ELF>6@@@8 @@@@ 000==ppp x|xx @8!@|88800hhhDDStd88800PtdsssQtdRtdx|xx/lib64/ld-linux-x86-64.so.2 GNUGNU/aA&} 7"{(GNU, @("I A" ,/129:<>?ACEGnG-k|.ś!qXGBׇK|l`oOÛk CffŹ@BE93b)% : ݣk~em kPILSc ]!ha)E K;n>s 7D*0Z" 40RJF 5n0? @? x@`A&i'pL@J`GiG Ak@p@@6&Q !iI  m!@I!"6P>npkUaBchmod__stack_chk_failfreeexitlseek64readdir64strdupclosediropen64strrchrunlinkstrtokstrlenrmdirread__memcpy_chkmkdir__vfprintf_chkgetpidreadlinkreallocexecvp__sprintf_chk__memmove_chk__fprintf_chkmalloc__libc_start_mainstderr__cxa_finalizestrchrcloserenameopendirgetuidaccessmemcpystrcmpstat64__errno_locationwritestrncmp__environlibc.so.6par_current_exec_ITM_deregisterTMCloneTableget_username_from_getpwuidpar_cleanup_edatapar_basenamepar_dirnamepar_mktmpdirsha_update__data_start__gmon_start___IO_stdin_usedpar_current_exec_proc_endpp_version_infopar_init_envsha_final__bss_startpar_findprogpar_setup_libpathpar_env_cleanpar_die_ITM_registerTMCloneTablesha_initGLIBC_2.14GLIBC_2.33GLIBC_2.4GLIBC_2.34GLIBC_2.3.4GLIBC_2.2.5/opt/hostedtoolcache/perl/5.42.0/x64/lib/5.42.0/x86_64-linux/COREuii ti ui xp707@Qq@@@@q@@@H@[?X@>h@[>x@=@`[=@@<@ [<@;ȥ@Z;إ@:@Z:@9@`Z9@@8(@ Z88@7H@Y7X@6h@Y6x@5@`Y5@@4@ Y4@3Ȧ@X3ئ@2@X2@1@`X1@@0(@ X08@/H@W/X@.h@W.x@-@`W-@@,@ W,@+ȧ@V+ا@*@V*@)@`V)@@((@ V(8@'H@U'X@&h@U&x@%@`U%@@$@ U$@#Ȩ@T#ب@"@T"@!@`T!@@ (@ T 8@H@SX@h@Sx@@`S@@@ S@ȩ@Rة@@R@@`R@@(@ R8@H@QX@h@Qx@@`Q@@@ Q@Ȫ@Pت@@P@@`P@@(@ P8@H@OX@h@Ox@ @`O @@ @ O @ ȫ@N ث@ @N @ @`N @@(@ N8@H@MX@h@Mx@@`M@@@ M@Ȭ@Lج@@L@@`L@@(@`H@$@X@?؏)D@;@=ȎЎ ؎     (08@HPX`hpx !"#$%&'(ȏ*Џ+HH_HtH5j^%l^@hfhfhfhfhfhfhfhrfhbfh Rfh Bfh 2fh "fh fhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfh fh!fh"fh#fh$fh%fh&f%N]fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%[fD%~[fD%v[fD%n[fD%f[fD%^[fD%V[fD%N[fD%F[fD%>[fD%6[fD%.[fD%&[fD%[fD%[fD%[fD%[fD%ZfD%ZfD%ZfD%ZfD%ZfD%ZfD%ZfD%ZfD%ZfD%ZfDAUATIUSH(dH%(HD$1j LHHHu_H\$H=;HI<$H H HHH=/o@HH50o@H)o@Ll$HufHsHHtqLHHUuHT$I4$H=<1H=&;1I4$HH=;1HT$I4$H=+<1rH\$LI$HNYI4$HH=k<1Bf1I^HHPTE11H=q#Yf.H=v@Hv@H9tHYHt H=yv@H5rv@H)HH?HHHtHXHtfD=mv@u+UH=XHt H=XIdEv@]wSHHdH%(H$1Hu6T$@tuHD1H$dH+%(u HĠ[}ff.fAWAVAUATUSHHL5Ru@MIIt<=uXE1IHt3McLLLHuB<#=tGH]HHuHH[]A\A]A^A_IAD$It<=uE)fDL)J\#HAmfD1@AVAUATUSHdH%(H$1Ht?Hu1H$dH+%(HĠ[]A\A]A^f.IHtL+Hx.Hhu}tfx.HHIEtMcLIILIHǾ1H J6QLHLtD$%=@tVLLH^LHP}.X}!I=HHIHt$HIHHI%L9LcD$N4<=HfPHt=uH)HL-p@J| MIEHtVHp@HKJ0<=t"u <=tHHu=1fDLLHuHD$dH+%('H([]A\A]A^A_@1fDTATHu@L=)p@I?LE1fHDAH8uDrMcJ p@ufHHL$p@HHLMcHL$LN4L8Ho@HAEDl$HHgfDLHEHno@HHMcN4D1_E1L7ATUSL$HH $L9uHdH%(H$1HH$L r1HAH d11SHߺHC1x2D`HMcL[HHtHcLHH"HH$dH+%(uHH[]A\T@AWAVAUATUSL$HH $L9uHdH%(H$1IHH=0Ht$ x/LHHtCLH=u04LH$dH+%(Hĸ[]A\A]A^A_HL-?0L5>1LHHHt;t~fHtHHtMH4HTIH9r!DHH9t:/tHILIDH=vOL1HH;uHt}.tAHm/f.}tL$LI1HLATL A/Ht$ LZYkD$(%=WLYBLH=.Ld S/HNHPHHEH[zf.ATUSL$HH $L9uHdH%(H$1H?HHPIHHHH,JD#H9rHH9t8/t/HHt-H9rXHH$dH+%(uIH[]A\ÐH$dH+%(u)HH=-[]A\vfD1ff.@AWAVAUATUH-y-SHdH%(HD$1H\$HH'HtBHcT$Hj@HHPHHtfDHPHHHuHHHuH--HHHtAHcT$H-j@HHPHHtDHPHHHuHHHuH-,HHvHtAHcT$Hi@HHPHHtDHPHHHuHH5HuH-p,HHHtAHcT$H}i@HHPHHtDHPHHHuHHHuH-,HHHtAHcT$H%i@HHPHHtDHPHHHuHHHuL%+HLnHtAHcT$Hh@HHPHHtDHPHHHuHL-HuL%4+HLHtAHcT$Huh@HHPHHtDHPHHHuHLHuL53+HLHtAHcT$Hh@HHPHHtDHPHHHuHL}HuL-*HLfHtAHcT$Hg@HHPHHtDHPHHHuHL%HuL=*HLHtAHcT$Hmg@HHPHHtDHPHHHuHLHuL=)HLHtAHcT$Hg@HHPHHtDHPHHHuHLuHuHH=)aHt HL1HH=)BHtHH=)HH=)HHt5LHD$dH+%(u>HHH5)[]A\A]A^A_HH=)HtHL,ff.HH= )dH%(HD$1Ht$Ht20 ЃHT$dH+%(uH1PXHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HH$HH=Je@HD$HD$ $D$0HD$BHATUSL$HH $L9uH1dH%(H$1AH HhHH?H0HDH)H)1HDHHD}HHvXHDH9rNH[@DHH9r7H H9uH)HH$dH+%(uOH[]A\f.HH\HH=B'1H=''1fHlHtHHff.@AVAUATL%&UHLSHdH%(HD$1Ht$Ht8Hu,HD$dH+%(u~HHL[]A\A]A^DHHIMtLHLISHIL %H &1UXZHD$dH+%(uLfAWH ,&AVfHnH %AUATUSHxH<$Hl$H= %HdH%(H$hH$HD$0HDŽ$HD$PfHnH%flfHnH%)D$ fHnfHnH N%flH%D$hfHnfHnH %flD$xfHnfl)D$@PHt 8HsH L8MLvLtLM6EHD$HEtZL-%fDLEH1LIM9LEICHL)HH9HBI)HMtEuLl$`H=:$DI}IHt;HsIHt8tHtLBIHuJf.Ll$ MeMt2A<$LMeIMuf.LXH\$IHHEMcLSML "IH#LPH #L1L_AXuLDAH$LÅtyH$MH=_@H$$H1%E1H$hdH+%(.HxL[]A\A]A^A_fDLIIH$%=@pD$LA9Z$%=CLHH="IHIH $HH9IH.LHƒ~>HH5"HT$I|6u"HT$BHA</@HH-!HH<0HH5!H-"L=B"ULL PMH "L1XZC[8uDHMUL LLSLP1hH LGtLLH=S L#fDE1 H|$@H\$@Ht HHt8u>H{HHu A L= A ASHD$HHIHtH$MH=-]@H&!H1g=fHhH$hdH+%(dHxH[]A\A]A^A_8H$L8@L11ADž'H1HpDH$H$*DH $H$*CACf$.HE1HqDuH$0(DHmH(HMLƄ$XH L LP1SOY^H$HPHHH$HH$H5VH|H$LDhH=61f.USHH=:HdH%(HD$1Ht$Ht0u Ht;u!HD$dH+%(urH[]f.H/HHHPHHEH5H5oHuHD$dH+%(uHH[]zf.AWHLG8AVAUATUSHdH%(H$1HL$HAMHIȉLHGLH H(I8%L IHIEL H HGL9ufoL$fo\$ HD$hHhfoT$0fo-wofofoPHfHfffofsfsffofof)@H9uLL^H~ H^LLHnHL$HHH $H yZ8yZLH1H!H1؍<HHHHIH LIAL1L!L1HHHL LT$D$LLHHOyZMH IH1‰H!L1LMIM Ll$AHHHEO(yZH MH1ЉL!IH1LMIM Ll$ ALIHEJ)yZL MH1IAL!H1HLHL Ll$(LIHJ/yZL IH1IAL!L1HHHL Ll$0LIHO,yZL IH1IAH!L1LIIM Ll$8AHHHEO*yZH MH1IH!L1LMIM Ll$@AHHHEO(yZH MH1IL!H1LMIM Ll$HALIHEJ)yZL MH1IAL!H1HLHL Ll$PLIHJ/yZL IH1IAL!L1HHHL Ll$XLIHO,yZL IH1IAH!L1LIIM Ll$`AHHHEO*yZH MH1IH!L1LMIM Ll$hAHHHEO(yZH MH1IL!H1LMIM Ll$pALIHEJ)yZL MH1IAL!H1HLHL Ll$xLHIJ/yZL IH1IAL!L1HHHL L$LIHO,yZL IH1IAH!L1LIIM F,"HHL$HH O"yZMH1IH!L1LMIM L$AHHHEO yZH MH1IL!H1LMIM ELMIIAM L$L1L!J)yZMH1IHLHL HLIHAL MEI1D1L$JnMHLIHL ҉HLHIAL$L ỈH$I1D1MnLMIHL ILIHEL IՉH$I1D1L9nLLHHH ILIHDL I‰I1E1NnHIIHL ҉ILIHEL IH$I1H$E1NnLMIHL IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1H$E1NnLMIHL IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMHIH$L IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMIHL H$IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$ I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMIHL IHHHEH$(H H׉H$0H1D1MH9nLIHL MIIM IHM1H$8E1INnHIHL ALIHEL MEI1IAD1MHnLIHL DHHܼHH I ΉH!M!I H$@HLMLMIIM ALIHEL H IAI!L!L L$HIMMLMIIM IALIHEL AI M!L!L L$PILMHLIHL LIHL H IAM!L!L L$XIMILIIIM IALIHEL AI I!L!L L$`IMMLMIIM AHHHEH H I։M!L!L L$hIMMLMIIM IALIHEL AI M!L!L L$pIMMLMIIM ALHIEL H IAM!L!L L$xILMHLIHL ILIHL AI M!L!L L$IMILIIIM ALIHEL H IAH!M!L L$IMMLMIIM IAHHHEH I M!H!L L$IMMLMIIM ALIHEL H IAI!L!L L$IMMLMIIM IALIHEL AI M!L!L L$ILMHLIHL LIHL H IAM!L!L L$IMILIIIM IALIHEL AI I!L!L L$IMMLMIIM AHHHEH H I։M!L!L L$IMMLMIIM IALIHEL I AM!L!L L$IMMLMIIM ALIHEL H IAM!L!L L$ILMHLIHL D9LIHHL AH L!L!H H$HLMH$HLIHL щHLIHAL H IAL!M!I J<8LL$LMHIL HLIHAI bL11H$HLMHLIHL MԉIHIIM MĉEM1D1L$IMILIIIM MIIEM L$LAIMMM1D1MILIHL IHHHEH DMI1LL$D1MHLHIIL щHLIHAI DIՉM1LL$E1MILIIHL ILIHEL L$ILMI1D1MHLIHL HLIHAI DỈLM1L$ E1MILIIHL ILIHEL L$ILMI1D1MHLIHL HLIHAI DI҉M1LL$0E1MILIHL щILHIEIL L$(ILMI1D1MHLIHL HLIHAI DIΉM1LL$@E1MILIHL ILIHEL L$8ILMI1D1MHLHIIL щHLIHAI DIՉM1LL$`E1MILIHL ILIHEL L$HILMEI1D1MHLIHL HLIHAI H$PHIHʉL1ID1MILIHL ‰ILIHEL L$XILMI1D1MHLIHL HLIHAI DI҉M1LL$pE1MLMIIM MEILIIM L$hAIH$xLMLM1D1MHLIHL MIIM EMHM1MED1ILMLIIIM DMIIM M1D1IHHHIAL Dn HNLVHHHHLn H DHFH$dH+%(uHĘ[]A\A]A^A_fDHfo H@0fo @x@fo @ HAWHcAVIAUATIUHo8SHHHw(HW0 H9HO(HHHHG0HcGxA?'A@EAEoIIݐoLH@EoKMoSU o[]0L9uAE)IcHr\IUIL$@HIT$8ITHTH)HI)HHrH1ItH4HH9rEt$xH[]A\A]A^A_ÐutHtAUAT$8tATfT@A@H|HA)E9EOMcLAD$xDAD$x@uLE)LI#AUAT$8ATT\AVLv8AUATUHSLn(HLf0LH?PD8Hcʃ8@L)t1ƒ9rHAfC8IF0AFAF LALLHHLHILH@@HH LHH AHH AHH HH HHH HH HCpHHHEHHEHeHEHCHEHCHEHCeHCEHCHEHCHE HCe HCE HCHE HCHE HCeHCEHC HEHC HEHC eHC E[]A\A]A^8I1)ЃrGINIIDHI)D|1҉փH<19re@u$UAI1fAT<AAD$HH%s/%s%s.%luexe/proc/%i/%s.PAR_TEMPPAR_PROGNAME:/PERL5LIBPERLLIBPERL5OPTPERLIOPAR_INITIALIZEDPAR_SPAWNEDPAR_CLEANPAR_DEBUGPAR_CACHEPAR_GLOBAL_DEBUGPAR_GLOBAL_TMPDIRPAR_TMPDIRPAR_GLOBAL_TEMPPAR_GLOBAL_CLEAN1lseek failedread failedLD_LIBRARY_PATHSYSTEM/tmpTEMPDIRTMPUSERUSERNAME%02x%s%s%s%spar-parl.parshort read%s%scache-%s%s%s%stemp-%u%s%s%stemp-%u-%u%slibperl.so%s: creation of private subdirectory %s failed (errno=%i) %s: private subdirectory %s is unsafe (please remove it and retry your operation) %s: creation of private cache subdirectory %s failed (errno= %i) %s: extraction of %s (custom Perl interpreter) failed (errno=%i) %s: extraction of %s failed (errno=%i) %s: exec of %s (custom Perl interpreter) failed (errno=%i) CACHE#EgܺvT2; @0Xp`$pl x00PLhP` pPzRx &D$4FJ w?9*3$"\ؽtнp AJq AA HBBB B(A0A8D@l 8D0A(B BBBI @xdBBB A(A0G~ 0A(A BBBK D@BBE D(D0M 0A(A BBBG HYBBB B(A0D8G` 8A0A(B BBBE <FAA H Q D  DABA  h( FBB B(A0A8H Q Go 8A0A(B BBBI OZA`&E\LtFAA H Q D  AABB Z  HABK HDFBB B(A0H8DPL 8K0A(B BBBE LiH P H hEAG<>BAA H Q D  AABK !HXLFBB H(G0D@~ 0D(A BBBJ dHGPaHA@,HFFIN B(A0A8G4]_Br 8D0A(B BBBG AKZA_DNIK  8D0A(B BBBM CFA4EAN0O AAK W DAE $nFBD A(DPL<hjBIB B(A0A8GB 8A0A(B BBBA IH@HFEE B(D0E8G@ 8A0A(B BBBB <UFFB A(D0 (A BBBM p707u 0 mxoX  a (h ooPooo00@0P0`0p00000000011 101@1P1`1p11111111122 202@2P2`2p222@(#) Packed by PAR::Packer 1.064_large_msgPerl_op_sibling_splicePerl_cv_set_call_checker_flagsPerl_newDEFEROPPL_destroyhookPerl_savesharedpvnPerl_init_stacksPerl_gv_overridePL_statgvPL_op_private_bitdefsPerl_save_helem_flagssignal@GLIBC_2.2.5PL_sv_constsstrspn@GLIBC_2.2.5Perl_newTRYCATCHOPPerl_dump_vindentPerl_newMETHOP_namedPerl_gv_AVaddmemmove@GLIBC_2.2.5Perl_sv_2nv_flagsPerl_sv_lenstrchr@GLIBC_2.2.5waitpid@GLIBC_2.2.5Perl_hv_placeholders_getPL_langinfo_svPerl_sv_setref_ivPerlIO_apply_layeraPL_regnode_infoPerl_sv_2pvutf8Perl_mg_findextPerl_load_modulePL_subversionPL_statnamePerl_sync_localePerl_newFOROPPL_clockticksocket@GLIBC_2.2.5fread@GLIBC_2.2.5rewinddir@GLIBC_2.2.5Perl_custom_op_get_fieldPerl_sv_setrv_noinc_mgPerl_find_runcvXS_utf8_native_to_unicodePerl_sv_destroyablePL_defgvPerl_my_pclosePerl_pv_displayPerl_save_aelem_flagsPerl_get_db_subperl_destructPL_breakable_sub_gengetenv@GLIBC_2.2.5Perl_sv_vcatpvf_mgeaccess@GLIBC_2.4alarm@GLIBC_2.2.5PL_def_layerlistPerl_call_methodPL_bodytargetPL_mod_latin1_ucPerl_PerlIO_filenomatch_unipropPerl_regexec_flagsPerl_newSTATEOPPL_diehookPerl_op_refcnt_unlockPL_tmps_floor__open64_2@GLIBC_2.7PL_strict_utf8_dfa_tabPL_unsafeXS_builtin_falsePerlIOBuf_get_cntgetservent@GLIBC_2.2.5Perl__new_invlist_C_arrayPerl_hv_iterkeysvPerl_utf8n_to_uvuniPerl_safesyscallocPL_EXACT_REQ8_bitmask__errno_location@GLIBC_2.2.5Perl_parse_subsignaturePerl_reg_numbered_buff_fetchPerl_sv_catpv_mgPerl_newCONSTSUBPerl_gv_fetchmeth_sv_autoloadPerl_sv_set_undefPL_inplacePerl_re_op_compilePL_core_reg_enginePerl_sv_setpvfPerl_op_parentPerl_op_clearaccept4@GLIBC_2.10Perl_class_prepare_initfield_parsePerl_sv_string_from_errnumPL_warn_nlfirst_sv_flags_namesPerl_PerlIO_errorPL_in_utf8_COLLATE_localePL_utf8_toupperPerl_hv_bucket_ratioPerl_save_pushptrPL_fold_latin1PerlIO_bytePerl_ck_warner_dPerl__to_utf8_title_flagsPerl_ptr_table_storePerl_save_set_svflagsPerl_newSVPerl_warn_problematic_localePerl_save_strlenPerl_noshutdownhookPerlIO_utf8sigaddset@GLIBC_2.2.5Perl_sv_pvPerl_debprofdumpPL_doswitchesPerl_sv_nolockingPerl_gv_init_svXS_mro_method_changed_inPerl_newLISTOPnPerl_mg_setPerl_regfree_internalPerlIO_tab_svPL_forkprocessPerl_pad_pushPerl_sv_resetPerl_isSCRIPT_RUNPerlIO_isutf8Perl_hv_rand_setPerl_sv_vcatpvfnPerl_sv_langinfoPL_custom_op_descsPerl_eval_svPerl_save_itemPerl_debopPerl_sv_2ioPL_body_arenas__stack_chk_fail@GLIBC_2.4PL_reg_intflags_namePL_initavkillpg@GLIBC_2.2.5PerlIO_default_layerPerl_messPerl_safesysreallocPerl_do_uniprop_matchPerl_sv_vcatpvfXS_DynaLoader_dl_install_xsubPL_perlio_fd_refcnt_sizePerlIOCrlf_pushedPerl_getcwd_svPerl_try_amagic_unPerlIO_modestrPerl_utf8_lengthPerlIO_clone_listPerl_hv_fetch_entPerl_sv_setuv_mgPerl_sv_setrv_inc_mgstrcmp@GLIBC_2.2.5Perl_moreswitchesPerl_ptr_table_splitPerl_newAVREFPerl_get_cvn_flagsPerl_newSVivPerl_save_shared_pvrefPerl_csighandler1Perl_do_magic_dumpPL_padixPerl_lex_read_spacePL_no_usymPerl_mro_get_private_dataPerl_cop_store_labelPerl_save_boolPerl_newSVnvXS_re_regnames_countsetnetent@GLIBC_2.2.5Perl_set_contextPL_in_utf8_turkic_localePerlIOScalar_eofPerl_sv_vsetpvf_mgPL_valid_types_NV_setPL_restartjmpenvPerl_hv_common_key_lenPerl_sv_unrefPerl_do_pmop_dumpPL_no_localize_refPL_DBcontrolPL_LB_invlistPerlIO_rewindPerl_re_intuit_stringPL_registered_mrosgetcwd@GLIBC_2.2.5send@GLIBC_2.2.5PL_numeric_namePerl_grok_bslash_xgetpwent@GLIBC_2.2.5getgrgid@GLIBC_2.2.5PerlIO_teardownPerl_newSV_falsePerl_get_avPerl_hv_itervalPL_statcachePerl_reg_named_buff_allhv_flags_namessetreuid@GLIBC_2.2.5Perl_langinfoPerl_croak_popstackXS_utf8_unicode_to_nativePerl_hv_fillPerl_lex_startPL_psig_pendlocaleconv@GLIBC_2.2.5Perl_sv_utf8_downgradePL_srand_overridePerl_my_popen_listPL_dowarnPerl_newMETHOPPerl_PerlIO_get_ptrXS_Internals_hv_clear_placeholdPerl_share_hekPerl_save_freeopPerl_sv_setpvn_freshPerlIOPending_seekXS_utf8_upgradechroot@GLIBC_2.2.5Perl_grok_number_flagsPerl_pmop_dumpPerl_set_numeric_standardPerl_sv_report_usedPL_collxfrm_basePL_magic_vtablesPL_perldblstat64@GLIBC_2.33PL_rpeeppPerl_gv_add_by_typePL_runops_stdgetnetbyaddr@GLIBC_2.2.5Perl_csighandlerPL_utf8_perl_idcontPL_max_intro_pendingPerlIOCrlf_set_ptrcntPL_op_maskPerl_newFORMPerl_block_startPerl_sv_cmp_localePerl_get_cvPerl_class_prepare_method_parsePL_op_private_bitfieldsPerl_delimcpy_no_escapePL_sublinePerlIO_tmpfile_flagsPerl_gv_fetchmethod_pv_flagsPerl_mg_findPL_op_descPerl_foldEQ_utf8_flagsPL_hexdigitgetprotobynumber@GLIBC_2.2.5Perl_pad_allocPL_latin1_lcgetuid@GLIBC_2.2.5PerlIO_list_freePerl_my_clearenvPerl_gv_fetchmeth_pvPL_sig_namePerl_sv_del_backrefXS_UNIVERSAL_canPerl_newAVhvPerl_mortal_svfunc_xPL_magic_vtable_namesPerl_apply_attrs_stringPerl_padnamelist_storePL_blockhooksPerl_sv_regex_global_pos_getXS_builtin_created_as_stringPL_multideref_pcPerl_sv_isobjectPerl_gv_efullname3Perl_newAVPL_sub_generationPerl_utf8_to_utf16_basePerl_uvuni_to_utf8Perl_newSVhek_mortalPL_laststypePL_comppadendgrent@GLIBC_2.2.5memmem@GLIBC_2.2.5endhostent@GLIBC_2.2.5Perl_save_re_contextPL_top_envPerl_refPerl_Slab_FreePerl_my_lstat_flagsPerl_my_strtodPerl_force_out_malformed_utf8_message_Perl_gv_fetchmethod_sv_flags__ctype_tolower_loc@GLIBC_2.3PerlIOBase_noop_okgetservbyport@GLIBC_2.2.5PL_wcrtomb_psPerl_sv_newrefPerl_init_i18nl10nmemcmp@GLIBC_2.2.5Perl_PerlIO_unreadPerl_newNULLLISTcalloc@GLIBC_2.2.5PL_curstnamePL_no_modifyPL_utf8_markPL_uudmapPL_defoutgvPerl_sv_growPerl_mro_meta_initPerlIO_tmpfilePerl_sv_2pvbyte_nolenPerl_upg_versionPerl_save_aptrshmget@GLIBC_2.2.5feof@GLIBC_2.2.5PerlIOUtf8_pushedPerl_cv_get_call_checkerop_flags_namesPerl_PerlIO_writePerl_grok_atoUVPL_envgvPerl_newPVOPPerlIOPending_pushedPerl_whichsig_pvPL_Private_UsePerl_PerlIO_stdinPL_e_scriptPerl_report_uninitPerl_dump_evalfclose@GLIBC_2.2.5Perl_save_gpPL_SvPerl_sv_derived_from_pvPerlIOPending_fillPerl_sv_len_utf8_nomgrecvfrom@GLIBC_2.2.5PL_reg_curpmPerl_suspend_compcvPL_extended_utf8_dfa_tabPL_restartopPerl_reentrant_initPerl_sv_getsPerlIO_releaseFILEPerl_do_aexecPL_hv_fetch_ent_mhPerl_av_popPerlIOBase_closePerl_parse_termexprPerl_class_apply_attributesPerl_grok_octsemop@GLIBC_2.2.5PL_origargcPL_valid_types_NVXPerl_sv_derived_from_pvnPerl_new_stackinfo_flagsPL_no_sock_funcXS_UNIVERSAL_DOESPL_globhookPerl_sv_magicextXS_re_regexp_patternPerlIOCrlf_unreadPerl_refcounted_he_freePL_DBcvPerl_safesysmallocPerl_newSLICEOPPerl_newCVREFPerl_amagic_deref_callPerl_gv_handlerPerl_sv_copypvPerl_hv_delete_entPL_cv_has_evallseek64@GLIBC_2.2.5perlsio_binmodePerl_hv_placeholders_setPerl_sv_copypv_flagsPerl_dump_subendservent@GLIBC_2.2.5PerlIO_getnamePL_hook__require__beforePerl__invlist_intersection_maybe_complement_2ndPerlIOUnix_refcnt_incPerl_reg_qr_packageXS_utf8_is_utf8PL_strxfrm_NUL_replacementPerl_seedPerl_savestack_grow_cntPerl_newSVpvPerl_sv_regex_global_pos_clearPL_scopestack_ixPerl_sv_strftime_tmPerl_amagic_callPerl_whichsig_svPerl_lex_grow_linestrPerl_pad_findmy_pvnPL_lastgotoprobePerl_class_setup_stashPerl_cv_get_call_checker_flagsPerl_op_append_elemsetlinebuf@GLIBC_2.2.5gethostent@GLIBC_2.2.5PL_unlockhookPerl_sv_catpvn_mgunsetenv@GLIBC_2.2.5Perl_valid_identifier_svPL_runops_dbgPerl_parse_stmtseqPL_hash_state_wmsgget@GLIBC_2.2.5Perl_uiv_2bufXS_utf8_validPL_no_symrefPerl_save_pptrPerlIOBase_dupPerl_localtime64_rPerl_reg_numbered_buff_storeclosedir@GLIBC_2.2.5Perl_savestack_growPerl_mg_sizePerl_sv_utf8_upgrade_flags_growXS_NamedCapture_flagsPerl_gp_refPerl_PerlIO_set_ptrcnt__sprintf_chk@GLIBC_2.3.4PerlIOBuf_poppedPerl_setlocalePerl_sv_pos_b2u_flagsPerlIOUnix_seekstderr@GLIBC_2.2.5Perl_av_pushPerl_sv_cat_decodeXS_builtin_infPerl_sv_usepvn_flagsPerl_sv_2iv_flagsPerl_mortal_destructor_svstrcspn@GLIBC_2.2.5PL_perlio_fd_refcntPerl_amagic_appliesPerl_tmps_grow_pPerl_PerlIO_get_basesurrogate_cp_formatXS_re_is_regexpPL_strxfrm_is_behavedPerl_to_uni_upperPerlIO_opennPerl_repeatcpyPL_do_undumpPL_utf8cachePerl_av_unshiftPerl_validate_protoPL_tmps_ixPL_stack_maxPerl_my_atofPerlIOBuf_dupPL_WARN_NONEPerl_gv_stashpvnPerl_newASSIGNOPclearerr@GLIBC_2.2.5XS_DynaLoader_dl_undef_symbolsaccess@GLIBC_2.2.5fork@GLIBC_2.2.5sigemptyset@GLIBC_2.2.5XS_PerlIO__Layer__NoWarningsPL_no_myglobmodf@GLIBC_2.2.5PL_XPosix_ptrsgetppid@GLIBC_2.2.5PerlIO_vprintfPL_statusvalue_posixPerl_croak_svPerl_gv_stashpvPerl_av_arylen_pPerl_grok_numberPerl_sv_unmagicextunlinkat@GLIBC_2.4PL_InMultiCharFoldPerl_PerlIO_clearerrPerl_fatal_warnerfopen64@GLIBC_2.2.5Perl_rpp_free_2_PerlIOUnix_tellPerl_block_endPerl_mg_find_mglobPL_memory_wrapdlsym@GLIBC_2.34Perl_sv_catsv_mgXS_builtin_load_modulesendto@GLIBC_2.2.5Perl_re_intuit_startPerl_croak_xs_usagebind@GLIBC_2.2.5PL_regmatch_slabPL_pad_reset_pendingPL_uuemapPL_mmap_page_sizePL_op_private_validPerl_new_versionPerl_sv_setref_uvPerl_grok_hexPerl_newHVREFPerl_croakPerl_cast_ulongfwrite@GLIBC_2.2.5Perl_reg_named_buff_scalarPerl_strxfrmdeprecated_property_msgsPerl_sv_2cvrealloc@GLIBC_2.2.5PL_keyword_pluginPerlIOPending_flushPerl_sv_utf8_encodePerlIO_list_pushPerl_PerlIO_stderrPerl_sv_pvutf8n_forcePerl_padnamelist_freePerl_sv_does_pvnsetlocale@GLIBC_2.2.5Perl_safesysfreePL_DBsubPerl_call_pvPerl_newGIVENOPPerlIOCrlf_flushshmctl@GLIBC_2.2.5Perl_push_scopePerl_cast_uvPerlIOStdio_tellPerl_taint_envPerl_my_lstatPerl_newXS__sigsetjmp@GLIBC_2.2.5Perl_op_append_listPerl_reg_numbered_buff_lengthPerlIOUnix_readPerl_hv_commonPL_cop_seqmaxPerl_save_pushi32ptrPerl_vwarnerPerlIOBase_setlinebufPL_ctype_namePL_InBitmapPerl_mg_freePerl_newSUBPerl_sortsvPerl_multideref_stringifyPerl_newSVuvPL_delaymagic_euidPerl_sv_2boolPerl_grok_bslash_cPerl_save_clearsvPerl_newPADNAMELISTPerl_hv_iterkeyPerl_uvoffuni_to_utf8_flags_msgsPerl_re_compilePerl_sys_init3localtime@GLIBC_2.2.5Perl_newSV_truePL_magic_dataPerl_unshare_hekPerl_sv_taintedPL_scratch_langinfoPerlIO_ungetcPerl_scan_versionPL_random_statePerl_multiconcat_stringifyPerlIO_crlfPerl_pad_findmy_svPL_charclassPerl_newHVPerlIO_rawPL_minus_aPerl_sv_decPerl_cxincPerl_hv_name_setPL_savestack_maxPerlIO_getposPL_known_layersPerl_sv_catpvnPerl_reentrant_sizePL_internal_random_statePL_ors_svPerl__to_fold_latin1Perl_hv_delayfree_entPerl_sv_rvunweakenPerl_dup_warningsPL_utf8_foldclosuresPL_padname_undefPerl_gv_fullname4Perl_savetmpsPerl_utf8_to_uvuniPL_xsubfilenamePerl_refcounted_he_chain_2hvPerl_cv_const_svPerlIO_sv_dupftello64@GLIBC_2.2.5PerlIO_allocatestrftime@GLIBC_2.2.5Perl_sv_2nvPerl_resume_compcvsetservent@GLIBC_2.2.5PL_sv_arenarootPerl_sv_derived_fromPerl_utf16_to_utf8PL_block_typePL_minus_nPL_curcopdbPerl_sv_pvn_forceaccept@GLIBC_2.2.5Perl_save_I16pow@GLIBC_2.29Perl_die_svPerl_lex_next_chunksqrt@GLIBC_2.2.5Perl_str_to_versionPerl_gv_fetchmethod_autoloadPerl_save_generic_svrefPL_sv_placeholderPerlIOUnix_dupPerl_sv_catpvf_mgPL_ppaddrPerlIO_intmode2strPerl_cv_clonePL_strategy_socketpairPerl_newSVpvfPerl_ckwarnPL_op_namePerl_unsharepvnPerl_mro_package_movedPerl_init_tmumask@GLIBC_2.2.5memcpy@GLIBC_2.14PerlIOBase_openPerl_do_op_dumpPL_warn_localePerl_sv_strftime_intssetgroups@GLIBC_2.2.5PL_strategy_socketPerl_start_subparsefchown@GLIBC_2.2.5PL_warnhookPL_main_cvPerl_av_existsPerl_grok_bslash_oPL_sharehookPL_incgvsetprotoent@GLIBC_2.2.5PL_naPerl_sv_uni_displayPL_varies_bitmaskPerl_newSVpvndup3@GLIBC_2.9Perl_newATTRSUB_xPL_delaymagic_uidPerl_dump_allPerl_class_add_fieldPerl_new_stackinfoPerl_newSVpvn_flagsPerl_do_sprintfXS_PerlIO__Layer__findPerl_sv_pos_u2bPerl_op_classPL_versionPL_WB_invlistPerl_refcounted_he_fetch_pvgetpwnam@GLIBC_2.2.5PL_unitcheckav_savePL_debug_padsin@GLIBC_2.2.5Perl_fbm_instrPL_utf8_tosimplefoldrename@GLIBC_2.2.5Perl_hv_eiter_setPerl_hv_placeholders_pPerl_markstack_growPL_runopsPL_stack_basePerl_gv_checkPerlIOUnix_closePerl_sv_setiv_mgPL_revisionPerl_locale_panicPerl_skipspace_flagsPL_hash_rand_bitsstrtod@GLIBC_2.2.5PL_ZeroPL_op_private_bitdef_ixPerl_pad_add_anonstdout@GLIBC_2.2.5PerlIOBuf_readXS_Internals_SvREFCNTXS_utf8_downgradereaddir64@GLIBC_2.2.5PerlIOBase_filenoPerl_save_freercpvPerl_newRVinjected_constructormkdir@GLIBC_2.2.5Perl_mg_free_typePerl_cx_dumpshmat@GLIBC_2.2.5Perl_ptr_table_newPL_utf8_tolowerfflush@GLIBC_2.2.5Perl_mg_magicalPerl_debstackptrsPerl_PerlIO_set_cntPerl_sv_sethekPerl_rsignalPerl_sv_backoffPerl_Gv_AMupdatePerl_dowantarrayPL_origalenPL_parserPerl_save_destructor_xPL_formtargetXS_Internals_SvREADONLYPL_deBruijn_bitpos_tab32Perl_sv_2pv_flagsPerl_sv_magicPerl_my_atof2Perl_sv_utf8_decodedlclose@GLIBC_2.34PL_utf8skipPerl_lex_stuff_pvPerl_lex_read_togetservbyname@GLIBC_2.2.5PerlIO_stdoutfPerl_init_named_cv.symtab.strtab.shstrtab.note.gnu.property.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.plt.data.bss.comment .$Ao0K 33ثS.s[oRRRho8a8a wXbXb@B||HZ  @<``p0<YY_`` M ]8]8G88:::: : : ;;;;;;0@;@; < <o 0 <- <8  8=_2?TABLE_59UC_AUX_TABLE_60UC_AUX_TABLE_61UC_AUX_TABLE_62UC_AUX_TABLE_63UC_AUX_TABLE_64UC_AUX_TABLE_65UC_AUX_TABLE_66UC_AUX_TABLE_67UC_AUX_TABLE_68UC_AUX_TABLE_69UC_AUX_TABLE_70UC_AUX_TABLE_71UC_AUX_TABLE_72TC_AUX_TABLE_1TC_AUX_TABLE_2TC_AUX_TABLE_3TC_AUX_TABLE_4TC_AUX_TABLE_5TC_AUX_TABLE_6TC_AUX_TABLE_7TC_AUX_TABLE_8TC_AUX_TABLE_9TC_AUX_TABLE_10TC_AUX_TABLE_11TC_AUX_TABLE_12TC_AUX_TABLE_13TC_AUX_TABLE_14TC_AUX_TABLE_15TC_AUX_TABLE_16TC_AUX_TABLE_17TC_AUX_TABLE_18TC_AUX_TABLE_19TC_AUX_TABLE_20TC_AUX_TABLE_21TC_AUX_TABLE_22TC_AUX_TABLE_23TC_AUX_TABLE_24TC_AUX_TABLE_25TC_AUX_TABLE_26TC_AUX_TABLE_27TC_AUX_TABLE_28TC_AUX_TABLE_29TC_AUX_TABLE_30TC_AUX_TABLE_31TC_AUX_TABLE_32TC_AUX_TABLE_33TC_AUX_TABLE_34TC_AUX_TABLE_35TC_AUX_TABLE_36TC_AUX_TABLE_37TC_AUX_TABLE_38TC_AUX_TABLE_39TC_AUX_TABLE_40TC_AUX_TABLE_41TC_AUX_TABLE_42TC_AUX_TABLE_43TC_AUX_TABLE_44TC_AUX_TABLE_45IVCF_AUX_TABLE_1IVCF_AUX_TABLE_2IVCF_AUX_TABLE_3IVCF_AUX_TABLE_4IVCF_AUX_TABLE_5IVCF_AUX_TABLE_6IVCF_AUX_TABLE_7IVCF_AUX_TABLE_8IVCF_AUX_TABLE_9IVCF_AUX_TABLE_10IVCF_AUX_TABLE_11IVCF_AUX_TABLE_12IVCF_AUX_TABLE_13IVCF_AUX_TABLE_14IVCF_AUX_TABLE_15IVCF_AUX_TABLE_16IVCF_AUX_TABLE_17IVCF_AUX_TABLE_18IVCF_AUX_TABLE_19IVCF_AUX_TABLE_20IVCF_AUX_TABLE_21IVCF_AUX_TABLE_22IVCF_AUX_TABLE_23IVCF_AUX_TABLE_24IVCF_AUX_TABLE_25IVCF_AUX_TABLE_26IVCF_AUX_TABLE_27IVCF_AUX_TABLE_28LC_AUX_TABLE_1CF_AUX_TABLE_29CF_AUX_TABLE_30CF_AUX_TABLE_31CF_AUX_TABLE_32CF_AUX_TABLE_33CF_AUX_TABLE_34CF_AUX_TABLE_35CF_AUX_TABLE_36CF_AUX_TABLE_37CF_AUX_TABLE_38CF_AUX_TABLE_39CF_AUX_TABLE_40CF_AUX_TABLE_41CF_AUX_TABLE_42CF_AUX_TABLE_43CF_AUX_TABLE_44CF_AUX_TABLE_45CF_AUX_TABLE_46CF_AUX_TABLE_47CF_AUX_TABLE_48CF_AUX_TABLE_49CF_AUX_TABLE_50CF_AUX_TABLE_51CF_AUX_TABLE_52CF_AUX_TABLE_53CF_AUX_TABLE_54CF_AUX_TABLE_55CF_AUX_TABLE_56CF_AUX_TABLE_57CF_AUX_TABLE_58CF_AUX_TABLE_59CF_AUX_TABLE_60CF_AUX_TABLE_61CF_AUX_TABLE_62CF_AUX_TABLE_63CF_AUX_TABLE_64CF_AUX_TABLE_65CF_AUX_TABLE_66CF_AUX_TABLE_67CF_AUX_TABLE_68CF_AUX_TABLE_69CF_AUX_TABLE_70CF_AUX_TABLE_71CF_AUX_TABLE_72CF_AUX_TABLE_73util.cS_ckwarn_commonS_with_queued_errorsoomp.2S_mess_allocunderscore.0DynaLoader.cmy_cxtSaveError.constprop.0__FRAME_END__Perl_pp_shmwritePerl_package_versionPerl_sighandlerPerl_setfd_inhexecPerl_pp_padhvPerl_pp_entertryPerl_ck_existsPerl_pp_nextPerl_pp_emptyavhvPerl_hv_ename_deletePerl_find_scriptPerl_pp_scomplementPerl_pp_entergivenPerl_ck_anoncodePerl_pp_ftrreadPerl_pp_classnamePerl_do_seekPerl_my_mkstemp_cloexecPerl_pp_iterPerl_pp_ehostentPerl_pp_leavewritePerl_magic_setarylenPerl_magic_set_all_envPerl_do_msgsndPerl_pp_right_shiftPerl_ck_evalPerl_pp_sselectPerl_pp_refgenPerl_dump_all_perlPerl_pp_stringifyPerl_pp_sbit_orPerl_PerlSock_socketpair_cloexecPerl_pp_methodPerl_ck_helemexistsorPerl_ck_concatPerl_check_hash_fields_and_hekifyPerl_croak_no_memPerl_ck_substrPerl_pp_enterloopPerl_hv_pushkvPerl_pp_sassignPerl_cv_clone_intoPerl_pp_undefPerl_yyerror_pvnPerl_pp_dbstatePerl_pp_definedPerl_XS_builtin_indexedPerl_do_exec3Perl_populate_anyof_bitmap_from_invlistPerl_pp_enterwritePerl_warn_elem_scalar_contextPerl_opslab_force_freePerl_pp_chrPerl_write_to_stderrPerl_pp_padavPerl_hv_kill_backrefsPerl_pp_helemexistsorPerl_pp_indexPerl_invertPerl_allocmyPerl_study_chunkPerl_pp_syscallPerl_mg_localizePerl_boot_core_PerlIOPerl_do_shmioPerl_pp_existsPerl_pp_lastPerl_boot_core_UNIVERSALPerl_pp_selectPerl_force_locale_unlockPerl_magic_sethookallPerl_pp_gnetentPerl_pp_aelemfastPerl_defelem_targetPerl_vivify_refPerl_ck_rfunPerl_pp_andPerl_sv_add_backrefPerl_pp_aslicePerl_magic_clearenvPerl_pp_unpackPerl_pp_xorPerl_free_tied_hv_poolPerl_pp_complementPerl_ck_definedPerl_sv_clean_allPerl_magic_sethintPerl_tied_methodPerl_magic_freecollxfrmPerl_pp_closePerl_no_bareword_filehandlePerl_pp_returnPerl_do_eofPerl_pp_warnPerl_ck_grepPerl_ck_smartmatchPerl_jmaybePerl_prepare_export_lexicalPerl_sv_free_arenasPerl_pp_sysopenPerl_ck_repeatPerl_magic_clearsigPerl_add_above_Latin1_foldsPerl_make_triePerl_ck_refassignPerl_op_unscopePerl_ck_requirePerl_find_lexical_cvPerl_pp_pushPerl_do_readlinePerl_pmruntimePerl_init_debuggerPerl_magic_setregexpPerl_pp_sprintfPerl_magic_regdatum_get__GNU_EH_FRAME_HDRPerl_gv_stashsvpvn_cached_finiPerl_pp_shostentPerl_pp_i_lePerl_pp_blessedPerl_pp_anonhashPerl_pp_sbit_andPerl_ck_returnPerl_pp_filenoPerl_magic_clearhookPerl_pp_chrootPerl_pp_i_gePerl_newSVavdefelemPerl_pp_lvavrefPerl_mem_collxfrm_Perl_my_strerrorPerl_pp_rewinddirPerl_pp_eqPerl_do_open_rawPerl_pp_i_gtPerl_magic_setsigPerl_init_dbargsPerl_scalarvoidPerl_pp_open_dirPerl_populate_bitmap_from_invlistPerl_ck_trycatchPerl_pp_method_redirPerl_magic_setsubstrPerl_pp_sinPerl_pp_tellPerl_pp_gelemPerl_pp_execPerl_ck_truncPerl_ck_lengthPerl_my_mkostemp_cloexec_GLOBAL_OFFSET_TABLE_Perl_magic_clearpackPerl_pp_listenPerl_pp_binmodePerl_coresub_opPerl_pp_chownPerl_cmpchain_startPerl_pp_multiderefPerl_magic_clear_all_envPerl_pp_poptryPerl_nextargvPerl_magic_setutf8Perl_pp_repeatPerl_rxres_savePerl_find_runcv_wherePerl_pp_isaPerl_pp_seqPerl_do_dump_padPerl_do_transPerl_pp_nextstatePerl_pp_resetPerl_pp_openPerl_ck_matchPerl_start_globPerl_rpeepPerl_sighandler1Perl_pp_grepwhilePerl_pp_sortPerl_pp_deletePerl_pp_catchPerl_pad_add_weakrefPerl_magic_copycallcheckerPerl_pp_substcontPerl_pp_ucfirstPerl_yyerror_pvPerl_pp_ftrownedPerl_applyPerl_magic_getarylenPerl_padlist_storePerl_get_opargsPerl_yyquitPerl_ck_funPerl_oopsAVPerl_setfd_cloexec_or_inhexec_by_sysfdnessPerl_pp_ncomplementPerl_pp_vecPerl_listPerl_pp_readdirPerl_parser_free_nexttoke_opsPerl_get_regclass_aux_dataPerl_unimplemented_opPerl_do_printPerl_ck_eachPerl_pp_scmpPerl_pp_backtickPerl_die_unwindPerl_pp_i_ltPerl_magic_getuvarPerl_ck_entersub_args_corePerl_pp_i_subtractPerl_pp_mapwhilePerl_populate_isaPerl_magic_clearisaPerl_rsignal_restorePerl_magic_setPerl_magic_methcallPerl_pp_regcompPerl_pp_gvPerl_ck_methodPerl_pp_stubPerl_op_varnamePerl_populate_invlist_from_bitmapPerl_pp_multiconcatPerl_pp_timePerl_pp_cryptPerl_magic_setvecPerl_pp_diePerl_pp_av2arylenPerl_notify_parser_that_encoding_changedPerl_pp_substPerl_hfree_next_entryPerl_pp_requirePerl_sighandler3Perl_pp_is_weakPerl_av_extend_gutsPerl_pp_rv2avPerl_pp_printPerl_pp_pushdeferPerl_pp_srandPerl_check_utf8_printPerl_build_infix_pluginPerl_cv_const_sv_or_avPerl_pp_cmpchain_andPerl_gv_setrefPerl_magic_freearylen_pPerl_pp_is_boolPerl_pp_bit_andPerl_pp_renamePerl_construct_ahocorasick_from_triePerl_pp_matchPerl_magic_getsubstrPerl_pp_i_eqPerl_pp_powPerl_pp_enteriterPerl_magic_setnonelemPerl_magic_scalarpackPerl_init_unipropsPerl_pp_lePerl_newSTUBPerl_opslab_free_nopadPerl_pp_dividePerl_pp_enterevalPerl_pp_argdefelemPerl_pp_method_namedPerl_PerlLIO_dup_cloexecPerl_pp_setpgrpPerl_do_kvPerl_pp_avhvswitchPerl_magic_getdebugvarPerl_magic_nextpackPerl_magic_clearhookallPerl_magic_setisaPerl_magic_clearhintPerl_pp_forkPerl_debug_hash_seedPerl_pp_pipe_opPerl_pp_rcatlinePerl_magic_getPerl_pp_syswritePerl_pp_methstartPerl_pp_akeysPerl_finish_export_lexicalPerl_pp_refassignPerl_cv_undef_flagsPerl_pp_entersubPerl_magic_setuvarPerl_pp_closedirPerl_magic_getsigPerl_do_semopPerl_create_eval_scopePerl_av_nonelemPerl_candoPerl_pp_bit_orPerl_peepPerl_pp_constPerl_pp_truncatePerl_magic_sethookPerl_pp_left_shiftPerl_pp_method_redir_superPerl_pp_leavetrycatchPerl_pp_ceilPerl_pp_readlinkPerl_boot_core_builtinPerl_pp_ncmpPerl_yyerrorPerl_ck_listiobPerl_pp_flockPerl_magic_setdebugvarPerl_invmap_dumpPerl_pp_shutdownPerl_magic_freedestructPerl_ck_lfunPerl_oopsHVPerl_magic_freeovrldPerl_pp_anonlistPerl_pp_unstackPerl_my_unexecPerl_pp_i_negatePerl_op_prune_chain_headPerl_magic_sizepackPerl_isinfnansvPerl_ck_spairPerl_pp_reversePerl_dump_packsubs_perlPerl_mro_isa_changed_inPerl_pp_posPerl_pp_introcvPerl_pp_concat__TMC_END__Perl_scan_commitPerl_do_open6Perl_pp_exitPerl_ck_isaPerl_pp_lengthPerl_pp_prtfPerl_croak_no_mem_extPerl_pp_snePerl_my_attrsPerl_pp_linkPerl_pp_getcPerl_ck_eofPerl_pp_callerPerl_do_msgrcvPerl_pp_i_dividePerl_ck_execPerl_pp_prototypePerl_subsignature_finishPerl_magic_wipepackPerl_pp_i_moduloPerl_pp_predecPerl_PerlLIO_dup2_cloexecPerl_dofilePerl_pp_smartmatchPerl_pp_shift__dso_handlePerl_pp_ordPerl_pp_leavetryPerl_pp_aassignPerl_pp_ftisPerl_pp_getloginPerl_pp_srefgenPerl_do_aexec5Perl_pp_anoncodePerl_parse_unicode_optsPerl_pp_unshiftPerl_do_ncmpPerl_pad_swipePerl_ck_selectPerl_pp_i_addPerl_pp_leavePerl_pp_sockpairPerl_pp_gotoPerl_dump_sub_perlPerl_pp_intPerl_join_exactPerl_pp_rv2gvPerl_do_ipcgetPerl_ck_classnamePerl_croak_callerPerl_pp_initfieldPerl_pad_leavemyPerl_ck_splitPerl_subsignature_append_positionalPerl_pp_postincPerl_pp_chdirPerl_setfd_inhexec_for_sysfdPerl_pp_splicePerl_pp_hslicePerl_do_vecgetPerl_pp_gserventPerl_pp_nbit_orPerl_sv_resetpvnPerl_pp_studyPerl_do_ipcctlPerl_pp_preincPerl_pp_clonecvPerl_reg_add_dataPerl_pp_setpriorityPerl_pp_wantarrayPerl_pp_getppidPerl_ck_tellPerl_pp_reftypePerl_alloc_LOGOPPerl_opslab_freePerl_is_graphemePerl_pp_fttextPerl_pp_tmsPerl_magic_existspackPerl_pp_nullPerl_pp_sleepPerl_do_vopPerl_magic_settaintPerl_get_extended_os_errnoPerl_varnamePerl_pp_pushmarkPerl_pp_anonconstPerl_pp_formlinePerl_PerlSock_socket_cloexecPerl_pp_regcresetPerl_pp_leavewhenPerl_ck_bitopPerl_magic_setsigallPerl_PerlLIO_open_cloexecPerl_cv_forget_slabPerl_pp_rmdirPerl_ck_ftstPerl_ssc_initPerl_pp_semgetPerl_pp_subtractPerl_pp_lslicePerl_PerlLIO_open3_cloexecPerl_magic_getvecPerl_get_ANYOFHbbm_contentsPerl_ck_prototypePerl_pad_freePerl_pp_gePerl_ck_svconstPerl_sv_clean_objsPerl_keywordPerl_pp_lockPerl_pp_ftlinkPerl_pp_quotemetaPerl_ck_shiftPerl_pp_absPerl_setfd_cloexecPerl_magic_setmglobPerl_parser_freePerl_do_vecsetPerl__to_upper_title_latin1Perl_magic_getposPerl_pp_leavegivenPerl_pp_alarmPerl_pp_kvaslicePerl_sv_kill_backrefsPerl_pp_getpriorityPerl_pp_umaskPerl_cmpchain_extendPerl_pp_schopPerl_magic_setposPerl_do_sysseekPerl_magic_freeutf8Perl_setfd_cloexec_for_nonsysfdPerl_magic_regdata_cntPerl_magic_setdefelemPerl_mode_from_disciplinePerl_abort_executionPerl_pp_i_multiplyPerl_pp_socketPerl_ck_sortPerl_ck_nullPerl_magic_getnkeysPerl_magic_setnkeysPerl_ck_stringifyPerl_sv_2numPerl_closest_copPerl_ck_joinPerl_hv_auxallocPerl_pp_splitPerl_PerlSock_accept_cloexecPerl_pp_ucPerl_ck_indexPerl_ck_readlinePerl_hv_ename_addPerl_pp_padrangePerl_pp_rv2svPerl_pp_gmtimePerl_ck_rvconstPerl_pp_substr_leftPerl_pp_entertrycatchPerl_packagePerl_no_bareword_allowedPerl_ck_globPerl_watchPerl_pp_atan2Perl_deb_stack_allPerl_cmpchain_finishPerl_pp_systemPerl_pp_telldirPerl_wait4pidPerl_ck_openPerl_pp_multiplyPerl_pp_rangePerl_pp_seekdirPerl_pp_enterPerl_pp_transPerl_pp_flopPerl_ck_sassignPerl_pp_runcvPerl_pp_nePerl_pp_mkdirPerl_bind_matchPerl_core_prototypePerl_newXS_len_flagsPerl_pad_block_startPerl_pp_aelemfastlex_storePerl_magic_gettaintPerl_rsignal_savePerl_magic_freemglobPerl_do_tellPerl_pp_cond_exprPerl_pp_octPerl_pp_untiePerl_pp_chopPerl_report_redefined_cvPerl_pp_aelemPerl_pp_ltPerl_magic_clearhintsPerl_pp_joinPerl_pp_gvsvPerl_ck_subrPerl_get_ANYOFM_contentsPerl_pp_ftttyPerl_yyunlexPerl_pp_notPerl_init_argv_symbolsPerl_report_evil_fhPerl_pp_leavesublvPerl_pp_grepstartPerl_pp_weakenPerl_pp_ssockoptPerl_ck_cmpPerl_hv_backreferences_pPerl_pp_tiePerl_pp_kvhslicePerl_pp_padcvPerl_pp_i_nePerl_delete_eval_scopePerl_pp_moduloPerl_pp_fcPerl_pp_lvrefslicePerl_magic_regdatum_setPerl_pp_leaveloopPerl_subsignature_startPerl_sawparensPerl_pp_waitpidPerl_pp_aeachPerl_translate_substr_offsetsPerl_pp_gtPerl_pp_waitPerl_pp_rv2cvPerl_sub_crush_depthPerl_magic_setlvrefPerl_pp_orPerl_pp_refPerl_pp_globPerl_ck_scmpPerl_pp_helemPerl_pp_packPerl_PerlProc_pipe_cloexecPerl_init_constantsPerl_pp_sysseekPerl_pp_anywhilePerl_pp_hintsevalPerl_pp_ggrentPerl_pp_leaveevalPerl_pp_padsvPerl_pp_cmpchain_dupPerl_pp_substrPerl_pp_is_taintedPerl_pp_leavesubPerl_pp_tiedPerl_pp_padsv_storePerl_pp_i_ncmpPerl_pp_blessPerl_pad_fixup_inner_anonsPerl_pp_addPerl_pp_randPerl_magic_getdefelemPerl_pp_ioctlPerl_pp_nbit_andPerl_io_closePerl_pp_qrPerl_ck_deletePerl_pp_method_superPerl_magic_setdblinePerl_pp_slePerl_pp_semctlPerl_magic_setenvPerl_pp_eachPerl_pp_enterwhenPerl_invoke_exception_hookPerl_pp_statPerl_magic_getpackPerl_pp_flipPerl_pp_getpgrpPerl_pp_lcPerl_pp_unweakenPerl_release_RExC_statePerl_pp_argcheckPerl_pp_ghostentPerl_getenv_lenPerl_pp_argelemPerl_amagic_is_enabledPerl_pp_dbmopenPerl_pp_eofPerl_scalarPerl_yyparsePerl_pp_refaddrPerl_pp_lvrefPerl_get_no_modifyPerl_pp_gprotoentPerl_pp_redoPerl_pp_postdecPerl_magic_cleararylen_pPerl_pp_negatePerl_pp_getpeernamePerl_pp_readlinePerl_pp_acceptPerl_magic_setcollxfrmPerl_pp_coreargsPerl_magic_killbackrefsPerl_report_wrongway_fhPerl_pp_sysreadPerl_pp_bindPerl_import_builtin_bundlePerl_magic_setpackPerl_ck_backtickPerl_utilizePerl_get_hash_seedPerl_boot_core_mroPerl_pp_once_DYNAMICPerl_localizePerl_pp_gpwentPerl_pp_floorPerl_pp_breakPerl_pp_listPerl_pp_continuePerl_set_ANYOF_argPerl_subsignature_append_slurpygetprotoent@GLIBC_2.2.5Perl_sv_chopPerl_sv_setnv_mgPL_modcountPerl_bytes_from_utf8Perl_class_set_field_defopPL_start_envPerl_rninstrPL_padlist_generationPL_sv_immortalsPerl_sv_taintPerlIO_cleantablePL_threadhookPerl_PerlIO_fillXS_builtin_export_lexicallyPerl_newWHILEOPPL_origargvPerl_rv2cv_op_cvPerlIOStdio_clearerrPerl_save_aryPerl_valid_identifier_pvePerl_pad_add_name_svPerl_pregcompPerl_get_prop_valuesPL_phase_namesPL_ofsgvPL_warn_reservedPerl_savesharedpvPL_deBruijn_bitpos_tab64Perl_newSVpvzPerl_sv_numeq_flagsPerl_sv_force_normal_flagsPL_in_some_foldPerlIOBuf_pushedPerl_hv_clearPL_utf8_charname_beginPL_statusvaluePerl_sv_insertsymlink@GLIBC_2.2.5PerlIOBuf_fillPerlIO_debugPerl_cv_undefPerl_bytes_to_utf8_free_mepipe2@GLIBC_2.9Perl__to_utf8_lower_flagsseteuid@GLIBC_2.2.5fileno@GLIBC_2.2.5Perl_hv_iterinitPL_argvgvPerl_scan_hexPerlIO_destructPerlIOBase_readdup2@GLIBC_2.2.5Perl_hv_iternextPerlIO_apply_layersPerl_cv_namePerl_sv_pvbytePerl_mg_getPL_colorsPerl__to_uni_fold_flagsPL_setlocale_bufsizePerl__is_uni_perl_idstartPL_strategy_open3Perl_call_argvregexp_extflags_namesPerl_reginitcolorssethostent@GLIBC_2.2.5Perl_caller_cxPL_splitstrPerl_sv_setivPerl_do_closePL_colorsetPerl_ck_warnerPL_dump_re_max_lenPerl_gv_try_downgradePerlIOBuf_bufsizatan2@GLIBC_2.2.5PerlIOBuf_seekPL_sighandlerpXS_builtin_truegetspnam@GLIBC_2.2.5frexp@GLIBC_2.2.5execv@GLIBC_2.2.5Perl_op_linklistPerl_sv_blessPL_lockhookPerl_dump_indentperl_freePerl_utf8_to_bytes_PL_replgvPerl_sv_len_utf8Perl_sv_freeendnetent@GLIBC_2.2.5mbtowc@GLIBC_2.2.5pause@GLIBC_2.2.5PL_isarevPerl_drand48_init_rPerlIOPending_readPerl_newSVbooldlerror@GLIBC_2.34Perl_newHVhvPerl_newPMOPPL_Latin1Perl_parse_barestmtPerl_save_sptrfseeko64@GLIBC_2.2.5mktime@GLIBC_2.2.5Perl_save_ivPerl_newGVREFmemset@GLIBC_2.2.5Perl_invlist_clonePerlIOBase_clearerrPerl_pad_newPerl_PerlIO_stdoutgetgid@GLIBC_2.2.5Perl_av_lenPerl_gv_autoload_pvnPL_phasePerl_get_hvPerl_hv_ksplitPL_hash_seed_setPerl_sv_truePerl_newUNOP_AUXPerlIO_fdopenPerl_get_op_namesPerl__invlist_union_maybe_complement_2ndgetgrnam@GLIBC_2.2.5PL_perlioPerl_hv_free_entPerl_lex_peek_unicharPL_opargsPL_exitlistPL_unicodePerl_form_alien_digit_msgPL_taintingPerl_mfreePL_secondgvPerl_require_pvPerl_croak_kw_unless_classPerl_sv_usepvnshutdown@GLIBC_2.2.5PL_Posix_ptrsPerl_opdump_printfPerl_newANONATTRSUBPerl_scan_wordXS_utf8_decodePerl_lex_stuff_svPerl_newCONDOPPerl_warnPerl_sv_derived_from_hvPL_srand_calledPerl_new_warnings_bitfieldPerl_get_svPL_TR_SPECIAL_HANDLING_UTF8PerlIOStdio_openPerl_save_scalarPL_argvoutgvPerlIO_printfPL_dumpindentPerl_av_dumpPerl_sv_setsv_mgPerl_reg_named_buff_nextkeyPerl_do_opennPL_regmatch_statePerl_sv_pvutf8Perl_filter_delPerl_hv_existsPerl_gv_fetchmethodPL_subnamePerl_mess_sv__longjmp_chk@GLIBC_2.11PL_osnameperl_parsePL_psig_namePL_localpatchesPerl_gv_autoload_svPerl_bytes_cmp_utf8Perl_save_allocPerl_diePerl_my_statPerl__to_utf8_fold_flagsPerlIO_list_allocPerl_vdebPerl_gv_fetchmethod_pvn_flagsPerl_Slab_AllocPerl_eval_pvPerl_langinfo8Perl_grok_bin_oct_hexPerl_sv_2bool_flagsPerl_hv_copy_hints_hvioctl@GLIBC_2.2.5shmdt@GLIBC_2.2.5abort@GLIBC_2.2.5PL_Assigned_invlistPerl_gv_init_pvPerl_sv_setsvPerlIO_perlio__h_errno_location@GLIBC_2.2.5exp@GLIBC_2.29PL_gensymmemchr@GLIBC_2.2.5PL_strxfrm_max_cpPL_utf8_totitlePerlIOStdio_dupgetlogin@GLIBC_2.2.5Perl_mg_clearPL_sig_numPerl_op_dumpPL_sh_pathPL_unitcheckavPL_perl_destruct_levelPerl_pad_tidyPL_padix_floorPerl_load_charnamesPL_hook__require__afterPerl_my_stat_flagsnl_langinfo@GLIBC_2.2.5Perl_vverifyPerl_sv_setsv_cowPerl_parse_labelPerl_clear_defarrayldexp@GLIBC_2.2.5Perl_sv_unmagicPL_bitcountPL_c9_utf8_dfa_tabPerl_vivify_defelemPerl_sv_inc_nomgPerl_sv_setpv_mgPerl_newLISTOPisatty@GLIBC_2.2.5utimes@GLIBC_2.2.5PerlIOCrlf_writePerl_call_atexitPerl_atfork_unlockPerl_hv_eiter_pPerl_get_prop_definitionPL_tmps_stackPerl_av_deletePL_eval_startPerl_fbm_compilePL_my_environPerl_dorefPL_utf8_idstartgethostbyname@GLIBC_2.2.5Perl_croak_no_modifyPerl_reg_named_buff_existsPerl_reg_named_buff_fetchPerl_save_destructorPerl_ck_entersub_args_protoPL_curstashPerl_sv_magicext_mglobPL_minus_FPerl_do_joinPerl_keyword_plugin_standard__gmon_start__PL_generationPerl_sv_set_truePerl_my_vsnprintfPerl_hv_iternext_flagsPerl_utf8_to_uv_msgs_helper_Perl_sv_nosharingPerl_save_generic_pvrefPL_origenvironXS_builtin_func1_scalarPL_curpadPerlIO_putcPerl_save_deletePerl_utf16_to_utf8_reversedPerl_lex_unstuffPerl_gv_fetchmeth_pv_autoloadPL_utf8_tofoldPerlIO_default_layersPL_utf8_xidstartPerl_reg_named_buff_iterPerl_gv_fetchmeth_svPerlIO_removePerl_my_dirfdPL_mess_svPerlIO_stdioPerl_save_intPL_checkavmsgrcv@GLIBC_2.2.5PL_argvout_stackPerl_sv_does_pvPerl_save_hashXS_utf8_encodePerl_cop_fetch_labelstrxfrm@GLIBC_2.2.5Perl_sv_dump_depthPerl_PerlIO_tellPerlIO_find_layerPL_signalhookselect@GLIBC_2.2.5Perl_av_makePerlIO_importFILEexecvp@GLIBC_2.2.5Perl_newLOOPOPgetpeername@GLIBC_2.2.5PL_YesPL_collation_namePL_sv_rootPerlIOBase_poppedPerl_do_openPL_fdpidPerl_do_gvgv_dumpPerl_utf8_to_uvchrPerl_scan_binPerlIOUnix_pushedPL_ptr_tablePerl_sv_streq_flagsPerl_cvgv_from_hekPerl_filter_addgp_flags_namesPerl_mg_freeextPerl_vnewSVpvfPL_simple_bitmaskPerl_get_ppaddrPerl_sv_utf8_downgrade_flagsPerl_parse_listexprPL_underlying_radix_svsuper_cp_formatPerlIOBase_unreadPerl_scan_vstringPL_basetimePL_comppad_namePerl_padname_freePL_reentrant_retintPL_checkPerl_dump_packsubsprctl@GLIBC_2.2.5PL_constpadixgettimeofday@GLIBC_2.2.5Perl__new_invlistPerl_sv_2uvPL_DBsinglePerlIOStdio_fillPL_isa_DOESPerl_forbid_outofblock_opsPerl_save_hintsPL_prevailing_versionPerl_newRANGEXS_NamedCapture_tie_itPerlIOBuf_flushPerl_sv_insert_flagsPerl_lex_read_unicharPerlIO_putsPerl_vcroakPerlIOBuf_writenonchar_cp_formatPerl_uvoffuni_to_utf8_flagsPerl_sv_untaintPerlIO_has_cntptrPL_defstashPerl_rpp_obliterate_stack_toPerl_av_create_and_pushPerl_sv_vcatpvfn_flagsPL_WARN_ALLPerl_sv_does_svPerl_reg_temp_copyPerl_sv_setref_pvnPerl__setup_canned_invliststrpbrk@GLIBC_2.2.5Perl_save_svrefPerl_drand48_rseekdir@GLIBC_2.2.5PL_laststatvalPerlIO_initexecl@GLIBC_2.2.5Perl_current_re_enginePerlIO_exportFILEPerl_sv_pvbyten_forcePL_nomemokPerl_av_clearPerl_lex_bufutf8Perl_sv_catpv_flagsPL_stdingvPerl_gv_fullname3Perl_PerlIO_seekPerl_sv_unref_flagsPerlIO_reopenPerl_class_apply_field_attributesPerl_vformPerlIO_fast_getsPerl_delimcpyPL_collxfrm_multPerl_class_seal_stashPL_strategy_dupPerlIOBuf_set_ptrcntPerl_sv_catpvfPerl_call_liststrncmp@GLIBC_2.2.5malloc@GLIBC_2.2.5PL_mbrtowc_psPerl_sv_cmp_flagsPerl_leave_scopePerl_hv_riter_setPerlIOBuf_closePerlIO_arg_fetchPL_utf8localeperl_runPerlIOPop_pushedPL_in_clean_objsPL_csighandler3pgetgrent@GLIBC_2.2.5sigfillset@GLIBC_2.2.5Perl_op_nullPerl_my_popendup@GLIBC_2.2.5Perl_sv_catpvn_flagsPerl_sv_recode_to_utf8getpriority@GLIBC_2.2.5Perl_newSVsv_flagsPerl_sv_2pv_nolenPL_sortstashPL_in_evalPerl_op_convert_listPerl_newSVobjectPerl_wrap_infix_pluginPerl_av_shiftPL_efloatsizePerl_gv_fetchpvPerl_sv_set_boolPerl_gp_freefchdir@GLIBC_2.2.5clearenv@GLIBC_2.2.5getnetbyname@GLIBC_2.2.5Perl_sv_2mortalPerlIOStdio_writeunlink@GLIBC_2.2.5Perl_sv_collxfrmPerl_vnormalPL_in_load_modulePerl_to_uni_titlePerl_sv_vsetpvfnPL_compilingPL_SB_invlistPerl_do_gv_dumpPerl_op_refcnt_locksetresuid@GLIBC_2.2.5PL_savestack_ixPerl_sv_setrv_noincrmdir@GLIBC_2.2.5PL_hash_rand_bits_enabledPerl_pv_prettyPL_DBsignalPerlIOStdio_flushPerl_pv_uni_displayPL_sortcopPerl_is_utf8_char_helper_PL_exit_flagsXS_re_regnamesPerl_sv_usepvn_mgPerl_newPROGPerl_hv_clear_placeholdersPerl_sv_setpvPerlIOStdio_unreadPL_last_in_gvPerlIO_parse_layersPerl_sv_eq_flagsXS_NamedCapture_FETCHPerl_valid_identifier_pvnPL_lastfdPL_mainstackPerl_vload_modulePerl_newGPPerl_gv_fetchsv_exit@GLIBC_2.2.5sigismember@GLIBC_2.2.5Perl_sv_pos_u2b_flagsPerl_class_add_ADJUSTPL_srand_override_nextPerl_my_atof3PL_efloatbufPerl_ck_entersub_args_proto_or_listPerl_despatch_signalsPerl_av_undefPerl_hv_scalarPerl_ck_entersub_args_listPerl_scan_numPerlIOBase_noop_failPerlIO_pendingPerl_my_setenvPerl_emulate_cop_ioPerl_PerlIO_restore_errnoPerl_optimize_optreePerl_sv_grow_fresh__memcpy_chk@GLIBC_2.3.4Perl_vstringifyPerl_vfatal_warnerPL_patchlevelPerl_mro_method_changed_inPerl_rcpv_copyPerl_pregfreePerl_newANONSUBPL_checkav_savePerlIOUnix_refcnt_deccos@GLIBC_2.2.5Perl_newLOGOPPerl_newGVOPPL_setlocale_bufsemget@GLIBC_2.2.5Perl_formPerl_hv_deletePerl_newGVgen_flagsPerlIOUnix_oflagsPerl_regpropPL_numeric_radix_svPerlIOBuf_get_basesetregid@GLIBC_2.2.5Perl__invlist_invertXS_builtin_nanPerl_newSVheksetsockopt@GLIBC_2.2.5PL_main_startPerl_cv_ckproto_len_flagsPerl_PerlIO_flushPerl_utf16_to_utf8_basePerl_gv_fetchpvn_flagssysconf@GLIBC_2.2.5setpgid@GLIBC_2.2.5PerlIOStdio_seekPerl_my_snprintfPerl_sv_refPerlIOUnix_openPerl_newARGDEFELEMOPPerl_hv_iternextsvPerl_refcounted_he_new_svPL_padname_constgetpid@GLIBC_2.2.5mkostemp64@GLIBC_2.7Perl_op_scopePerl_leave_adjust_stacksPerl_newPADNAMEpvnPL_body_rootsXS_DynaLoader_dl_load_filePL_modglobalPerl_sv_dumpPerl_gmtime64_rPerl_grok_binXS_Internals_stack_refcountedPerl_free_tmpsPerl_hv_storePL_filemodePerl_refcounted_he_incPL_compcvPerl_newSVpvn_sharePerl_newDEFSVOPPerl_scan_octPL_utf8_perl_idstartPerl_save_adeletePL_watch_pvxPL_delaymagic_egidPL_evalseqPerl_hv_exists_entPerl_packlistPerl_whichsig_pvnPerl__invlistEQPL_stack_sp__vsnprintf_chk@GLIBC_2.3.4PerlIOPending_closePerlIOBuf_openPerl_prescan_versionPerl_hv_store_flagsPerlIO_cleanupPerl_hugePerl_reg_named_buffPerl_sv_force_normalPerl_PerlIO_get_bufsizXS_UNIVERSAL_isaop_class_namesPL_CCC_non0_non230PerlIO_canset_cntrenameat@GLIBC_2.4Perl_taint_properPerl_more_svfreopen64@GLIBC_2.2.5PL_no_helem_svPL_user_def_propsgp_flags_imported_namesPL_varies__environ@GLIBC_2.2.5Perl_is_utf8_FF_helper_PL_in_diehookPerl_debstackPerl_sv_peek__getgroups_chk@GLIBC_2.4PL_oldnamegetpwuid@GLIBC_2.2.5Perl_newAVavPerl_gv_init_pvnPL_valid_types_IV_setPerl_ninstr_ITM_deregisterTMCloneTablePL_errorsgetnetent@GLIBC_2.2.5Perl_gv_fetchmeth_pvn_autoloadPerl_PerlIO_readPerl__invlist_dumpPL_savestackPerl_reentrant_freePerl_looks_like_numberPerlIOStdio_eofPerl_sv_collxfrm_flagsPerl_noperl_diePerl_get_and_check_backslash_N_namePL_infix_pluginPerl__invlist_searchPL_toptargetgeteuid@GLIBC_2.2.5PL_numeric_standardPerl_newSVsvfmod@GLIBC_2.2.5PL_scopestackperl_allocXS_DynaLoader_dl_unload_filePerl_newXS_deffilePerl_reallocPerlIOBase_binmodePerl_sv_setuvstrnlen@GLIBC_2.2.5PerlIOPending_set_ptrcntPL_UpperLatin1PL_curpmXS_UNIVERSAL_import_unimportPerl_try_amagic_binungetc@GLIBC_2.2.5__ctype_toupper_loc@GLIBC_2.3Perl_op_lvalue_flagsPerlIO_pushPerl_get_op_descsPerl_save_hptrPerl_sv_clearXS_builtin_created_as_numberPerl_newSVOPPL_bincompat_optionsPerl_save_opPerl_save_rcpvPerl_runops_standardPL_signalsPerl_reg_named_buff_firstkeyPerl_hv_riter_pPerl_vmessPL_taint_warnPL_numeric_underlying_is_standardPerl_parse_blockPerlIOBase_flush_linebufPerl_dounwindPerl_PerlIO_context_layersPerl_softref2xvlog@GLIBC_2.29Perl_grok_infnanXS_builtin_trimPerl_rsignal_statePL_min_intro_pendingPerl_nothreadhookPerl_cv_set_call_checkerPerl_sv_setpvn_mgcrypt@XCRYPT_2.0Perl_sv_cmpPerl_hv_dumpPerl_mbtowc_PL_localizingfree@GLIBC_2.2.5PL_opPerl_sv_reftypePL_stashcachePerl_sv_catsvPL_DBtracePerl_sv_can_swipe_pv_bufPerl_intro_myPL_hash_seed_wPerl_vcmpPerl_to_uni_lowerPL_tmps_maxstrlen@GLIBC_2.2.5PL_op_sequencePerl_parse_fullstmtPerl_PerlIO_save_errnoPerl_mg_copyPerl_sv_derived_from_svPL_reg_extflags_name_ITM_registerTMCloneTablePL_warn_uninit_svPerl_warn_svPerl_pv_escapePerl_gv_name_setPerl_gv_dumpPerl_xs_handshakePL_scopestack_namePerl_refcounted_he_fetch_pvnPerl_cntrl_to_mnemonicPerlIOStdio_filenoPerl_do_sv_dumpPerl_utf8_to_bytesPerl_reg_numbered_buff_fetch_flagsPerl_sv_2pvutf8_nolenPerl_wrap_keyword_pluginferror@GLIBC_2.2.5Perl_callocPerl_save_I32Perl_av_create_and_unshift_onePerlIO__closePerl_newIOPerl_sv_nounlockingopendir@GLIBC_2.2.5Perl_sv_doesPL_strtabPL_beginav_savePL_minus_Egethostbyaddr@GLIBC_2.2.5PL_utf8_xidcontPerl_parse_arithexprPL_savebeginPL_curpm_underPL_strategy_mkstempPL_debstashPerl_mro_set_private_dataPerl_newSVREFPerl_PerlIO_get_cntPerlIO_define_layerPL_delaymagicPerl_save_hdeletePerl_mro_set_mro__ctype_get_mb_cur_max@GLIBC_2.2.5Perl_sortsv_flagscv_flags_names__vfprintf_chk@GLIBC_2.3.4PL_NoPL_in_clean_allPerl_mini_mktimePL_minus_pPL_psig_ptrPL_watchaddrgetprotobyname@GLIBC_2.2.5PL_strategy_pipePL_markstack_maxPerl__is_uni_perl_idcontPL_hintgvmkstemp64@GLIBC_2.2.5second_sv_flags_namesPerl_sys_termPerl_PerlIO_eofPerl_ptr_table_fetchlisten@GLIBC_2.2.5PL_veto_cleanupPerl_refcounted_he_new_pvnPL_eval_rootPerl_padnamelist_fetchpmflags_flags_names__ctype_b_loc@GLIBC_2.3__cxa_finalize@GLIBC_2.2.5Perl_newCONSTSUB_flagsPerlIO_default_bufferPerl_sv_catpvPerl_av_reifyXS_NamedCapture_TIEHASHmsgsnd@GLIBC_2.2.5PL_anPL_preambleavPerl__to_utf8_upper_flagsPerl_sv_regex_global_pos_setPerl__is_utf8_perl_idcontPerl_qerrorPerl_op_wrap_finallyPerl_mallocPerl_pad_add_name_pvPL_DBlinePerl_sv_replacePL_warn_uninitPerl_gv_fetchmeth_pvnPerl_is_utf8_char_bufPerl_my_forkPerl_finalize_optreePerl_save_pushptrptrboot_DynaLoaderPL_simplePerl_sv_2pvutf8_flagsPL_minus_lmsgctl@GLIBC_2.2.5Perl_av_iter_pPerl_gv_HVaddPerl_my_exitPerl_sv_setref_pvPerl_PerlIO_setlinebufPerlIORaw_pushedPerl_atfork_lockPL_op_private_labelsPerl_csighandler3Perl_sv_2ivPerl_isinfnanPerl_infix_plugin_standardPL_collation_ixPerl_sv_rvweakenPerl_newANONHASHPerlIO_stdstreamsPerl_gv_efullname4Perl_magic_dumpPerl_sys_initPerl_pregfree2PL_custom_op_namesPerl_setdefoutstdin@GLIBC_2.2.5PL_markstack_ptrPL_no_wrongrefPL_shutdownhookXS_constant__make_constPerl_sv_vstring_getPL_minus_cPL_taintedPerl_newMYSUBPerl_scan_strPL_nanfgetc@GLIBC_2.2.5Perl_do_hv_dumpPerl_gv_stashsvPerl_newXS_flagsPerl_refcounted_he_new_pvfdopen@GLIBC_2.2.5perl_constructPerlIO_findFILEPerl_vnumifyPerl_sv_vsetpvfPL_sighandler1pPL_no_securitytowupper@GLIBC_2.2.5Perl_yylexPL_mbrlen_psstrrchr@GLIBC_2.2.5PL_markstackPerl_av_extendPL_curinterpsyscall@GLIBC_2.2.5Perl_PerlIO_closePL_peeppPerl_sv_pos_b2uPerl__inverse_foldsPL_foldPL_comppad_name_fillPerlIO_clonePerl_sv_cmp_locale_flagsPerl_sv_setrv_incPerlIOStdio_readPL_no_dir_funcPL_eval_begin_nest_depthPL_stderrgvPL_op_seqPerl_sv_2pvbytePerl_save_mortalizesvPerl_newWHENOPPerl_is_lvalue_subendprotoent@GLIBC_2.2.5pipe@GLIBC_2.2.5Perl_pop_scopesleep@GLIBC_2.2.5PL_debugPerlIO_poptelldir@GLIBC_2.2.5PL_no_funcPL_comppad_name_floorPerl_newUNOPsetpriority@GLIBC_2.2.5PerlIOBuf_unreadPL_opfreehookPerl_newSVrvPerl_rcpv_freePerl_cvstash_setregexp_core_intflags_namesPL_regnode_namePerlIOUnix_writePerl_mro_registerPerl_sv_mortalcopy_flagsPL_scopestack_maxPerl_save_freesvPL_custom_opsPerl_sv_upgradePL_beginavPL_errgvPL_sv_countPL_in_warnhookPL_utf8_charname_continuePL_curstackinfofutimes@GLIBC_2.3Perl_more_bodiesPerl__byte_dump_stringXS_re_regnameXS_DynaLoader_dl_find_symbolPerl__add_range_to_invlistPL_sighandler3pPerl_sv_isa_svPL_curstackPerlIOBuf_get_ptrPerl_find_rundefsvPerl_set_numeric_underlyingPerlIOStdio_errorPerl_save_vptrPerl_get_re_argPerlIO_binmodePerlIO_unixPL_strategy_dup2Perl_hv_store_entPerl_cast_i32Perl_wrap_op_checkergetegid@GLIBC_2.2.5PerlIOBase_pushedflock@GLIBC_2.2.5PL_extended_cp_formatPerl_save_padsv_and_mortalizePerl_warnerPerl_gv_const_svPL_SCX_invlistXS_DynaLoader_dl_errorPerl_doing_taintkill@GLIBC_2.2.5Perl_gv_SVaddPerl_call_svstrerror@GLIBC_2.2.5Perl_lex_discard_toPerl_hv_undef_flagsstrstr@GLIBC_2.2.5PL_endavPerl_sv_setsv_flagsPerl_refcounted_he_fetch_svPerl_sv_setref_nvPerl_filter_readPerl_av_storesigprocmask@GLIBC_2.2.5Perl_sv_dec_nomgPL_main_rootXS_PerlIO_get_layersPerl_sv_pvn_force_flagsPerl_sv_get_backrefsXS_builtin_func1_voidsigaction@GLIBC_2.2.5Perl_cvgv_setPL_globalstashPerlIOStdio_modePerlIOCrlf_binmodePerl_set_caret_Xsocketpair@GLIBC_2.2.5PerlIO_getcPerl_sv_isaPerl_gv_autoload_pvPerlIO_openPerl_sv_setpvnPL_collation_standardPerl_rcpv_newfstat64@GLIBC_2.33XS_NamedCapture_FIRSTKEYPerl_mro_get_linear_isaPerl_dump_formPerl_save_freepvPerl_sv_setpv_bufsizesetegid@GLIBC_2.2.5Perl_sv_utf8_upgradePerl_reentrant_retrygetsockopt@GLIBC_2.2.5Perl_grok_numeric_radixPerl_newLOOPEXPerlIOCrlf_get_cntmemrchr@GLIBC_2.2.5Perl__is_utf8_FOOPerl_was_lvalue_subPerl_gv_fetchfilePerlIOStdio_setlinebufPL_chopsetPL_valid_types_PVXsemctl@GLIBC_2.2.5Perl_pregexecdlopen@GLIBC_2.34PL_watchokPerl_sv_free2Perl_hv_fetchPL_HasMultiCharFoldPL_EXACTFish_bitmaskPerl_op_prepend_elemftruncate64@GLIBC_2.2.5readlink@GLIBC_2.2.5PerlIO_setposPerl_stack_growgetsockname@GLIBC_2.2.5PerlIOStdio_pushedPerl_block_gimmePL_valid_types_RVdirfd@GLIBC_2.2.5Perl_sv_mortalcopyPerl_my_failure_exitPL_csighandlerpPL_origfilenamePL_perlio_debug_fdPerl_ptr_table_freePerl_my_strftimePL_maxsysfdPL_strategy_acceptPerlIO_has_basePerl_newPADNAMEouterPerl_gv_IOaddconnect@GLIBC_2.2.5Perl_gv_fetchfile_flagsPerl_regcurlyPL_profiledataPerl_op_freePerlIOBuf_tellPL_GCB_invlistPL_fold_localePerl_pad_add_name_pvnPL_numeric_underlyingPerlIO_fdupopenPerlIOStdio_closePL_DBgvPL_dbargsPL_valid_types_IVXPL_delaymagic_gidtowlower@GLIBC_2.2.5PerlIOUnix_filenoPL_no_aelemPerl_custom_op_registerPerl_cast_ivPL_strategy_openPerl_sv_setpvf_mgPerl_newSVpv_sharePerl_vwarnPL_no_symref_svPerl_sv_2uv_flagsXS_builtin_importsetgrent@GLIBC_2.2.5Perl_apply_builtin_cv_attributessetpwent@GLIBC_2.2.5endpwent@GLIBC_2.2.5Perl_newANONLISTfchmod@GLIBC_2.2.5PL_sig_pendingPerl_op_contextualizePerl_save_I8Perl_switch_to_global_localePerl_is_in_locale_category_getpgid@GLIBC_2.2.5Perl_sv_newmortalPerlIO_resolve_layersPerl_op_force_listPerl_runops_debugPerl_sv_2pvPerl_regdumpPerl_sv_incPerl_av_fetchPerl_unpackstringPerl_av_fillPerl_sv_2pvbyte_flagsPerl_lex_stuff_pvnPerl_class_wrap_method_bodyPL_sigfpe_savedsetresgid@GLIBC_2.2.5fcntl64@GLIBC_2.28PerlIOUnix_refcntPerl_sv_setnvPerl_blockhook_registerPL_exitlistlenPerl_ckwarn_dPerlIOBase_eofPerl_newOPPerl__is_utf8_perl_idstartPerl_mro_get_from_namePL_curcopPerlIOBase_errorPL_warn_nosemiPerl_get_deprecated_property_msgPerl_my_socketpairPerl_localeconvPerl_parse_fullexprPerl_hv_magicPL_infPerl__is_uni_FOOPL_firstgvPerl_sv_set_falsePL_in_utf8_CTYPE_localePerl_xs_boot_epilogPL_AboveLatin1PerlIO_layer_fetchPerl_pad_findmy_pvPerl_sv_eqPL_csighandler1pPL_rsPL_utf8_idcontPerl_newBINOPPerl_my_fflush_allPerl_sv_catsv_flagsPerl_perly_sighandlerPerl_debPerl_form_cp_toostUNI_CWT_invlistUNI_CWU_invlistUNI_CYPRIOTSYLLABARY_invlistUNI_CYRILLICEXTA_invlistUNI_CYRILLICEXTB_invlistUNI_CYRILLICEXTC_invlistUNI_CYRILLICEXTD_invlistUNI_CYRILLICSUP_invlistUNI_CYRL_invlistUNI_DASH_invlistUNI_DEP_invlistUNI_DEVA_invlistUNI_DEVANAGARIEXT_invlistUNI_DEVANAGARIEXTA_invlistUNI_DI_invlistUNI_DIA_invlistUNI_DIACRITICALS_invlistUNI_DIACRITICALSEXT_invlistUNI_DIACRITICALSFORSYMBOLS_invlistUNI_DIACRITICALSSUP_invlistUNI_DIAK_invlistUNI_DINGBATS_invlistUNI_DOGR_invlistUNI_DOMINO_invlistUNI_DSRT_invlistUNI_DT__CAN_invlistUNI_DT__COM_invlistUNI_DT__ENC_invlistUNI_DT__FIN_invlistUNI_DT__FONT_invlistUNI_DT__FRA_invlistUNI_DT__INIT_invlistUNI_DT__ISO_invlistUNI_DT__MED_invlistUNI_DT__NAR_invlistUNI_DT__NB_invlistUNI_DT__NONCANON_invlistUNI_DT__NONE_invlistUNI_DT__SML_invlistUNI_DT__SQR_invlistUNI_DT__SUB_invlistUNI_DT__SUP_invlistUNI_DT__VERT_invlistUNI_DUPL_invlistUNI_EARLYDYNASTICCUNEIFORM_invlistUNI_EA__A_invlistUNI_EA__F_invlistUNI_EA__H_invlistUNI_EA__N_invlistUNI_EA__NA_invlistUNI_EA__W_invlistUNI_EBASE_invlistUNI_ECOMP_invlistUNI_EGYP_invlistUNI_EGYPTIANHIEROGLYPHFORMATCONTROLS_invlistUNI_EGYPTIANHIEROGLYPHSEXTA_invlistUNI_ELBA_invlistUNI_ELYM_invlistUNI_EMOD_invlistUNI_EMOJI_invlistUNI_EMOTICONS_invlistUNI_ENCLOSEDALPHANUM_invlistUNI_ENCLOSEDALPHANUMSUP_invlistUNI_ENCLOSEDCJK_invlistUNI_ENCLOSEDIDEOGRAPHICSUP_invlistUNI_EPRES_invlistUNI_ETHI_invlistUNI_ETHIOPICEXT_invlistUNI_ETHIOPICEXTA_invlistUNI_ETHIOPICEXTB_invlistUNI_ETHIOPICSUP_invlistUNI_EXT_invlistUNI_EXTPICT_invlistUNI_GARA_invlistUNI_GCB__CN_invlistUNI_GCB__EX_invlistUNI_GCB__L_invlistUNI_GCB__PP_invlistUNI_GCB__SM_invlistUNI_GCB__T_invlistUNI_GCB__V_invlistUNI_GCB__XX_invlistUNI_GEOMETRICSHAPES_invlistUNI_GEOMETRICSHAPESEXT_invlistUNI_GEOR_invlistUNI_GEORGIANEXT_invlistUNI_GEORGIANSUP_invlistUNI_GLAG_invlistUNI_GLAGOLITICSUP_invlistUNI_GONG_invlistUNI_GONM_invlistUNI_GOTH_invlistUNI_GRAN_invlistUNI_GRBASE_invlistUNI_GREEKEXT_invlistUNI_GREK_invlistUNI_GREXT_invlistUNI_GUJR_invlistUNI_GUKH_invlistUNI_GURU_invlistUNI_HALFANDFULLFORMS_invlistUNI_HALFMARKS_invlistUNI_HAN_invlistUNI_HANG_invlistUNI_HANO_invlistUNI_HATR_invlistUNI_HEBR_invlistUNI_HIGHPUSURROGATES_invlistUNI_HIGHSURROGATES_invlistUNI_HIRA_invlistUNI_HLUW_invlistUNI_HMNG_invlistUNI_HMNP_invlistUNI_HST__NA_invlistUNI_HST__V_invlistUNI_HUNG_invlistUNI_HYPHEN_invlistUNI_IDC_invlistUNI_IDCOMPATMATHCONTINUE_invlistUNI_IDCOMPATMATHSTART_invlistUNI_IDENTIFIERSTATUS__ALLOWED_invlistUNI_IDENTIFIERSTATUS__RESTRICTED_invlistUNI_IDENTIFIERTYPE__DEFAULTIGNORABLE_invlistUNI_IDENTIFIERTYPE__EXCLUSION_invlistUNI_IDENTIFIERTYPE__INCLUSION_invlistUNI_IDENTIFIERTYPE__LIMITEDUSE_invlistUNI_IDENTIFIERTYPE__NOTCHARACTER_invlistUNI_IDENTIFIERTYPE__NOTNFKC_invlistUNI_IDENTIFIERTYPE__NOTXID_invlistUNI_IDENTIFIERTYPE__OBSOLETE_invlistUNI_IDENTIFIERTYPE__RECOMMENDED_invlistUNI_IDENTIFIERTYPE__TECHNICAL_invlistUNI_IDENTIFIERTYPE__UNCOMMONUSE_invlistUNI_IDEO_invlistUNI_IDEOGRAPHICSYMBOLS_invlistUNI_IDS_invlistUNI_IDSB_invlistUNI_IDST_invlistUNI_IDSU_invlistUNI_INADLAM_invlistUNI_INAHOM_invlistUNI_INANATOLIANHIEROGLYPHS_invlistUNI_INARABIC_invlistUNI_INARMENIAN_invlistUNI_INAVESTAN_invlistUNI_INBALINESE_invlistUNI_INBAMUM_invlistUNI_INBASSAVAH_invlistUNI_INBATAK_invlistUNI_INBENGALI_invlistUNI_INBHAIKSUKI_invlistUNI_INBOPOMOFO_invlistUNI_INBRAHMI_invlistUNI_INBUGINESE_invlistUNI_INBUHID_invlistUNI_INCARIAN_invlistUNI_INCAUCASIANALBANIAN_invlistUNI_INCB__CONSONANT_invlistUNI_INCB__EXTEND_invlistUNI_INCB__LINKER_invlistUNI_INCB__NONE_invlistUNI_INCHAKMA_invlistUNI_INCHAM_invlistUNI_INCHEROKEE_invlistUNI_INCHORASMIAN_invlistUNI_INCOPTIC_invlistUNI_INCUNEIFORM_invlistUNI_INCYPROMINOAN_invlistUNI_INCYRILLIC_invlistUNI_INDEVANAGARI_invlistUNI_INDICNUMBERFORMS_invlistUNI_INDICSIYAQNUMBERS_invlistUNI_INDIVESAKURU_invlistUNI_INDOGRA_invlistUNI_INDUPLOYAN_invlistUNI_INEGYPTIANHIEROGLYPHS_invlistUNI_INELBASAN_invlistUNI_INELYMAIC_invlistUNI_INETHIOPIC_invlistUNI_INGARAY_invlistUNI_INGEORGIAN_invlistUNI_INGLAGOLITIC_invlistUNI_INGOTHIC_invlistUNI_INGRANTHA_invlistUNI_INGREEK_invlistUNI_INGUJARATI_invlistUNI_INGUNJALAGONDI_invlistUNI_INGURMUKHI_invlistUNI_INGURUNGKHEMA_invlistUNI_INHANGUL_invlistUNI_INHANIFIROHINGYA_invlistUNI_INHANUNOO_invlistUNI_INHATRAN_invlistUNI_INHEBREW_invlistUNI_INHIRAGANA_invlistUNI_INIDC_invlistUNI_INIMPERIALARAMAIC_invlistUNI_ININSCRIPTIONALPAHLAVI_invlistUNI_ININSCRIPTIONALPARTHIAN_invlistUNI_INJAVANESE_invlistUNI_INKAITHI_invlistUNI_INKANNADA_invlistUNI_INKATAKANA_invlistUNI_INKAWI_invlistUNI_INKHAROSHTHI_invlistUNI_INKHITANSMALLSCRIPT_invlistUNI_INKHMER_invlistUNI_INKHOJKI_invlistUNI_INKHUDAWADI_invlistUNI_INKIRATRAI_invlistUNI_INLAO_invlistUNI_INLEPCHA_invlistUNI_INLIMBU_invlistUNI_INLINEARA_invlistUNI_INLISU_invlistUNI_INLYCIAN_invlistUNI_INLYDIAN_invlistUNI_INMAHAJANI_invlistUNI_INMAKASAR_invlistUNI_INMALAYALAM_invlistUNI_INMANDAIC_invlistUNI_INMANICHAEAN_invlistUNI_INMARCHEN_invlistUNI_INMASARAMGONDI_invlistUNI_INMEDEFAIDRIN_invlistUNI_INMEETEIMAYEK_invlistUNI_INMENDEKIKAKUI_invlistUNI_INMEROITICCURSIVE_invlistUNI_INMIAO_invlistUNI_INMODI_invlistUNI_INMONGOLIAN_invlistUNI_INMRO_invlistUNI_INMULTANI_invlistUNI_INMYANMAR_invlistUNI_INNABATAEAN_invlistUNI_INNAGMUNDARI_invlistUNI_INNANDINAGARI_invlistUNI_INNEWA_invlistUNI_INNEWTAILUE_invlistUNI_INNKO_invlistUNI_INNUSHU_invlistUNI_INNYIAKENGPUACHUEHMONG_invlistUNI_INOGHAM_invlistUNI_INOLDHUNGARIAN_invlistUNI_INOLDITALIC_invlistUNI_INOLDPERMIC_invlistUNI_INOLDPERSIAN_invlistUNI_INOLDSOGDIAN_invlistUNI_INOLDTURKIC_invlistUNI_INOLDUYGHUR_invlistUNI_INOLONAL_invlistUNI_INORIYA_invlistUNI_INOSAGE_invlistUNI_INOSMANYA_invlistUNI_INPAHAWHHMONG_invlistUNI_INPAUCINHAU_invlistUNI_INPC__BOTTOM_invlistUNI_INPC__BOTTOMANDLEFT_invlistUNI_INPC__BOTTOMANDRIGHT_invlistUNI_INPC__LEFT_invlistUNI_INPC__LEFTANDRIGHT_invlistUNI_INPC__NA_invlistUNI_INPC__OVERSTRUCK_invlistUNI_INPC__RIGHT_invlistUNI_INPC__TOP_invlistUNI_INPC__TOPANDBOTTOM_invlistUNI_INPC__TOPANDBOTTOMANDLEFT_invlistUNI_INPC__TOPANDBOTTOMANDRIGHT_invlistUNI_INPC__TOPANDLEFT_invlistUNI_INPC__TOPANDLEFTANDRIGHT_invlistUNI_INPC__TOPANDRIGHT_invlistUNI_INPHAGSPA_invlistUNI_INPHOENICIAN_invlistUNI_INPSALTERPAHLAVI_invlistUNI_INPUNCTUATION_invlistUNI_INREJANG_invlistUNI_INRUNIC_invlistUNI_INSAMARITAN_invlistUNI_INSAURASHTRA_invlistUNI_INSC__AVAGRAHA_invlistUNI_INSC__BINDU_invlistUNI_INSC__BRAHMIJOININGNUMBER_invlistUNI_INSC__CANTILLATIONMARK_invlistUNI_INSC__CONSONANT_invlistUNI_INSC__CONSONANTDEAD_invlistUNI_INSC__CONSONANTFINAL_invlistUNI_INSC__CONSONANTHEADLETTER_invlistUNI_INSC__CONSONANTINITIALPOSTFIXED_invlistUNI_INSC__CONSONANTKILLER_invlistUNI_INSC__CONSONANTMEDIAL_invlistUNI_INSC__CONSONANTPLACEHOLDER_invlistUNI_INSC__CONSONANTPRECEDINGREPHA_invlistUNI_INSC__CONSONANTPREFIXED_invlistUNI_INSC__CONSONANTSUBJOINED_invlistUNI_INSC__CONSONANTSUCCEEDINGREPHA_invlistUNI_INSC__CONSONANTWITHSTACKER_invlistUNI_INSC__GEMINATIONMARK_invlistUNI_INSC__INVISIBLESTACKER_invlistUNI_INSC__MODIFYINGLETTER_invlistUNI_INSC__NONJOINER_invlistUNI_INSC__NUKTA_invlistUNI_INSC__NUMBER_invlistUNI_INSC__NUMBERJOINER_invlistUNI_INSC__OTHER_invlistUNI_INSC__PUREKILLER_invlistUNI_INSC__REGISTERSHIFTER_invlistUNI_INSC__SYLLABLEMODIFIER_invlistUNI_INSC__TONELETTER_invlistUNI_INSC__TONEMARK_invlistUNI_INSC__VIRAMA_invlistUNI_INSC__VISARGA_invlistUNI_INSC__VOWEL_invlistUNI_INSC__VOWELDEPENDENT_invlistUNI_INSC__VOWELINDEPENDENT_invlistUNI_INSIDDHAM_invlistUNI_INSINHALA_invlistUNI_INSOGDIAN_invlistUNI_INSORASOMPENG_invlistUNI_INSOYOMBO_invlistUNI_INSUNDANESE_invlistUNI_INSUNUWAR_invlistUNI_INSYLOTINAGRI_invlistUNI_INSYRIAC_invlistUNI_INTAGALOG_invlistUNI_INTAGBANWA_invlistUNI_INTAILE_invlistUNI_INTAITHAM_invlistUNI_INTAIVIET_invlistUNI_INTAKRI_invlistUNI_INTAMIL_invlistUNI_INTANGSA_invlistUNI_INTANGUT_invlistUNI_INTELUGU_invlistUNI_INTHAANA_invlistUNI_INTHAI_invlistUNI_INTIBETAN_invlistUNI_INTIFINAGH_invlistUNI_INTIRHUTA_invlistUNI_INTODHRI_invlistUNI_INTOTO_invlistUNI_INTULUTIGALARI_invlistUNI_INUGARITIC_invlistUNI_INVAI_invlistUNI_INVITHKUQI_invlistUNI_INVS_invlistUNI_INWANCHO_invlistUNI_INWARANGCITI_invlistUNI_INYEZIDI_invlistUNI_INZANABAZARSQUARE_invlistUNI_IN__10_invlistUNI_IN__11_invlistUNI_IN__12_invlistUNI_IN__12_DOT_1_invlistUNI_IN__13_invlistUNI_IN__14_invlistUNI_IN__15_invlistUNI_IN__15_DOT_1_invlistUNI_IN__16_invlistUNI_IN__1_DOT_1_invlistUNI_IN__2_invlistUNI_IN__2_DOT_1_invlistUNI_IN__3_invlistUNI_IN__3_DOT_1_invlistUNI_IN__3_DOT_2_invlistUNI_IN__4_invlistUNI_IN__4_DOT_1_invlistUNI_IN__5_invlistUNI_IN__5_DOT_1_invlistUNI_IN__5_DOT_2_invlistUNI_IN__6_invlistUNI_IN__6_DOT_1_invlistUNI_IN__6_DOT_2_invlistUNI_IN__6_DOT_3_invlistUNI_IN__7_invlistUNI_IN__8_invlistUNI_IN__9_invlistUNI_IN__NA_invlistUNI_IPAEXT_invlistUNI_ITAL_invlistUNI_JAMO_invlistUNI_JAMOEXTA_invlistUNI_JAMOEXTB_invlistUNI_JAVA_invlistUNI_JG__AFRICANFEH_invlistUNI_JG__AFRICANNOON_invlistUNI_JG__AFRICANQAF_invlistUNI_JG__AIN_invlistUNI_JG__ALAPH_invlistUNI_JG__ALEF_invlistUNI_JG__BEH_invlistUNI_JG__BETH_invlistUNI_JG__BURUSHASKIYEHBARREE_invlistUNI_JG__DAL_invlistUNI_JG__DALATHRISH_invlistUNI_JG__E_invlistUNI_JG__FARSIYEH_invlistUNI_JG__FE_invlistUNI_JG__FEH_invlistUNI_JG__FINALSEMKATH_invlistUNI_JG__GAF_invlistUNI_JG__GAMAL_invlistUNI_JG__HAH_invlistUNI_JG__HAMZAONHEHGOAL_invlistUNI_JG__HANIFIROHINGYAKINNAYA_invlistUNI_JG__HANIFIROHINGYAPA_invlistUNI_JG__HE_invlistUNI_JG__HEH_invlistUNI_JG__HEHGOAL_invlistUNI_JG__HETH_invlistUNI_JG__KAF_invlistUNI_JG__KAPH_invlistUNI_JG__KASHMIRIYEH_invlistUNI_JG__KHAPH_invlistUNI_JG__KNOTTEDHEH_invlistUNI_JG__LAM_invlistUNI_JG__LAMADH_invlistUNI_JG__MALAYALAMBHA_invlistUNI_JG__MALAYALAMJA_invlistUNI_JG__MALAYALAMLLA_invlistUNI_JG__MALAYALAMLLLA_invlistUNI_JG__MALAYALAMNGA_invlistUNI_JG__MALAYALAMNNA_invlistUNI_JG__MALAYALAMNNNA_invlistUNI_JG__MALAYALAMNYA_invlistUNI_JG__MALAYALAMRA_invlistUNI_JG__MALAYALAMSSA_invlistUNI_JG__MALAYALAMTTA_invlistUNI_JG__MANICHAEANALEPH_invlistUNI_JG__MANICHAEANAYIN_invlistUNI_JG__MANICHAEANBETH_invlistUNI_JG__MANICHAEANDALETH_invlistUNI_JG__MANICHAEANDHAMEDH_invlistUNI_JG__MANICHAEANFIVE_invlistUNI_JG__MANICHAEANGIMEL_invlistUNI_JG__MANICHAEANHETH_invlistUNI_JG__MANICHAEANHUNDRED_invlistUNI_JG__MANICHAEANKAPH_invlistUNI_JG__MANICHAEANLAMEDH_invlistUNI_JG__MANICHAEANMEM_invlistUNI_JG__MANICHAEANNUN_invlistUNI_JG__MANICHAEANONE_invlistUNI_JG__MANICHAEANPE_invlistUNI_JG__MANICHAEANQOPH_invlistUNI_JG__MANICHAEANRESH_invlistUNI_JG__MANICHAEANSADHE_invlistUNI_JG__MANICHAEANSAMEKH_invlistUNI_JG__MANICHAEANTAW_invlistUNI_JG__MANICHAEANTEN_invlistUNI_JG__MANICHAEANTETH_invlistUNI_JG__MANICHAEANTHAMEDH_invlistUNI_JG__MANICHAEANTWENTY_invlistUNI_JG__MANICHAEANWAW_invlistUNI_JG__MANICHAEANYODH_invlistUNI_JG__MANICHAEANZAYIN_invlistUNI_JG__MEEM_invlistUNI_JG__MIM_invlistUNI_JG__NOJOININGGROUP_invlistUNI_JG__NOON_invlistUNI_JG__NUN_invlistUNI_JG__NYA_invlistUNI_JG__PE_invlistUNI_JG__QAF_invlistUNI_JG__QAPH_invlistUNI_JG__REH_invlistUNI_JG__REVERSEDPE_invlistUNI_JG__ROHINGYAYEH_invlistUNI_JG__SAD_invlistUNI_JG__SADHE_invlistUNI_JG__SEEN_invlistUNI_JG__SEMKATH_invlistUNI_JG__SHIN_invlistUNI_JG__STRAIGHTWAW_invlistUNI_JG__SWASHKAF_invlistUNI_JG__SYRIACWAW_invlistUNI_JG__TAH_invlistUNI_JG__TAW_invlistUNI_JG__TEHMARBUTA_invlistUNI_JG__TETH_invlistUNI_JG__THINYEH_invlistUNI_JG__VERTICALTAIL_invlistUNI_JG__WAW_invlistUNI_JG__YEH_invlistUNI_JG__YEHBARREE_invlistUNI_JG__YEHWITHTAIL_invlistUNI_JG__YUDH_invlistUNI_JG__YUDHHE_invlistUNI_JG__ZAIN_invlistUNI_JG__ZHAIN_invlistUNI_JOINC_invlistUNI_JT__C_invlistUNI_JT__D_invlistUNI_JT__L_invlistUNI_JT__R_invlistUNI_JT__T_invlistUNI_JT__U_invlistUNI_KAKTOVIKNUMERALS_invlistUNI_KALI_invlistUNI_KANA_invlistUNI_KANAEXTA_invlistUNI_KANAEXTB_invlistUNI_KANASUP_invlistUNI_KANBUN_invlistUNI_KANGXI_invlistUNI_KATAKANAEXT_invlistUNI_KAWI_invlistUNI_KEHNOMIRROR_invlistUNI_KEHNOROTATE_invlistUNI_KHAR_invlistUNI_KHMERSYMBOLS_invlistUNI_KHMR_invlistUNI_KHOJ_invlistUNI_KITS_invlistUNI_KNDA_invlistUNI_KRAI_invlistUNI_KTHI_invlistUNI_L_invlistUNI_LANA_invlistUNI_LAO_invlistUNI_LATIN1_invlistUNI_LATINEXTA_invlistUNI_LATINEXTADDITIONAL_invlistUNI_LATINEXTB_invlistUNI_LATINEXTC_invlistUNI_LATINEXTD_invlistUNI_LATINEXTE_invlistUNI_LATINEXTF_invlistUNI_LATINEXTG_invlistUNI_LATN_invlistUNI_LB__AI_invlistUNI_LB__AK_invlistUNI_LB__AL_invlistUNI_LB__AP_invlistUNI_LB__AS_invlistUNI_LB__B2_invlistUNI_LB__BA_invlistUNI_LB__BB_invlistUNI_LB__BK_invlistUNI_LB__CB_invlistUNI_LB__CJ_invlistUNI_LB__CL_invlistUNI_LB__CM_invlistUNI_LB__CP_invlistUNI_LB__CR_invlistUNI_LB__EX_invlistUNI_LB__GL_invlistUNI_LB__H2_invlistUNI_LB__H3_invlistUNI_LB__HL_invlistUNI_LB__HY_invlistUNI_LB__ID_invlistUNI_LB__IN_invlistUNI_LB__IS_invlistUNI_LB__LF_invlistUNI_LB__NL_invlistUNI_LB__NS_invlistUNI_LB__NU_invlistUNI_LB__OP_invlistUNI_LB__PO_invlistUNI_LB__PR_invlistUNI_LB__QU_invlistUNI_LB__SA_invlistUNI_LB__SG_invlistUNI_LB__SP_invlistUNI_LB__SY_invlistUNI_LB__VF_invlistUNI_LB__VI_invlistUNI_LB__WJ_invlistUNI_LB__XX_invlistUNI_LB__ZW_invlistUNI_LB__ZWJ_invlistUNI_LEPC_invlistUNI_LETTERLIKESYMBOLS_invlistUNI_LIMB_invlistUNI_LINA_invlistUNI_LINB_invlistUNI_LINEARBIDEOGRAMS_invlistUNI_LINEARBSYLLABARY_invlistUNI_LISU_invlistUNI_LISUSUP_invlistUNI_LM_invlistUNI_LO_invlistUNI_LOE_invlistUNI_LOWERCASELETTER_invlistUNI_LOWSURROGATES_invlistUNI_LYCI_invlistUNI_LYDI_invlistUNI_MAHJ_invlistUNI_MAHJONG_invlistUNI_MAKA_invlistUNI_MAND_invlistUNI_MANI_invlistUNI_MARC_invlistUNI_MATH_invlistUNI_MATHALPHANUM_invlistUNI_MATHOPERATORS_invlistUNI_MAYANNUMERALS_invlistUNI_MC_invlistUNI_MCM_invlistUNI_ME_invlistUNI_MEDF_invlistUNI_MEETEIMAYEKEXT_invlistUNI_MEND_invlistUNI_MERC_invlistUNI_MERO_invlistUNI_MIAO_invlistUNI_MISCARROWS_invlistUNI_MISCMATHSYMBOLSA_invlistUNI_MISCMATHSYMBOLSB_invlistUNI_MISCPICTOGRAPHS_invlistUNI_MISCSYMBOLS_invlistUNI_MISCTECHNICAL_invlistUNI_MLYM_invlistUNI_MN_invlistUNI_MODI_invlistUNI_MODIFIERLETTERS_invlistUNI_MODIFIERTONELETTERS_invlistUNI_MONG_invlistUNI_MONGOLIANSUP_invlistUNI_MRO_invlistUNI_MTEI_invlistUNI_MULT_invlistUNI_MUSIC_invlistUNI_MYANMAREXTA_invlistUNI_MYANMAREXTB_invlistUNI_MYANMAREXTC_invlistUNI_MYMR_invlistUNI_N_invlistUNI_NAGM_invlistUNI_NAND_invlistUNI_NARB_invlistUNI_NB_invlistUNI_NBAT_invlistUNI_NEWA_invlistUNI_NFCQC__M_invlistUNI_NFCQC__Y_invlistUNI_NFDQC__Y_invlistUNI_NFKCQC__N_invlistUNI_NFKCQC__Y_invlistUNI_NFKDQC__N_invlistUNI_NKO_invlistUNI_NL_invlistUNI_NO_invlistUNI_NSHU_invlistUNI_NT__DI_invlistUNI_NT__NU_invlistUNI_NUMBERFORMS_invlistUNI_NV__0_invlistUNI_NV__1_invlistUNI_NV__10_invlistUNI_NV__100_invlistUNI_NV__1000_invlistUNI_NV__10000_invlistUNI_NV__100000_invlistUNI_NV__1000000_invlistUNI_NV__10000000_invlistUNI_NV__100000000_invlistUNI_NV__1000000000_invlistUNI_NV__10000000000_invlistUNI_NV__1000000000000_invlistUNI_NV__10000000000000000_invlistUNI_NV__11_invlistUNI_NV__11_SLASH_12_invlistUNI_NV__11_SLASH_2_invlistUNI_NV__12_invlistUNI_NV__13_invlistUNI_NV__13_SLASH_2_invlistUNI_NV__14_invlistUNI_NV__15_invlistUNI_NV__15_SLASH_2_invlistUNI_NV__16_invlistUNI_NV__17_invlistUNI_NV__17_SLASH_2_invlistUNI_NV__18_invlistUNI_NV__19_invlistUNI_NV__1_SLASH_10_invlistUNI_NV__1_SLASH_12_invlistUNI_NV__1_SLASH_16_invlistUNI_NV__1_SLASH_160_invlistUNI_NV__1_SLASH_2_invlistUNI_NV__1_SLASH_20_invlistUNI_NV__1_SLASH_3_invlistUNI_NV__1_SLASH_32_invlistUNI_NV__1_SLASH_320_invlistUNI_NV__1_SLASH_4_invlistUNI_NV__1_SLASH_40_invlistUNI_NV__1_SLASH_5_invlistUNI_NV__1_SLASH_6_invlistUNI_NV__1_SLASH_64_invlistUNI_NV__1_SLASH_7_invlistUNI_NV__1_SLASH_8_invlistUNI_NV__1_SLASH_80_invlistUNI_NV__1_SLASH_9_invlistUNI_NV__2_invlistUNI_NV__20_invlistUNI_NV__200_invlistUNI_NV__2000_invlistUNI_NV__20000_invlistUNI_NV__200000_invlistUNI_NV__20000000_invlistUNI_NV__21_invlistUNI_NV__216000_invlistUNI_NV__22_invlistUNI_NV__23_invlistUNI_NV__24_invlistUNI_NV__25_invlistUNI_NV__26_invlistUNI_NV__27_invlistUNI_NV__28_invlistUNI_NV__29_invlistUNI_NV__2_SLASH_3_invlistUNI_NV__2_SLASH_5_invlistUNI_NV__3_invlistUNI_NV__30_invlistUNI_NV__300_invlistUNI_NV__3000_invlistUNI_NV__30000_invlistUNI_NV__300000_invlistUNI_NV__31_invlistUNI_NV__32_invlistUNI_NV__33_invlistUNI_NV__34_invlistUNI_NV__35_invlistUNI_NV__36_invlistUNI_NV__37_invlistUNI_NV__38_invlistUNI_NV__39_invlistUNI_NV__3_SLASH_16_invlistUNI_NV__3_SLASH_2_invlistUNI_NV__3_SLASH_20_invlistUNI_NV__3_SLASH_4_invlistUNI_NV__3_SLASH_5_invlistUNI_NV__3_SLASH_64_invlistUNI_NV__3_SLASH_8_invlistUNI_NV__3_SLASH_80_invlistUNI_NV__4_invlistUNI_NV__40_invlistUNI_NV__400_invlistUNI_NV__4000_invlistUNI_NV__40000_invlistUNI_NV__400000_invlistUNI_NV__41_invlistUNI_NV__42_invlistUNI_NV__43_invlistUNI_NV__432000_invlistUNI_NV__44_invlistUNI_NV__45_invlistUNI_NV__46_invlistUNI_NV__47_invlistUNI_NV__48_invlistUNI_NV__49_invlistUNI_NV__4_SLASH_5_invlistUNI_NV__5_invlistUNI_NV__50_invlistUNI_NV__500_invlistUNI_NV__5000_invlistUNI_NV__50000_invlistUNI_NV__500000_invlistUNI_NV__5_SLASH_12_invlistUNI_NV__5_SLASH_2_invlistUNI_NV__5_SLASH_6_invlistUNI_NV__5_SLASH_8_invlistUNI_NV__6_invlistUNI_NV__60_invlistUNI_NV__600_invlistUNI_NV__6000_invlistUNI_NV__60000_invlistUNI_NV__600000_invlistUNI_NV__7_invlistUNI_NV__70_invlistUNI_NV__700_invlistUNI_NV__7000_invlistUNI_NV__70000_invlistUNI_NV__700000_invlistUNI_NV__7_SLASH_12_invlistUNI_NV__7_SLASH_2_invlistUNI_NV__7_SLASH_8_invlistUNI_NV__8_invlistUNI_NV__80_invlistUNI_NV__800_invlistUNI_NV__8000_invlistUNI_NV__80000_invlistUNI_NV__800000_invlistUNI_NV__9_invlistUNI_NV__90_invlistUNI_NV__900_invlistUNI_NV__9000_invlistUNI_NV__90000_invlistUNI_NV__900000_invlistUNI_NV__9_SLASH_2_invlistUNI_NV__NAN_invlistUNI_NV___MINUS_1_SLASH_2_invlistUNI_OCR_invlistUNI_OGAM_invlistUNI_OLCK_invlistUNI_ONAO_invlistUNI_ORKH_invlistUNI_ORNAMENTALDINGBATS_invlistUNI_ORYA_invlistUNI_OSGE_invlistUNI_OSMA_invlistUNI_OTTOMANSIYAQNUMBERS_invlistUNI_OUGR_invlistUNI_P_invlistUNI_PALM_invlistUNI_PATSYN_invlistUNI_PAUC_invlistUNI_PC_invlistUNI_PCM_invlistUNI_PD_invlistUNI_PE_invlistUNI_PERM_invlistUNI_PF_invlistUNI_PHAG_invlistUNI_PHAISTOS_invlistUNI_PHLI_invlistUNI_PHLP_invlistUNI_PHNX_invlistUNI_PHONETICEXT_invlistUNI_PHONETICEXTSUP_invlistUNI_PI_invlistUNI_PLAYINGCARDS_invlistUNI_PO_invlistUNI_PRTI_invlistUNI_PS_invlistUNI_PUA_invlistUNI_QAAI_invlistUNI_QMARK_invlistUNI_RADICAL_invlistUNI_RI_invlistUNI_RJNG_invlistUNI_ROHG_invlistUNI_RUMI_invlistUNI_RUNR_invlistUNI_S_invlistUNI_SAMR_invlistUNI_SARB_invlistUNI_SAUR_invlistUNI_SB__AT_invlistUNI_SB__CL_invlistUNI_SB__EX_invlistUNI_SB__FO_invlistUNI_SB__LE_invlistUNI_SB__LO_invlistUNI_SB__NU_invlistUNI_SB__SC_invlistUNI_SB__SE_invlistUNI_SB__SP_invlistUNI_SB__ST_invlistUNI_SB__UP_invlistUNI_SB__XX_invlistUNI_SC_invlistUNI_SC__ADLM_invlistUNI_SC__AGHB_invlistUNI_SC__ARAB_invlistUNI_SC__ARMN_invlistUNI_SC__AVST_invlistUNI_SC__BENG_invlistUNI_SC__BOPO_invlistUNI_SC__BUGI_invlistUNI_SC__BUHD_invlistUNI_SC__CAKM_invlistUNI_SC__CARI_invlistUNI_SC__CHER_invlistUNI_SC__COPT_invlistUNI_SC__CPMN_invlistUNI_SC__CPRT_invlistUNI_SC__CYRL_invlistUNI_SC__DEVA_invlistUNI_SC__DOGR_invlistUNI_SC__DUPL_invlistUNI_SC__ELBA_invlistUNI_SC__ETHI_invlistUNI_SC__GARA_invlistUNI_SC__GEOR_invlistUNI_SC__GLAG_invlistUNI_SC__GONG_invlistUNI_SC__GONM_invlistUNI_SC__GOTH_invlistUNI_SC__GRAN_invlistUNI_SC__GREK_invlistUNI_SC__GUJR_invlistUNI_SC__GUKH_invlistUNI_SC__GURU_invlistUNI_SC__HAN_invlistUNI_SC__HANG_invlistUNI_SC__HANO_invlistUNI_SC__HEBR_invlistUNI_SC__HIRA_invlistUNI_SC__HUNG_invlistUNI_SC__JAVA_invlistUNI_SC__KALI_invlistUNI_SC__KANA_invlistUNI_SC__KHOJ_invlistUNI_SC__KNDA_invlistUNI_SC__KTHI_invlistUNI_SC__LATN_invlistUNI_SC__LIMB_invlistUNI_SC__LINA_invlistUNI_SC__LINB_invlistUNI_SC__LISU_invlistUNI_SC__LYCI_invlistUNI_SC__LYDI_invlistUNI_SC__MAHJ_invlistUNI_SC__MAND_invlistUNI_SC__MANI_invlistUNI_SC__MERO_invlistUNI_SC__MLYM_invlistUNI_SC__MODI_invlistUNI_SC__MONG_invlistUNI_SC__MULT_invlistUNI_SC__MYMR_invlistUNI_SC__NAND_invlistUNI_SC__NKO_invlistUNI_SC__ONAO_invlistUNI_SC__ORKH_invlistUNI_SC__ORYA_invlistUNI_SC__OSGE_invlistUNI_SC__OUGR_invlistUNI_SC__PERM_invlistUNI_SC__PHAG_invlistUNI_SC__PHLP_invlistUNI_SC__QAAI_invlistUNI_SC__ROHG_invlistUNI_SC__RUNR_invlistUNI_SC__SAMR_invlistUNI_SC__SHAW_invlistUNI_SC__SHRD_invlistUNI_SC__SIND_invlistUNI_SC__SINH_invlistUNI_SC__SOGD_invlistUNI_SC__SUNU_invlistUNI_SC__SYLO_invlistUNI_SC__SYRC_invlistUNI_SC__TAGB_invlistUNI_SC__TAKR_invlistUNI_SC__TALE_invlistUNI_SC__TAML_invlistUNI_SC__TANG_invlistUNI_SC__TELU_invlistUNI_SC__TFNG_invlistUNI_SC__TGLG_invlistUNI_SC__THAA_invlistUNI_SC__THAI_invlistUNI_SC__TIBT_invlistUNI_SC__TIRH_invlistUNI_SC__TODR_invlistUNI_SC__TOTO_invlistUNI_SC__TUTG_invlistUNI_SC__YEZI_invlistUNI_SC__YI_invlistUNI_SC__ZYYY_invlistUNI_SD_invlistUNI_SGNW_invlistUNI_SHAW_invlistUNI_SHORTHANDFORMATCONTROLS_invlistUNI_SHRD_invlistUNI_SIDD_invlistUNI_SIND_invlistUNI_SINH_invlistUNI_SINHALAARCHAICNUMBERS_invlistUNI_SK_invlistUNI_SM_invlistUNI_SMALLFORMS_invlistUNI_SMALLKANAEXT_invlistUNI_SO_invlistUNI_SOGD_invlistUNI_SOGO_invlistUNI_SORA_invlistUNI_SOYO_invlistUNI_SPECIALS_invlistUNI_STERM_invlistUNI_SUND_invlistUNI_SUNDANESESUP_invlistUNI_SUNU_invlistUNI_SUPARROWSA_invlistUNI_SUPARROWSB_invlistUNI_SUPARROWSC_invlistUNI_SUPERANDSUB_invlistUNI_SUPMATHOPERATORS_invlistUNI_SUPPUAA_invlistUNI_SUPPUAB_invlistUNI_SUPPUNCTUATION_invlistUNI_SUPSYMBOLSANDPICTOGRAPHS_invlistUNI_SUTTONSIGNWRITING_invlistUNI_SYLO_invlistUNI_SYMBOLSANDPICTOGRAPHSEXTA_invlistUNI_SYMBOLSFORLEGACYCOMPUTING_invlistUNI_SYMBOLSFORLEGACYCOMPUTINGSUP_invlistUNI_SYRC_invlistUNI_SYRIACSUP_invlistUNI_TAGB_invlistUNI_TAGS_invlistUNI_TAIXUANJING_invlistUNI_TAKR_invlistUNI_TALE_invlistUNI_TALU_invlistUNI_TAMILSUP_invlistUNI_TAML_invlistUNI_TANG_invlistUNI_TANGUTCOMPONENTS_invlistUNI_TANGUTSUP_invlistUNI_TAVT_invlistUNI_TELU_invlistUNI_TERM_invlistUNI_TFNG_invlistUNI_TGLG_invlistUNI_THAA_invlistUNI_THAI_invlistUNI_TIBT_invlistUNI_TIRH_invlistUNI_TITLE_invlistUNI_TNSA_invlistUNI_TODR_invlistUNI_TOTO_invlistUNI_TRANSPORTANDMAP_invlistUNI_TUTG_invlistUNI_UCAS_invlistUNI_UCASEXT_invlistUNI_UCASEXTA_invlistUNI_UGAR_invlistUNI_UIDEO_invlistUNI_UPPERCASELETTER_invlistUNI_VAI_invlistUNI_VEDICEXT_invlistUNI_VERTICALFORMS_invlistUNI_VITH_invlistUNI_VO__R_invlistUNI_VO__TR_invlistUNI_VO__TU_invlistUNI_VO__U_invlistUNI_VS_invlistUNI_VSSUP_invlistUNI_WARA_invlistUNI_WB__DQ_invlistUNI_WB__EB_invlistUNI_WB__EX_invlistUNI_WB__EXTEND_invlistUNI_WB__FO_invlistUNI_WB__KA_invlistUNI_WB__LE_invlistUNI_WB__MB_invlistUNI_WB__ML_invlistUNI_WB__MN_invlistUNI_WB__NL_invlistUNI_WB__NU_invlistUNI_WB__SQ_invlistUNI_WB__WSEGSPACE_invlistUNI_WB__XX_invlistUNI_WCHO_invlistUNI_XIDC_invlistUNI_XIDS_invlistUNI_XPEO_invlistUNI_XSUX_invlistUNI_YEZI_invlistUNI_YI_invlistUNI_YIJING_invlistUNI_YIRADICALS_invlistUNI_YISYLLABLES_invlistUNI_Z_invlistUNI_ZANB_invlistUNI_ZL_invlistUNI_ZNAMENNYMUSIC_invlistUNI_ZP_invlistUNI_ZS_invlistUNI_ZYYY_invlistUNI_ZZZZ_invlistUNI__PERL_NCHAR_invlistUNI__PERL_PATWS_invlistUNI__PERL_PROBLEMATIC_LOCALE_FOLDEDS_START_invlistUNI__PERL_PROBLEMATIC_LOCALE_FOLDS_invlistUNI__PERL_QUOTEMETA_invlistUNI__PERL_SURROGATE_invlistregcomp_study.cS_unwind_scan_framesS_ssc_is_cp_posixl_initS_get_ANYOF_cp_list_for_sscS_ssc_orS_ssc_andS_rck_elide_nothingPerl_study_chunk.coldregcomp_trie.cS_trie_bitmap_set_foldedPerl_make_trie.coldregexec.cPerl_foldEQPerl_foldEQ_latin1Perl_foldEQ_localeS_foldEQ_latin1_s2_foldedS_reg_check_named_buff_matchedS_to_utf8_substrS_to_byte_substrS_find_span_end_maskS_find_next_maskedS_regcppopS_regcppushS_reghopmaybe3.part.0S_reghop3.part.0S_reghop3S_isFOO_lc.part.0S_setup_EXACTISH_STCSWTCH.2843CSWTCH.2844CSWTCH.2845S_reg_set_capture_string.isra.0S_set_reg_curpmPerl_utf8_hop_overshoot.constprop.0S_cleanup_regmatch_info_auxS_advance_one_WB__Perl_WB_invmapS_advance_one_LB_Perl_LB_invmapS_backup_one_SB_Perl_SB_invmapS_backup_one_LB_S_isLBLB_dfa_tableLB_tableCSWTCH.2824CSWTCH.2826CSWTCH.2823CSWTCH.2822CSWTCH.2825S_isSBS_backup_one_GCB_Perl_GCB_invmapS_isGCB.constprop.0GCB_dfa_tableGCB_tableS_backup_one_WB_but_over_Extend_FOS_isWBWB_dfa_tableWB_tableS_isFOO_utf8_lcS_reginclassS_regrepeatsets_utf8_locale_requiredscript_zerosSCX_AUX_TABLE_ptrsSCX_AUX_TABLE_lengths_Perl_SCX_invmapS_regtryb_utf8_locale_requiredS_regtry.coldS_find_byclassSCX_AUX_TABLE_1SCX_AUX_TABLE_2SCX_AUX_TABLE_3SCX_AUX_TABLE_4SCX_AUX_TABLE_5SCX_AUX_TABLE_6SCX_AUX_TABLE_7SCX_AUX_TABLE_8SCX_AUX_TABLE_9SCX_AUX_TABLE_10SCX_AUX_TABLE_11SCX_AUX_TABLE_12SCX_AUX_TABLE_13SCX_AUX_TABLE_14SCX_AUX_TABLE_15SCX_AUX_TABLE_16SCX_AUX_TABLE_17SCX_AUX_TABLE_18SCX_AUX_TABLE_19SCX_AUX_TABLE_20SCX_AUX_TABLE_21SCX_AUX_TABLE_22SCX_AUX_TABLE_23SCX_AUX_TABLE_24SCX_AUX_TABLE_25SCX_AUX_TABLE_26SCX_AUX_TABLE_27SCX_AUX_TABLE_28SCX_AUX_TABLE_29SCX_AUX_TABLE_30SCX_AUX_TABLE_31SCX_AUX_TABLE_32SCX_AUX_TABLE_33SCX_AUX_TABLE_34SCX_AUX_TABLE_35SCX_AUX_TABLE_36SCX_AUX_TABLE_37SCX_AUX_TABLE_38SCX_AUX_TABLE_39SCX_AUX_TABLE_40SCX_AUX_TABLE_41SCX_AUX_TABLE_42SCX_AUX_TABLE_43SCX_AUX_TABLE_44SCX_AUX_TABLE_45SCX_AUX_TABLE_46SCX_AUX_TABLE_47SCX_AUX_TABLE_48SCX_AUX_TABLE_49SCX_AUX_TABLE_50SCX_AUX_TABLE_51SCX_AUX_TABLE_52SCX_AUX_TABLE_53SCX_AUX_TABLE_54SCX_AUX_TABLE_55SCX_AUX_TABLE_56SCX_AUX_TABLE_57SCX_AUX_TABLE_58SCX_AUX_TABLE_59SCX_AUX_TABLE_60SCX_AUX_TABLE_61SCX_AUX_TABLE_62SCX_AUX_TABLE_63SCX_AUX_TABLE_64SCX_AUX_TABLE_65SCX_AUX_TABLE_66SCX_AUX_TABLE_67SCX_AUX_TABLE_68SCX_AUX_TABLE_69SCX_AUX_TABLE_70SCX_AUX_TABLE_71SCX_AUX_TABLE_72SCX_AUX_TABLE_73SCX_AUX_TABLE_74SCX_AUX_TABLE_75SCX_AUX_TABLE_76SCX_AUX_TABLE_77SCX_AUX_TABLE_78SCX_AUX_TABLE_79SCX_AUX_TABLE_80SCX_AUX_TABLE_81SCX_AUX_TABLE_82SCX_AUX_TABLE_83SCX_AUX_TABLE_84SCX_AUX_TABLE_85SCX_AUX_TABLE_86SCX_AUX_TABLE_87SCX_AUX_TABLE_88SCX_AUX_TABLE_89SCX_AUX_TABLE_90SCX_AUX_TABLE_91SCX_AUX_TABLE_92SCX_AUX_TABLE_93SCX_AUX_TABLE_94SCX_AUX_TABLE_95SCX_AUX_TABLE_96SCX_AUX_TABLE_97SCX_AUX_TABLE_98SCX_AUX_TABLE_99SCX_AUX_TABLE_100SCX_AUX_TABLE_101SCX_AUX_TABLE_102SCX_AUX_TABLE_103SCX_AUX_TABLE_104SCX_AUX_TABLE_105SCX_AUX_TABLE_106sv.cS_F0convertS_find_array_subscriptS_croak_overflowS_hextractS_assert_uft8_cache_coherent.part.0S_sv_pos_b2u_midwayS_sv_pos_u2b_midwayS_sv_setnvint2str_tableS_curseS_destroydo_clean_named_io_objsS_sv_unmagicext_flagsS_croak_sv_setsv_flagsS_glob_assign_globS_find_hash_subscriptS_find_uninit_varPerl_SvIVS_find_uninit_var.coldPerl_sv_2pv_flags.localaliasfake_rvS_sv_uncowS_sv_display.constprop.0S_not_a_numberS_utf8_mg_len_cache_updateS_utf8_mg_pos_cache_updateS_sv_pos_u2b_cachedS_sv_2iuv_commonS_sprintf_arg_num_valnullstr.1toke.cS_word_takes_any_delimiterS_check_scalar_sliceS_checkcommaS_check_uniyyl_safe_barewordS_parse_identident_too_longyyl_strictwarn_barewordS_missingtermS_parse_recdescent_for_opS_postderefS_force_ident.part.0yyl_croak_unrecognisedtokentype_for_plugop.isra.0S_update_debugger_infoyyl_constant_opPerl_is_utf8_string_loclen.constprop.0S_newSV_maybe_utf8yyl_fatcommaS_inclineS_add_utf16_textfilterS_utf16_textfilterS_utf16_textfilter.coldS_warn_expect_operatorS_vcs_conflict_markerS_scan_identident_var_zero_multi_digitS_intuit_moreS_force_wordyyl_hyphenS_intuit_methodS_lopyyl_just_a_word.isra.0yyl_fake_eof.constprop.0S_new_constantS_tokeqS_sublex_startS_apply_builtin_cv_attributeS_force_strict_versionS_pmflagyyl_dollaryyl_colonyyl_leftpointyyyl_subyyl_myS_scan_patyyl_leftcurlyS_scan_constbases.3Bases.0nvshift.2maxima.1S_force_versionS_tokenize_useyyl_word_or_keyword.isra.0yyl_keylookup.constprop.0yyl_tryyyl_rightcurlyS_sublex_donecrtstuff.cderegister_tm_clones__do_global_dtors_auxcompleted.0__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entryav.cS_adjust_indexbuiltin.cck_builtin_func1S_export_lexicalck_builtin_funcNck_builtin_constS_import_symbuiltin_not_recognisedbuiltinscaretx.cdeb.cdoop.cdquote.cdump.cS_deb_curcvS_append_padvar.constprop.0S_deb_padvar.constprop.0S_append_gv_nameS_sequence_num.part.0S_opdump_linkS_opdump_indentS_gv_displaysvshorttypenamesS_do_op_dump_barS_do_pmop_dump_bar.part.0Perl_dump_packsubs_perl.part.0svtypenamesPerl_do_sv_dump.localaliasmagic_namesglobals.ckeywords.cCSWTCH.101CSWTCH.103CSWTCH.102locale.cPerl_my_strlcatS_populate_hash_from_C_localeconvS_mortalized_pv_copyS_new_collateS_get_displayable_string.part.0.constprop.0S_my_localeconv.constprop.0S_populate_hash_from_localeconvS_calculate_LC_ALL_stringcategory_namescategoriesS_setlocale_failure_panic_via_i.constprop.0S_toggle_locale_iCSWTCH.413S_parse_LC_ALL_string.constprop.0category_name_lengthsS_new_LC_ALLupdate_functionsS_new_ctypeS_restore_toggled_locale_i.part.0S_ints_to_tmS_strftime_tmS_langinfo_sv_iS_get_locale_string_utf8ness_iS_is_locale_utf8S_sv_strftime_commonS_external_call_langinfo.isra.0C_decimal_pointS_new_numericS_new_ctype.part.0mathoms.cmg.cS_unwind_handler_stackS_save_magic_flagsS_restore_magicunblock_sigmaskS_mg_free_structrestore_sigmaskS_magic_sethint_feature.constprop.0S_magic_methcall1numeric.cS_strtodperlio.cPerlIOScalar_filenoPerlIOScalar_tellPerlIOScalar_flushS_lockcnt_decS_perlio_async_runPerlIOScalar_fillPerlIOScalar_bufsizPerlIOScalar_poppedPerlIOScalar_set_ptrcntPerlIOScalar_get_basePerlIOScalar_get_ptrPerlIOScalar_get_cntPerlIOScalar_seekPerlIOScalar_writecode_point_warningPerlIO_scalarPerlIOScalar_openPerlIOScalar_pushedPerlIOScalar_closePerlIO_cleantable.localaliasPerlIOScalar_argPerlIOBase_dup.localaliasPerlIOScalar_dupPerlIOScalar_readperly.cS_clear_yystackyy_type_tabyystosyytranslateyypactyycheckyydefactyyr2yypgotoyyr1yydefgotoyytablepp.cS_postincdec_commonS_localise_helem_lvalS_localise_gv_slotS_find_runcv_nameS_sv_or_pv_pos_u2bS_maybe_unwind_defavS_localise_aelem_lvalS_reftoS_scomplementS_rv2gvS_negate_stringS_do_chompCSWTCH.2429CSWTCH.2430CSWTCH.2431pp_hot.cPerl_rpp_extendS_softref2xv_liteS_padhv_rv2hv_common.part.0S_are_we_in_Debug_EXECUTE_rS_croak_undefined_subroutineS_pushavS_opmethod_stashS_do_concata_hash.0an_array.1pp_pack.cdoencodesS_group_endmarked_upgradeS_sv_exp_growS_my_bytes_to_utf8S_sv_check_infnanS_next_symbolS_measure_structpackpropsutf8_to_byteS_utf8_to_bytesS_unpack_recS_pack_recreentr.cregcomp_debug.cregcomp_invlist.cS_invlist_replace_list_destroys_srcPerl_newSV_type.constprop.0S__append_range_to_invlistrun.cscope.cS_save_scalar_atleave_scope_arg_countstaint.cmisc_env.0time64.cdays_in_monthjulian_days_by_monthlength_of_yearsafe_yearsutf8.cS_new_msg_hvS__to_utf8_casemalformed_textS_check_locale_boundary_crossinguneesUC_AUX_TABLE_lengthsUppercase_Mapping_invmapUC_AUX_TABLE_ptrsTC_AUX_TABLE_lengthsTitlecase_Mapping_invmapTC_AUX_TABLE_ptrsLC_AUX_TABLE_lengthsLowercase_Mapping_invmapLC_AUX_TABLE_ptrs_Perl_IVCF_invmapIVCF_AUX_TABLE_ptrsIVCF_AUX_TABLE_lengthsSimple_Case_Folding_invmapUC_AUX_TABLE_1UC_AUX_TABLE_2UC_AUX_TABLE_3UC_AUX_TABLE_4UC_AUX_TABLE_5UC_AUX_TABLE_6UC_AUX_TABLE_7UC_AUX_TABLE_8UC_AUX_TABLE_9UC_AUX_TABLE_10UC_AUX_TABLE_11UC_AUX_TABLE_12UC_AUX_TABLE_13UC_AUX_TABLE_14UC_AUX_TABLE_15UC_AUX_TABLE_16UC_AUX_TABLE_17UC_AUX_TABLE_18UC_AUX_TABLE_19UC_AUX_TABLE_20UC_AUX_TABLE_21UC_AUX_TABLE_22UC_AUX_TABLE_23UC_AUX_TABLE_24UC_AUX_TABLE_25UC_AUX_TABLE_26UC_AUX_TABLE_27UC_AUX_TABLE_28UC_AUX_TABLE_29UC_AUX_TABLE_30UC_AUX_TABLE_31UC_AUX_TABLE_32UC_AUX_TABLE_33UC_AUX_TABLE_34UC_AUX_TABLE_35UC_AUX_TABLE_36UC_AUX_TABLE_37UC_AUX_TABLE_38UC_AUX_TABLE_39UC_AUX_TABLE_40UC_AUX_TABLE_41UC_AUX_TABLE_42UC_AUX_TABLE_43UC_AUX_TABLE_44UC_AUX_TABLE_45UC_AUX_TABLE_46UC_AUX_TABLE_47UC_AUX_TABLE_48UC_AUX_TABLE_49UC_AUX_TABLE_50UC_AUX_TABLE_51UC_AUX_TABLE_52UC_AUX_TABLE_53UC_AUX_TABLE_54UC_AUX_TABLE_55UC_AUX_TABLE_56UC_AUX_TABLE_57UC_AUX_TABLE_58UC_AUX_@X!" *"`<!" k -2"p+ :E"uV"m"y \y""V 0" }"`(}"V;"""0#0; #P +# <#`'R#f#@ {#0>##d #^# M |##V $$: -$ D$;O$b$u$P!"$$<$`$ B$0~<$$$%'% 5%2E%]%Pk !p%j%%% %0%;%p<%z<&Q&b 2%&h;1&<D&D *T& Ji& w&&8 &t&<&(&0A W&8~<&}<&` 'U;&'p_ 6'd H'<P'<Z'@m'<'' ' B'`y'X n'(<'@'`* ( )(B((H:(qUL(a((((`,((<(0=(@O) )s ;)O)~a) w)P)` ) )=)\<)p2q))Ky)p,*p,*T3*{<C*Y*l*e d~*PUp*p *<*`&* *@ * W* A +<+ (+7+X+ k+a {+}+ ++`R4+ <+`+<+M+H~< ,6 9 ,` +3,` >,;O,<U,|<d,`,kr,в ,r, 2 ,P<,[ ,,pL -@-;(-`J;-pYML- ]-<g-  }-I--~<--@J- J-.И .".@LP4. f@.S.g. &.Ѐ<. U,. ; .h.Л . D..A/</ f!/U//<-;ЎZA; [; Bh;VXw;<;; ;<;P.;<;1;Q Z<$<Т 3<p D<Y<A -l<|<<Pg <p <Z <n<<< : =<="=;,=P7 `@=(;N=g= x=|<=<=N = <=0fu==%=C+=8>7>|O>(<Z> o> \ 0> 3>@:X Y>u>`!>>` I>??( $?` 5?N AJ? ;(V?yvj?po{?@<H?d? : ?P?@ ?<?" @_*@Ȉ<;@ oL@p _@ j@p;|@PP@ @`Z@d;@@<@@@AЋ(A@<3A Ap[ AA` AA {< B{BЃ = -B@B`G KSB@dBwBX<B,BP{<BBp<BdBp 9B B B[ CCC,C=C HOC GhC:`wC@= ]Cr C<C /CX ,C C8{<C .C<DD $D7D;DDH<JD/bDA uDP DDX<Dz rD`DP<DDt1 Es ZEГ )E@<pQ WQp9QQ`|Q<QKQ`#QP~ QR5RX n%R@ 6RpERP SRC^RvRpRP.,R{ Rp R<R?OR`kR  Sx<SH{<'S W4S @SP LSp *fSsS<S S`V SPDS mS S!SWT:&T3TCT`QT bTGrTȀ<Ts lTTh~<T T@;T vTT U;U+<U`<*U055U PFU<WUP \eU0<uUP UU`~<UȂ<U`UU YU`{|Up$ V|< V<81V MCVpK_QV0 gdVh<tV@ V;V0] VV' }VV V0 I W W`<0W3EWPXW@ ;pfW.<qW<}W WWAOWWЙW[WW8,XP\ !X:9Xz<KXPb ZXlX <P vX0' X0 (X<XXP.X:X X XI XrYY+YZ ;Y KY<ZYc pYY<YE9YYX<Y<YQ;Y\ Y;Z<Z'Z0<-ZpuAZ@SZpaZpZ`Z<Z UZ`Z 5 Z0ZB Z1 <[v[ #[B.[|<<[ ?X[m[<[<H[[ [h{<[[ ,[@ H[6n\;\0<*\: &8\Pd I\S!Z\Cf\8 x\`h\؈<\\\@T\ \\z X]].]D]= 0V]@Di]gt]@|]] V]c]]@T]x{<]^@ x^$^Q `8^)G^T^`qfd^p\ u^`^<^@<^0GO^h<^^ ^B __py _<4_G_S_`0+e_1v__ _GS_mark_padname_lvalueS_scalar_mod_typeS_is_handle_constructorS_set_hasevalS_search_constS_last_non_null_kidS_link_freed_opPerl_croak_memory_wrapS_assignment_typeS_assignment_type.coldS_forget_pmopS_op_varname_subscriptS_looks_like_boolS_fold_constants_evalconst_sv_xsubwalk_ops_find_labelsconst_av_xsubPerl_CvGVS_perl_hash_siphash_1_3_with_state_64.constprop.0sbox32_hash_with_state.constprop.0custom_op_register_freePerl_newSV_typebodies_by_typeS_process_optreewalk_ops_forbidS_op_clear_gvS_op_const_svPerl_cv_ckproto_len_flags.coldcustom_op_register_vtblxop_null.0S_cant_declareS_is_control_transfercheck_precedence_not_vs_cmpS_bad_type_pvS_bad_type_gvS_already_definedPerl_scalarvoid.coldPerl_scalar.coldS_scalarbooleanPerl_op_lvalue_flags.coldPerl_ck_return.coldS_voidnonfinalS_dup_attrlistS_gen_constant_listPerl_ck_entersub_args_list.coldPerl_ck_subr.coldS_fold_constantsS_ref_array_or_hashPerl_ck_entersub_args_proto.coldS_new_logopPerl_cmpchain_finish.coldS_newONCEOPno_list_state.1Perl_newFOROP.coldS_move_proto_attrPerl_ck_trycatch.coldarray_passed_to_statPerl_ck_exec.coldPerl_ck_helemexistsor.coldPerl_ck_grep.coldPerl_ck_tell.coldPerl_ck_refassign.coldPerl_ck_sort.coldPerl_ck_stringify.coldPerl_ck_entersub_args_core.colddestroy_subsignature_contextS_newGIVWHENOP.constprop.0S_process_special_blocksS_apply_attrs.isra.0S_my_kidperl.cS_init_idsPerl_SvREFCNT_decS_moreswitch_mread_e_scriptS_Internals_Vnon_bincompat_options.1S_incpush_if_existsS_my_exit_jumpS_incpushS_incpush_use_seplocal_patchesS_init_postdump_symbolsPerl_my_exit.coldS_minus_vS_usageusage_msg.0Perl_my_failure_exit.colduniversal.cS_isa_lookupS_isa_lookup.coldoptimize_out_native_convert_functionXS_version_qvS_sv_derived_from_svpvnXS_version_newXS_universal_versionXS_utf8_native_to_unicode.localaliasXS_version_from_tupleXS_version_tupleS_version_check_keyXS_version_is_qvXS_version_is_alphaXS_version_booleanXS_version_vcmpXS_version_to_dotted_decimalXS_version_to_decimalXS_version_normalXS_version_numifyXS_version_stringifyXS_version_noopfile.0these_detailsclass.cS_split_attr_namevalS_class_apply_attributeapply_class_attribute_isaS_class_apply_field_attributeapply_field_attribute_readerapply_field_attribute_writerapply_field_attribute_paraminvoke_class_sealPerl_class_seal_stash.colddoio.cS_openn_setupS_exec_failedS_dir_unchanged.isra.0S_argvout_dupS_openn_cleanupS_argvout_finalS_argvout_freeargvout_vtblPerl_do_aexec5.coldgv.cPerl_cvgv_from_hek.coldcore_xsubS_gv_init_svtypeS_maybe_add_coresubS_require_tie_modPerl_gv_check.localaliasS_gv_fetchmeth_internalS_autoloadPL_AMG_namelensPL_AMG_namesPerl_amagic_call.localaliashv.cS_save_hek_flagsS_hsplitS_share_hek_flagsS_hv_auxinitS_unshare_hek_or_pvnhek_eq_pvn_flagsS_hv_free_entriesS_clear_placeholdersS_hv_notallowedPerl_hv_common.localaliasS_strtab_errorS_refcounted_he_valuePerl_hv_undef_flags.coldmro_core.cS_mro_clean_isarevPerl_mro_set_private_data.localaliasdfs_algS_mro_get_linear_isa_dfsS_mro_get_linear_isa_dfs.coldS_mro_gather_and_renameS_mro_gather_and_rename.coldpad.cPerl_cv_name.coldS_cv_cloneS_cv_clone.coldS_pad_alloc_nameS_pad_findlexpeep.cS_scalar_slice_warningS_scalar_slice_warning.coldS_finalize_opS_finalize_op.coldS_warn_implicit_snail_cvsigS_check_for_bool_cxt.constprop.0S_maybe_multiderefS_aassign_scan.constprop.0S_maybe_multiconcatS_maybe_multiconcat.coldS_optimize_opS_optimize_op.coldPerl_rpeep.coldpp_ctl.cS_dopoptosub_atS_dopoptogivenforS_dofindlabelS_docatchS_make_matcherS_try_run_unitcheck.constprop.0S_try_yyparse.constprop.0S_outside_integer.part.0S_matcher_matches_svS_pop_eval_context_maybe_croakS_check_type_and_openS_doopen_pm_invoke_defer_blockinvoke_finally_blockS_run_user_filterS_run_user_filter.coldS_do_smartmatchS_doeval_compilePL_feature_bitsPerl_pp_formline.coldS_unwind_loopcontext_namepp_sort.cS_sortcv_stackedsortsv_cmp_locale.constprop.0sortsv_cmp.constprop.0sortsv_cmp_locale_desc.constprop.0sortsv_cmp_desc.constprop.0S_sortcv_xsubS_sortcvsortsv_ncmp_desc.constprop.0S_amagic_i_ncmpsortsv_amagic_i_ncmp.constprop.0sortsv_amagic_i_ncmp_desc.constprop.0sortsv_ncmp.constprop.0sortsv_i_ncmp_desc.constprop.0sortsv_i_ncmp.constprop.0sortsv_amagic_cmp_desc.constprop.0sortsv_amagic_cmp_locale_desc.constprop.0sortsv_amagic_ncmp_desc.constprop.0sortsv_amagic_cmp.constprop.0sortsv_amagic_cmp_locale.constprop.0sortsv_amagic_ncmp.constprop.0Perl_pp_sort.coldpp_sys.cS_warn_not_dirhandleS_space_join_names_mortalS_ft_return_falsePerl_SvPV_helper.constprop.0S_try_amagic_ftestS_doformzero_but_trueCSWTCH.1389CSWTCH.1390CSWTCH.1391CSWTCH.1392CSWTCH.1394CSWTCH.1396Perl_pp_fttext.coldmonname.1dayname.0regcomp.cPerl_regnode_afterS_delete_recursion_entryPerl_SvREFCNT_dec_NNS_skip_to_be_ignored_textS_nextcharS_regex_set_precedenceS_reg_scan_nameS_get_fq_nameS__invlist_contains_cpS_set_regex_pvS_change_engine_sizePerl_av_countS_execute_wildcard.constprop.0S_reginsert.constprop.0Perl_utf8_hop_back_overshoot.constprop.0S_re_croakS_get_quantifier_valueS_reg_nodeS_reg1nodeS_reg_la_OPFAILS_reg2nodeS_regtailS_regtail.coldS_alloc_code_blocksS_free_codeblocksS_pat_upgrade_to_utf8S_output_posix_warningsPerl_populate_anyof_bitmap_from_invlist.part.0S_is_ssc_worth_it.isra.0S_concat_patS_concat_pat.coldS_add_multi_matchS_add_multi_match.coldS_reg_la_NOTHINGS_handle_possible_posixS_handle_possible_posix.coldS_handle_named_backrefS_ssc_finalizemph_tablemph_blobUNI_ASCII_invlistUNI_XPOSIXALNUM_invlistUNI_XPOSIXALPHA_invlistUNI_XPOSIXBLANK_invlistUNI_CASED_invlistUNI_XPOSIXCNTRL_invlistUNI_XPOSIXDIGIT_invlistUNI_XPOSIXGRAPH_invlistUNI_XPOSIXLOWER_invlistUNI_XPOSIXPRINT_invlistUNI_XPOSIXPUNCT_invlistUNI_XPOSIXSPACE_invlistUNI_XPOSIXUPPER_invlistUNI_VERTSPACE_invlistUNI_XPOSIXWORD_invlistUNI_XPOSIXXDIGIT_invlistUNI_POSIXALNUM_invlistUNI_POSIXALPHA_invlistUNI_POSIXBLANK_invlistUNI_POSIXCNTRL_invlistUNI_POSIXDIGIT_invlistUNI_POSIXGRAPH_invlistUNI_POSIXLOWER_invlistUNI_POSIXPRINT_invlistUNI_POSIXPUNCT_invlistUNI_POSIXSPACE_invlistUNI_POSIXUPPER_invlistUNI_POSIXWORD_invlistUNI_POSIXXDIGIT_invlist_Perl_GCB_invlist_Perl_SB_invlist_Perl_WB_invlist_Perl_LB_invlist_Perl_SCX_invlistAboveLatin1_invlistUpperLatin1_invlistUNI_ASSIGNED_invlistUNI__PERL_IDSTART_invlistUNI__PERL_IDCONT_invlistUNI__PERL_CHARNAME_BEGIN_invlistUNI__PERL_CHARNAME_CONTINUE_invlistUNI__PERL_ANY_FOLDS_invlistUNI__PERL_FOLDS_TO_MULTI_CHAR_invlistUNI__PERL_IS_IN_MULTI_CHAR_FOLD_invlistUppercase_Mapping_invlistLowercase_Mapping_invlistTitlecase_Mapping_invlistSimple_Case_Folding_invlist_Perl_IVCF_invlistUNI_M_invlist_Perl_CCC_non0_non230_invlistUNI_CO_invlistuni_prop_ptrsUNI_prop_value_ptrsS_parse_uniprop_stringS_handle_user_defined_propertyS_regclassS_regS_grok_bslash_NS_regbranchparens.0S_reg.coldPerl_re_op_compile.coldS_regpiecePerl_get_regclass_aux_data.coldUNI_age_valuesUNI_ahex_valuesUNI_bc_valuesUNI_blk_valuesUNI_bpt_valuesUNI_ccc_valuesUNI_dt_valuesUNI_ea_valuesUNI_gc_valuesUNI_gcb_valuesUNI_hst_valuesUNI_identifierstatus_valuesUNI_identifiertype_valuesUNI_incb_valuesUNI_inpc_valuesUNI_insc_valuesUNI_jg_valuesUNI_jt_valuesUNI_lb_valuesUNI_nfcqc_valuesUNI_nfdqc_valuesUNI_nt_valuesUNI_nv_valuesUNI_sb_valuesUNI_sc_valuesUNI_vo_valuesUNI_wb_valuesUNI_ADLM_invlistUNI_AEGEANNUMBERS_invlistUNI_AGE__10_invlistUNI_AGE__11_invlistUNI_AGE__12_invlistUNI_AGE__12_DOT_1_invlistUNI_AGE__13_invlistUNI_AGE__14_invlistUNI_AGE__15_invlistUNI_AGE__15_DOT_1_invlistUNI_AGE__16_invlistUNI_AGE__2_invlistUNI_AGE__2_DOT_1_invlistUNI_AGE__3_invlistUNI_AGE__3_DOT_1_invlistUNI_AGE__3_DOT_2_invlistUNI_AGE__4_invlistUNI_AGE__4_DOT_1_invlistUNI_AGE__5_invlistUNI_AGE__5_DOT_1_invlistUNI_AGE__5_DOT_2_invlistUNI_AGE__6_invlistUNI_AGE__6_DOT_1_invlistUNI_AGE__6_DOT_2_invlistUNI_AGE__6_DOT_3_invlistUNI_AGE__7_invlistUNI_AGE__8_invlistUNI_AGE__9_invlistUNI_AGHB_invlistUNI_AHOM_invlistUNI_ALCHEMICAL_invlistUNI_ALL_invlistUNI_ALPHABETICPF_invlistUNI_ANCIENTGREEKMUSIC_invlistUNI_ANCIENTGREEKNUMBERS_invlistUNI_ANCIENTSYMBOLS_invlistUNI_ANY_invlistUNI_ARAB_invlistUNI_ARABICEXTA_invlistUNI_ARABICEXTB_invlistUNI_ARABICEXTC_invlistUNI_ARABICMATH_invlistUNI_ARABICPFA_invlistUNI_ARABICPFB_invlistUNI_ARABICSUP_invlistUNI_ARMI_invlistUNI_ARMN_invlistUNI_ARROWS_invlistUNI_AVST_invlistUNI_BALI_invlistUNI_BAMU_invlistUNI_BAMUMSUP_invlistUNI_BASS_invlistUNI_BATK_invlistUNI_BC__AL_invlistUNI_BC__AN_invlistUNI_BC__B_invlistUNI_BC__BN_invlistUNI_BC__CS_invlistUNI_BC__EN_invlistUNI_BC__ES_invlistUNI_BC__ET_invlistUNI_BC__FSI_invlistUNI_BC__L_invlistUNI_BC__LRE_invlistUNI_BC__LRI_invlistUNI_BC__LRO_invlistUNI_BC__NSM_invlistUNI_BC__ON_invlistUNI_BC__PDF_invlistUNI_BC__PDI_invlistUNI_BC__R_invlistUNI_BC__RLE_invlistUNI_BC__RLI_invlistUNI_BC__RLO_invlistUNI_BC__S_invlistUNI_BC__WS_invlistUNI_BENG_invlistUNI_BHKS_invlistUNI_BIDIC_invlistUNI_BIDIM_invlistUNI_BLOCKELEMENTS_invlistUNI_BOPO_invlistUNI_BOPOMOFOEXT_invlistUNI_BOXDRAWING_invlistUNI_BPT__C_invlistUNI_BPT__N_invlistUNI_BPT__O_invlistUNI_BRAH_invlistUNI_BRAI_invlistUNI_BUGI_invlistUNI_BUHD_invlistUNI_BYZANTINEMUSIC_invlistUNI_C_invlistUNI_CAKM_invlistUNI_CANS_invlistUNI_CARI_invlistUNI_CASEDLETTER_invlistUNI_CCC__0_invlistUNI_CCC__1_invlistUNI_CCC__10_invlistUNI_CCC__103_invlistUNI_CCC__107_invlistUNI_CCC__11_invlistUNI_CCC__118_invlistUNI_CCC__12_invlistUNI_CCC__122_invlistUNI_CCC__129_invlistUNI_CCC__13_invlistUNI_CCC__130_invlistUNI_CCC__132_invlistUNI_CCC__14_invlistUNI_CCC__15_invlistUNI_CCC__16_invlistUNI_CCC__17_invlistUNI_CCC__18_invlistUNI_CCC__19_invlistUNI_CCC__20_invlistUNI_CCC__202_invlistUNI_CCC__21_invlistUNI_CCC__214_invlistUNI_CCC__216_invlistUNI_CCC__22_invlistUNI_CCC__23_invlistUNI_CCC__24_invlistUNI_CCC__25_invlistUNI_CCC__26_invlistUNI_CCC__27_invlistUNI_CCC__28_invlistUNI_CCC__29_invlistUNI_CCC__30_invlistUNI_CCC__31_invlistUNI_CCC__32_invlistUNI_CCC__33_invlistUNI_CCC__34_invlistUNI_CCC__35_invlistUNI_CCC__36_invlistUNI_CCC__6_invlistUNI_CCC__7_invlistUNI_CCC__8_invlistUNI_CCC__84_invlistUNI_CCC__9_invlistUNI_CCC__91_invlistUNI_CCC__A_invlistUNI_CCC__AL_invlistUNI_CCC__AR_invlistUNI_CCC__B_invlistUNI_CCC__BL_invlistUNI_CCC__BR_invlistUNI_CCC__DA_invlistUNI_CCC__DB_invlistUNI_CCC__IS_invlistUNI_CCC__L_invlistUNI_CCC__R_invlistUNI_CE_invlistUNI_CF_invlistUNI_CHAM_invlistUNI_CHER_invlistUNI_CHEROKEESUP_invlistUNI_CHESSSYMBOLS_invlistUNI_CHRS_invlistUNI_CI_invlistUNI_CJK_invlistUNI_CJKCOMPAT_invlistUNI_CJKCOMPATFORMS_invlistUNI_CJKCOMPATIDEOGRAPHS_invlistUNI_CJKCOMPATIDEOGRAPHSSUP_invlistUNI_CJKEXTA_invlistUNI_CJKEXTB_invlistUNI_CJKEXTC_invlistUNI_CJKEXTD_invlistUNI_CJKEXTE_invlistUNI_CJKEXTF_invlistUNI_CJKEXTG_invlistUNI_CJKEXTH_invlistUNI_CJKEXTI_invlistUNI_CJKRADICALSSUP_invlistUNI_CJKSTROKES_invlistUNI_CJKSYMBOLS_invlistUNI_CN_invlistUNI_COMPATJAMO_invlistUNI_COMPEX_invlistUNI_CONTROLPICTURES_invlistUNI_COPT_invlistUNI_COPTICEPACTNUMBERS_invlistUNI_COUNTINGROD_invlistUNI_CPMN_invlistUNI_CPRT_invlistUNI_CUNEIFORMNUMBERS_invlistUNI_CURRENCYSYMBOLS_invlistUNI_CWCF_invlistUNI_CWCM_invlistUNI_CWKCF_invlistUNI_CWL_invli v s,p `Ga,t 0-D?pVBMPl}cDH{- EPY  >F-J&"pD 0 ELR \^7Cp 0 9M@%J{u^S AU'и0@@PR [.@n #  g # .Y# 0! *c;M[jv0 +  3 )& nT` >#@3g2 <pfJr[ nZl l/s(`N!/yE 96GXdkp[} i`?ОUOxE y `t*: !R@ j v +<@d@i[h a6So@ p+ 9%0}20F`?Kp'Z# "iB^z~P 1 Z@D}# z-@;:}=FqWgКt /  p,P! cEe6&$`}5 JBд bUXafq  }*7 m`/ 4%pBP QW`D o60   V} `n6p&p%a2kByS0|*dPu`S ` g@@pK  (  `_@<r,X=5Z l}~p! N0~ m o@@fs@eK'@7BP ?T[p10 0&Мb 4B$],\& :(JKG Z Sv kxJ U&h @ V'p7 K@!k P WK0H_AE{K@  N+Pu=0JP[Рhpvy@! ) Y@ 0Dn2cH 0U`|(n={@ JPM`9c0ep\ > %P5a3 ANp^ /l 'w:ЩP  F )`6`hH^OT4rbP Mo`P@# (KPd 8<6pkT5IB\nG*}h_ 2+l `p nM0mJp , 9/г G?GY.jqPPdi@$` +G < > m"/<<\JPOWGrppP`go&g1;@Fre{ @Iu`)*08&=PQpNU` n@ SUT !u`0 jj}@Wp C) )5-Dp V8c zu00 w`m0L H*`tgCv#`j3<C` Z09jjsv 3k60 H<P  P:eP+<PK` 3bP% s X @pp @b pU <2@$=?;H`V ems~A{1}@pV!<L)D`<QP^X;t<` Y U;`B bhP<0j p !=/(I ^0t(l` ;8x<9T@@|r |<"V x30 A`{<X<g@ vp~ '  pM``lt   y1<;d I0? Yx 2iz ;  ' > <0j<R2$<*K:9:pOq byp%0<RZT<H; 8J 2@ u&؁<5`UEZl~`7; @;pGȃ< <p-);<EY`z l1{` m ~<*CPBw +D> D )R _І .rK(PP <BT z<pM " EVBW8<a rb9@<<PX <| < Tn0 5{<C $V .sjEy0=vPm<p;#P~< l /9 @؃<Mpu [l;i v)"cH< >p>P ? %D0<6< @pA%Kh<X8<hV | EDK@ d`( #V   yS&`b F5X  Kui_ 5u@~< ?@ ; <#6ـ<H{<Xc h} n H@<< X<@H<0HdU gMx`' `  W/!P%8@O fI`;hZm 2}@<0O<P<o|<*!E)_FOtp$<Y*< >  \;@@( ?)\n`:<n8<s FDW0P01xP ?p{<.7 D|<U#4n  ;Ђ<;0@8<Ѓ< A>@" [7K 8^> ]oP/ ;4k`p Kg<h< 1 >(<G OY@ lb zh q`<@ ]:{:0 P =`}Q<h75xG W@K<0< (< ;P 0  <3B~EБ Q<] nzuG{<X| @f e@t /' \3PH ,C7FU ! q9E 4< PE P~FQ<pp<.-PXH\Jl9{`;a rxq d? <B*\%s09<D` V= Zg0y{ FD 6p}<` P/0< 0K 7!0sn?Sf({<t L` ,\ W6 <h? 9<;)@`BM[k@pJ (<<Q0!)PJ$7<E -U1f@ s p <`TZ+Y<@<XI~<Wp g{<o;z <P $r"0<-P$5G<U`d v@ 3-4G < 4 fPb= "<,x<9Kp V fx`<s <0," (0M6 Ep`0Nnp  ;P 0 !P 'tAP M3@<A0R \Pk-y. <c l09# <0 : U+f ==J<^ aqD>W< _`> O! !8L`  q0.h W ]@ `<8 $'!@p KS@<a|< *pb @8n =< 8<0!*@@c N|<cFWuz<<<P (` W(H< \ Z .C -W f fP p-0 P ]P :p@{<PE *   n' = DL 8<^ :@v P  & {< S }   <  `7  Y/ E @Q  m H<w  pN Py K  VU  <    P  "/  ? гjc ;s C X<  P;    < :8  :$ | 1 * HD  TDR f pK  ~< < e P    n 9    , C; @ I `f ps    0:! 1W < 0"y  2 P < T;,`*=A vVd` p lPm E`b&@W <P2-!$5A0 N` g[<iz@< 8<p <`x z< !+ T <(z<7*K0v !b o@:  "1o @  9p<' D[ Dn 2~@Lp0' !| PA"0I/X T= 4H \p=}Ј<X<(<|<`} << <h< 7` fEpQ ]Y3 Qm<{PE.T @ `:p<`$-</p<;<Hc<t<R2x<::1C ZQz<* E<RP i:}"к6 d/P+*$<*؂<8Y3R0]o Xi| p =<P9`!PN  К ]  - 'B8OWOg qn,<pTJ TOPD M@ p@/ A My %[0v<0 9 g%p G .P:&ЂH< PA@.<?`N;^vPC/<<  zE @O B 3ZWBr hR_?oЁ<P@w"0{<<.{< PY L;'!!7 YKS(<h`* u0$Q @ +<<z< ` r$P7O`c5o8<p* m! <$E <p:`4* X;@:V@:f{ w ~<P <P<<p<{<X{<,<<No_ (vf Kȁ<z<J # 7 ] (  :BI SY`< Fh;t,< !W X&R S 0Cw& М2  FC ~<R i Uuz   C *  P29  (  H< ! /!V0A!?$R!P/`!x!]!<!w !0bj!yW!0_h %0}h$0h $h$0h$0h$h@$i$0*i`$=i$Pi$0ki$~i@$i$0i`$i$i %Pi%0j`%p#j %@?j%0Yj%@tj %j%0j%@j %j` %@j %Pk %`.k` %0Ik %0ck %}k@ %0k %0k $ k$`k@$k$pl`$`l $@-l$0Fl$0Yl`$0pl $0l$0l$0l`$0l $0l$0l$0l`$0m$"m@$0t$POt@$0nt~$@t}$t@}$@t}$0t|$Pt p$ to$0tn$um$0u@m$$ul$4u@k$`Cu`f$Rue$cu e$rud$pu`d$0u d$@uc$`uc$@u@c$0uc$0u b$ va$0&vU$0 5v`U$@Fv@P$UvP$0ev N$vv M$vL$PvL$0v@L$@vK$v`K$0v K$0v@<$v;$Pw;$0w`;$@0w;$`Cw8$Vw#$`iw"$|w@#0#w#0*w#w#`w`#@w#w@#`x#0)xi#6'xg#p6x g#PKxf#@`xc#uxb#`x`b#@x`a#xa#Px`#@x`#0x@`#@y`#0y_#P2y@_#PGy_#0\y^#qy]#y@]#py]#0y\#py@\#0yY#`yY#PzX#z@X#.zW#Cz W#XzV#0mzU#z`S#`z`R#z R#0zQ# zO#zN#z@N#0{M#){M#>{L#PS{@L#Ph{L#@}{K#{J#@{I#{I#@{F#{`F#p{F#P|`E#%| E#@:|D#0O|D#@d|`D#0y| D#@|C#@|C#0|C#|B#@|@B#|A#p }`A#`!}A#P6}@#@J}@#@_}@@#0t}@?#}?#@}>#0}>#0}@>#0}=#P};#~;#@~`;#@1~ ;#@F~:#0[~:#0p~`:#@~`9#~ 9#0~8#@~8#0~@8#`~7#P7#@`7#@- 6#@B5#`W4#l`4#P 4#@3#03#@3#2#@2#0@2#0`1#)1#P>0#@Q%# f##@u ##P"#@"#0"#̀!#@݀`!#`@ # #0!#0#0?`#0V #0o@ # ~ #@ #0 #@@ #0 #0ׁ`# #@#0@#$#0;#0R#0i@#0#0#0#0Ƃ@#0#0#0$`#P5 #0[#0#0@#P#0у"``"0 "0 "`@"-"`>"0S"d`"u "0"0"@`"0ʄ"`ۄ`""P`""@"0"Al3S"@d"u"@`"0@" "0ą"0؅"0@"@"0C3(,"0<"0Q@"0k"|"""@"Ɔ@"`Ն"0"@"0 P""1@"pH@"[ "n"P%@"""@"P͇@""0" @_"@2 _"@1," 2B"*S"@d`"`u" "!0!0`!0׈!!0@!0!0!0. !=! N@!-_!@w!p#1‰"1@ 1 @!0%5X#JXbY~^C_|`c\ʊt\ *C 0+C +C3+>M,dl,}-P/`012[͋44@5I5`7V$ 6`0 6`< 6`HhPxʌ6ڌ@O7,  6$4f,}36[@ 6$I6;U6|a@6>m65y6|0K70H6 Ѝ`6ڍ0p66Я*7!C6F] 6hj`;X}6k6@ɣ 6LĎ\ Ҏf@6L66 6!616A6 Q6 a6qp6@6, 666$Ə6(׏66 p6 `6 X6,P6=@6 N06_(6p666 6 6Ő6֐6 66 66+p6 <P6M@6 ^ 6 o6$66 664đ@60Ց6T6\p6`6 X6*P6;H6L86 ](6 n6 6666Ò6 Ԓ6666`6,)P6:@6K06 \ 6 m6~666 6“6ӓ66 6p6@6((6,96 J6,[`60l 6$}66 666Ҕ6`6@ 6<6,60'x6 8p6I`6 ZX6kP6}H686 06 6 ŕ6ו6`hjY`jjW"j-lAQlKe0myqr/7727pіa)/p_#E(-\ DB a7itPr ~.җ<P`K Ԅ7@y9}N@[0gyп7 0֘0XP|1@n"7*GAEQPx L@""0AB̙\ NK`[x`iy7B9xDG0*T`_@oPus 0@h˚@`M=m,0!4`;F0 T&'%a;(i;(q@7({@;(cZ`dLe4H; ؛0 1 7\ ]P]3<?:f]r:`))[k@]fќ]@^Fab.;  )/6?F`f Rg ng $h i &k l q̝y ٝ:0 @  4 :@ 2[:gq|4  H- g0. u؞/ ^0  1 '3 CW cP9 };p 8? -ß@@ 0՟`4pA ppE %`;p6p 2BPF dF qG I P &O S ԠU X`[ Ws %/4О K ^ np ~ 1@ @ PФ á աߡU    * 8 Kp ]@! ;q! 7! v@" ^" #Ȣ" ݢ# $ m R@;#: 5T IX \Y UyP] ^ d` T`v ǣϣp ߣ%@,@vpH/* kH)Wj#*W(i2@L*: ? S ip N| z@   p 1 @̤P Ԥ  ` @ o`P@)28B@TЁp0t  {å0#ϥإ p\]P^a5 @a3aEbOSjdnl{nr=D=Φ>>?)/172Hl7;_g;(r{770778@̧0!ܧ7? 757I'7 @;HR`7.g7T ;p38`8$;Ҩ@ 8;@838@I8J;P7*797H7W7 f7 u777777ѩ77 p7 `7 X7!P71H7A@7Q87a07q(7 77777Ѫ77777!717A7Q7a7q777777ѫp7 h7`7X7P7!@7 107 A(7Q7 a7 q777 777Ѭ77 777!7 17 Ax7Qp7ah7q`7X7P7`7X7P7έ@7 ݭ07 (7 7 77(787H7X7 h7 x7 7777 Ȯ7خ77x7 h7 `7(P7 8@7 H87X07h 7 x7777 7ȯ7د77 7 77(787H7X7hP8yH8@88808(8ΰ 8߰8888 %8 78I8[8m88888DZ8ٱ888 x8!p83h8E`8W38jL8{L8L8L8L8 L8 аL8L8L8L8L8'xL89pL8K`L8 ]PL8 o@L8 8L80L8(L8 L8ɱL8۱L8L8L8K8#K85K8GK8fK8vK8K8K8K8K8ƲK8ֲK8K8K8K8K8&xK86pK8FhK8V`K8fPK8 vHK8@K88K80K8 K8 ƳK8 ֳK8J8 J8 J8J8&J8 6J8FJ8VJ8fJ8vJ8 J8J8J8pJ8 ƴ`J8 ִXJ8PJ8HJ8@J88J8&0J86=p{^M{R0|%bU8iPvU8`<:@2̵0n  V qU# 2G?Q f|w@w@0ЖѶZ޶;Kn' g< S" Pbpvl7@<  P JjǷ@9 ׷pz0Uc7,0N` Qo@>a u / HtҸ0P@X  w%@JS.qй/@{0 Q͹#@uR3@}] a`+ <9 ;R' ` oE|p(D'8  Ӻ0  @8 ^&R2  FYU0 Vipx"u@ L>ukл hp ) p!|6 tE0vQ`^`+k ~ `hyn!VyʼSټ )x} @?@*i:JP_0Kl}(VP |Ľ 'ܽ]8p>  ` J-0H =N`2_pn%} )Ks¾;Ҿe =    H$I10 C0VT deuAPnjX IҿR޿Pn+ @%p0 #<;RP gPvP(AP A1` v P  %#03P\IDLU*aЃ @r`, P/-Y00* 0 #` P6`&   l# n8 Sm ep uN+`^P  L @ HEr 1(?U<rH@RSb)7$j`^?,}  H0 3`_5`GmHIY jNk 0 `  @0f@  0P `v4AO am 3TpVRRRX^^\aenr@u@u|}pp `PPR R   <` ApP`P0p`PP `"P`P+`)BC<Ap'`P/@0ОP56@7@>? tEGH J J[0UU@WXZwx z}~p!#%&P(+48094@<D0FXJKS00VpXcjPnpruuycX{`}@@PPPP00ЖЖЖЖЖЖККККК``````````````00  @p0@`00 @@@@@@`g^g qq000`$@$$P%. /p  069;@<D E@Fclv lF`GGH0Hkklm@IGCC: (Ubuntu 11.4.0-1ubuntu1~22.04.2) 11.4.01][^)^fA0_O`^`;r`aaYcpdefgph2Pi@@kJ`k|mTpoIo!Pr@sIvpwQY 2 :@J 0U d@zЦyгY.Y 8Y BY (07`F ZLYz`Y PpjY 01tY A!>~YX'``9YO@!1dZ vZZZ Z Z Z Z 2Mp{fP{ `2F2%24`5R@66.8?S<A*S8mPZb|l@[t`:0Zi[ @`I W4 Ymo`r !#$%!P&3'H'X] _;muv"w0{ x:`py{d }:0 ` B  [#] d  _r   7   pt :@ .[ J | T D[   7 = - 2 7A A . t@XS : &l E 6  K  ;X `c    z p    Ѝ     J0 | T, @ >  S @ $c p } + P  M[   R   P;  r  V[0= 0& U [ X  r {  { tx [  m [  @    [   [   ;  \ P o 0   b [A P  [ \  IU JJpJ!PN+Qf:pQZStUPVXZ-\]G_O`cc g \ 5qVEV;f)\| ;p ` 0   &&p4'W=( Z4}j6  C5 `P [ i w%OP's@?1\ @1 N [aAoj x ;\ ;`;8pMm0P3pM`uXfoP  ! fp,  &1;6 aAXP\cqn0~@|D\ !@ !%#>p% KN\ ]/?oX\ @2O3:b\op`o 0!#3( 3@2/2p/G2_3 q28 220.2P*U2-@I20 H2`2 )1`C3PG11^1a6(wp3Pp3@@p3@p38o30o30@o30o30/n3`F`n3@] n30tm3``m3P5<`4`h]4??5Y4:`6(  30!3-6'1+PR102i 1*1`211$1`3X,2 6`(L4*m 46,f34p)5*%05 /P`;(@;6? 0(f38c9 I0.sUPo ^z\ i\ [\ ;;;Y; %Y;PR;`P;(O;"`J;0H;?G;N`G;(jF; F;HE;B;X;;;;@5;4;h`4;H3;x@/;-;*`;8;F ;T1e`10111101 1 1 ` 1P+@1?@1R1@k@0~0`000 0P`00!04 0M00f0@00`0`0p0P@00 0  00 008 `00X  00s 0( @0 00 00 00 @00 00!00!002!@0@C!0pT!00g! 0`x!0@!0@!`00! 0@!0@!0! 0!0p "0"0/"0B"0U" 0h"00|"0"00"@00"00"u0 "`i0 " i00#h00# f0+#e00?#e00S#`e00g#e0Py#`d0#b0# b0`#a0`#Z0@#@Z00# Y0#X00$X00,$T0 ?$R0R$`N0 e$N0Pv$M00$`M0P$ M0@$L00$0.$`0`$0P$0p%30 % 0` 0%@0C%00W%00l%00%@00%00%00%00%@00%00% 0P&` 00&& 00:& 00N& 00b&` 00v& 0@& 00& 00&@ 0P& 00& 00&` 0`' 00' 00-' 00A'` 00U' 00i'0@}'0@'`0@' 0@'0@'0@'`00' 00 (00(001(`00D(0W(`00j( 00~(`0( 00(/P(`/`(/(`/( /@)/`)`/P/)/`C)/0W)/0j)@/0})/0)/p) /`)/)@/0)/0)/0)`/`* /0*/04*/0O*`/0o* /0*/0*/0*`/0* /0*/0*/0 +`/0+ /02+/0F+/0a+`/0x+ /0+@/-+/0+/+/0+/+/0,`/0,, /@=,`/N, /0k,/0,k/@',@c/P,`./4,/&,`.p',.',.0-`.0!- .0:-.0S-.0l-`.0- .@-.-.- .-.0-.0-`.0 .. ..04.`.0P. .0s..0.@...0..P.`.0. .0..@. ./.&/@.0:/.pO/`.Pc/{.x/@u.@/q./@q./p.p/d.0 /J./J.P 0I.0@I.p10 G.E0F.pZ0E.k0 .00:.P 0 :.P09.0'.0 '.0`.0. 1.1.@01@.0]1.01.P1`.01 .01. 1`.01 .01.02.012`.0T2@ . f2.pw2.02@.02.02.02.2-2-3 -H"3-63@-@I3 - ]3@- q3-@3-`3 -h3-03-03-3`-04 -0'4- 84-0R4 -c4-t4-p4@-4@-84-04 -4j-4@i-04i-@5g-P5`g-015 g-0G5`d-W5b-ph5b-0y5@b-P5a-5@a-05a-05_-05_-05_-p6^-`6 ^-p+6]-@>6@]-O6\-b6*-1r6)-@6(-6-6@,7,@-7,S7,y7,7 ,-7,07,8 ,58l, ]8e,P8_,8`^,p8 ^,083,p*8@3,P83,0 92,09o(029o(0E9`o(0h9 o(0}9n(09n(09`n(09 n(09m(09m(0:`m(0: m(0.:l(0E:l(0Z:`l(0q: l(0:k(0:k(0:i(:R(P:R(;9(;8(04;8(0G;@8(0^;8(0w;7(0;7(0;@7(0;7(0;6(0;6(0 <@6(0)<6(0B<5(0V<5(0m<@5(0<5(0<4(0<4(0<@4(0<4(0<3(0=3(0+=@3(0A=3(0U=2(0l=2(0=@2(0=2(0=1(0=1(0=@1(0>1(0>0(0*>0(0A>@0(0S>0(0q>/(0>/(0>@/(0>/(0>.(0>.(0?@.(0$?.(0=?-(0]?-(0q?@-(0?-(0?,(0?,(0?@,(0?,(0?+(0@+(0@@+(0.@+(0C@*(0Z@*(0p@@*(0@*(0@)(0@)(0@@)(0@)(0A((0A((07A@((0UA((0hA'(0{A'(0A@'(0A'(0A&(0A&(0A@&(0B&(0B%(0/B%(0GB@%(0YB%(0mB$(0B$(0B@$(0B$(0B#(0B#(0C@#(0!C#(09C"(0QC"(0fC@"(0zC"(0C!(0C!(0C@!(0C( C`(0D(`0D(PGD(fD({D(`D@'0 D@' D'D'@ E@'02E'OE`'`tE'E`'0E '0E'0E'0E`'0 F '0!F'09F'0RF`'@mF`'F '0F 'F' F' G'+G@'0QG'0}G'@G' G'G'pH'`6H'[H'0H '`H'pH'H`'0I '0/I@'GI'0`I'0I@'pI'I@'0I'`I'PJ`'1J'JJ'dJ'p|J`' J@'J'0J'0J'0K@'0K'02K'0JK'0`K@'0zK'0K'0K'0K@'0K'0K'0K'0L@'0$L'09L'0NL'0cL@'0xL'0L'0L'0L@'0L'0L'0L'0M@'0(M'0:M'0QM'0bM@'0wM'0M'0M'0M@+H)M`+)M+h*Mx+X*NM+*(N@!+8,;N`*,NN*,gN *H.zN ,N*Nq*NZ*(N`A*8N`(*N*O)(O):O@)RO )jO|) |OY)h"O7)h"O)h"O@(8&O ('O((O p(H. P@'0 P'@1P'0BP'0WP@'0lP'P}P'0P`'0P '@P'P`'0P'Q '"Q'@7Q'0[Q 'oQ'PQ'0Q '`Q'0Q'`Q@'0Q' R@'@#R`'7R '0VR'`|R`'PR '0R'0R'0R`'0R'pS'0S`'06S '0LS'@gS`'p{S '0S'0S'0S`'0S '0T'0#T'0@T`'0^T '0{T'0T'0T`'0T '0T'0U'0/U`'0PU '0rU~'0U~'0U`~'0U ~'0U}'0V}'02V`}'0PV }'0nV|'0V|'0V`|'0V |'0V{'0W{'0(W`{'0FW {'0dWz'0Wz'0W`z'0W z'0Wy'0Xy'0#X@y'P8Xy'0LXv'0kX`v'`X v'0Xu'0Xu'0X u'pXt'0X t'Xs'0Ys'0/Y@s'`CYs'0YY`r'nY r'0Yq'0Yq'0Y`q'0Y q'0Yp'pY`p'0Zp'P-Zo'0BZo'0ZZ@o'0wZn'Zn'Zm'0Zm'0Z@m'0Zm'0[l'0[l'0,[@l'0>[k'pP[f'b[`f'pt[ b'@[K'[@2'[2'0[1'0[@0'[0'0[/'0\/'0'\@/'0:\/'0M\.'0e\`.'Pv\.'`\+'`\+'\*'0\`*'`\*'`\)'P] ('p]''0%]`''p6]&p*D]`&pU]&e]@&0x]&0]&0]&0]@&0]&0]&0^&0^@&01^&0B^ &U^&ph^&0{^@&p^&0^&@^&^&^&@^`&0_`&_&p&_&9_`&L_ &0__`&r_&_w&_^&_]&_]&0_R& _ R&`_Q& `@Q&0`Q&00`O&@C`@K&V``E&i`C&|`A&`@&`>&@``>&0` >&0`=&0`=&0a=&a<&@'a@&x+:a&0Ma&0aa`&Pra &0a&a@&`a&a@&0a&0a &pb@ &0"b`&1b@% !@b%Pb q3)lb`%0b %@b%`b %`b%0b%0b@%Pb%Pc%Pc%"c`%0;c %0Uc%0oc% ~c %c%pc`%0c %0c%@c%Pc@%@c%P d%0$d`%0Ad %0^d%0zd%0d`%0d%d%pd%Pd`%0d %0e%*e@%0Ce%PSe%Pde%ue%0e%0e@%0e%0e%pe`% e %0e`%f %0!f%X0f%@Af@%@Rf%0gf`%|f q%@fa% fN%f`4%f3%f3%f`.%g .%@g,%`%g"%@ 8g@"%0Pg%bg%p tg %g%Pg@%pg@%g%pg%@g@%0h%P(h%0Ch`%`o( o(n(n(`n( n(m(m(`m( m(l(l(`l( l(k(k(i(R(R(9(8(8(@8(8(7(7(@7(7(6(6(@6(6(5(5(@5(5(4(4(@4(4(3(3(@3(3(2(2(@2(2(1(1(@1(1(0(0(@0(0(/(/(@/(/(.(.(@.(.(-(-(@-(-(,(,(@,(,(+(+(@+(+(*(*(@*(*()()(@)()(((((@(((('('(@'('(&(&(@&(&(%(%(@%(%($($(@$($(#(#(@#(#("("(@"("(!(!(@!((`((((((@'@'''@''`''`' '''`' '''`'`' ' ''''@''''''''' '''`' '@'''@''@'''`''''`'@''''@''''@''''@''''@''''@''''@''''@''''@''''@+`++x+M+@!+`** * ,*q*Z*`A*`(**))@) )|)Y)7))@( (( p(@''''@'''`' ''`'' ''' ''' '''@''@'`' ''`' '''`'''`' ''`' '''`' '''`' '''`' '''`' '~'~'`~' ~'}'}'`}' }'|'|'`|' |'{'{'`{' {'z'z'`z' z'y'y'@y'y'v'`v' v'u'u' u't' t's's'@s's'`r' r'q'q'`q' q'p'`p'p'o'o'@o'n'n'm'm'@m'm'l'l'@l'k'f'`f' b'K'@2'2'1'@0'0'/'/'@/'/'.'`.'.'+'+'*'`*'*')' ('''`''&`&&@&&&&@&&&&@&& &&&@&&&&&&`&`&&&`& &`&&w&^&]&]&R& R&Q&@Q&Q&O&@K&`E&C&A&@&>&`>& >&=&=&=&<&@&&&`& &&@&&@&& &@ &`&@%% q3`% %%% %%%@%%%%`% %%% %%`% %%%@%%%`% %%%`%%%%`% %%@%%%%%%@%%%`% %`% %%%@%%`% q%a%N%`4%3%3%`.% .%,%"%@"%%% %%@%@%%%@%%%`% %$ $$$$@$$`$$$$@$$`$$ %%`% %%% %%% %` % % %` % % %@ % % $$@$$`$ $$$`$ $$$`$ $$$`$$@$ $$`$$$`$ $$$`$ $$$`$ $$`$ $`$ $$$`$`$$@$$$@$$$$@$$$$@$$$ $$$ $$$$$`$$$$$$$@$$ $`$$$ $$$$`$@$`$$$ $$$$@$$$@$$$"%$$@$$$@$~$}$@}$}$|$ p$o$n$m$@m$l$@k$`f$e$ e$d$`d$ d$c$c$@c$c$ b$a$U$p3p3@p3p3o3o3@o3o3n3`n3 n3m3`m3`U$@P$P$ N$ M$L$L$@L$K$`K$ K$@<$;$;$`;$;$8$#$"$@####`##@##i#g# g#f#c#b#`b#`a#a#`#`#@`#`#_#@_#_#^#]#@]#]#\#@\#Y#Y#X#@X#W# W#V#U#`S#`R# R#Q#O#N#@N#M#M#L#@L#L#K#J#I#I#F#`F#F#`E# E#D#D#`D# D#C#C#C#B#@B#A#`A#A#@#@#@@#@?#?#>#>#@>#=#;#;#`;# ;#:#:#`:#`9# 9#8#8#@8#7#7#`7# 6#5#4#`4# 4#3#3#3#2#2#@2#`1#1#0#%### ##"#"#"#!#`!#@ # ###`# #@ # # # #@ # #`# ##@####@####@###`# ###@##"`" ""@""""`" """`""`""`""@""l3"""`"@""""@""C3""@"`C3"""""@""""P""@"@" ""@"""@"@"""@_"_",""" 3222 222U2@I2H2`211`"" "!!`!!!@!!! !!@!1 111R1'1$1!!#1"1@ 1@!x?Y Z @666666666p6@6 666666p6`6X6P6@606(666666666666p6P6@6 666666@666p6`6X6P6H686(66666666666`6P6@606 6666666666p6@6666`6 6666666`6 666x6p6`6X6P6H68606 6667V7b7]7x?o7x?v7|7x? x?( 7x?x?uq 7777777777777p7`7X7P7H7@78707(7 777777777777777777777p7h7`7X7P7@707(7777777777777777x7p7h7`7X7P7`7X7P7@707(7 7777777777777777x7h7`7P7@78707 7777777777777777P8H8@88808(8 888888888888888888x8p8h8`838L8L8L8L8L8L8L8L8L8L8L8xL8pL8`L8PL8@L88L80L8(L8 L8L8L8L8L8K8K8K8K8K8K8K8K8K8K8K8K8K8K8K8K8xK8pK8hK8`K8PK8HK8@K88K80K8 K8K8K8J8J8J8J8J8J8J8J8J8J8J8J8J8pJ8`J8XJ8PJ8HJ8@J88J80J8U0V?VOVaVuV V V'VVV'V'VP&VP&V%W$#W#>W!LW!ZW!hW wW W'W'W'W'W'W'W'W'W'W' X'X-X9XJXYX`hX|XXXXXXVUXXXXP\YY Y6Y?@zPRR H  ̊؊ # 1 @?Qe p  @ɋ  *= K@Z fvıȱ̱бԱرܱ;;;Y;Y;R;`P;O;`J;H;G;`G;F; F;E;B;;;;;@5;4;`4;3;@/;-;`;; ;ݸc g   !*.2=X@GN[h  &kz#Ccù͹׹޹. 1(n7!4 ձFS_beomy| &wѺԺɺ׺ݺ,16=DMV[`ejrzʻӻٻ߻ !&+4=BGNUZ_gotyҼ׼ܼ ',16;DMXchmt{ *½˽Խٽ޽$/49?EJOTYbkpu¾ʾҾ׾ܾ  %*5@EJOTY^elqv~¿пݿ$+27<L[`emuz 4I`v{*06;@EJQXblv  )16;@ELSX]dkt} $0<AFS_diw] !&+05:?GOW_dis} 3HMRX^goty 0;EPZbinsy $).38AINSX]bgr}$).9DINV^fnsx}    %/49AINS`lqv} $)07>EJOTY`glqv{ */49>GP=X\`ejot} !&+05:?.ٱDJPSVKc g =X@Gh  #Cc q\b1(n7hpx {puY myYC !&*.26:>B; RC WW \H7LQVZT8[E@am&y7 3:GU. !F   # `dhlptx| &.7@JUao!_X6W_/#1(n7Gv]I#v5SGv]I#v BH   " %(+.:ER^isPS"2A^yc g 2=Xtw'3?KNQTWZ]Cc`js ЇԼ1(n7!$.!4 ձ@8;b>#7HS8P=KNQ] T[bo}w{my|Č7Tj7V & \Y%1=ITamyr Ҵ@EP $(.48<N]vn7EU(5>]l &2@M\jx '8HXgw-@Rbq%5DUew)8FVev\huO_  #/9BMW[_kvIS #)?Sev &7GXh~,E\q 67'8HZk}T[;HWmbO$/װ3BOg{v@G'./#5GXcnx +3;FVQ^mjv\Y@c g !*.2=X@G&kzVCcm!4 ձ  2\Y@my|Č7$1=@CFIOUX[q.  &:VMy޸P^kzqw57 Gv]/ 67>KWdpC#1 Az #2 _-<2>#7wIZju> $ ;6G  #);V iu %*.2;DINV^bfoxTQa|/#\r  =X b _Y; ZT8E@am&y7 3:GU.%29FMT`  !%)-1 $o}5@ P" JOTX\afus D^c")/6=CJQX^djpv|#)07>DJPV\bhntze?  '6KDQ]`VbOcft  &T[Č7VKG/#r[m׺ݺ'4Rp(I HI $4D6=S`kx'7ChI I I NZdpz'1CUDM6 A fljrr|ʻӻٻ +4);M^jvGN_gy1C ',;DVcoMXGS,=UmI J 0J 3=EOWais{ %;GS^juXJ J J J J K 8K `K K K K K L @L hL L L L L M HM hM M M M N (N %AHN pN N N N O 8O `O O [p$/@Q av* O O P +<L^p½˽&8L`r':Q޽gv ,9JZsT { $9?Yb P HP pP 4uIdP P |¾ʾP Q (Q *>KHQ hQ WsQ Q ܾ$6G[o#7J[l| ->KWk*5^ev~  ! + 4 C R ` ¿пݿn { z $+  + C O [ f }         <Lem, H d }       Q Q R   @R hR R   $ 8 J 4` I`w     J e         # . 7 G W e u               + 7 T q   *0   JQXb lv      ) 5 ? K U a k w          / @ Q ` q           $ 0 : F P \ f y          ( ; 16L U ] m } EL]dkt   R R S  1 H   ^ m | $0 FS iw  1 = (S PS xS S S S H ^ t T @T hT T T   ' 8 I Y f r     ?GOW( 6 B P \ j v  is ' * 6 : C  K 3b f RXj ^gs y        0; EP Zb  - syI ] q       8A     gr! . @ ] y T U : W h w              .9NV^f0 J d |         " / D Y  l  y     %     9A- : E R ] j u         1 E [ q    U HU pU    U U U V 8V  `V V , I S [ e m }       S` $ V V W > [ x W  HW pW W v}            * 6 L b  u     )07>       ( Y` 9 K [ u         >GW W X 8X hX X X Y 8Y X\   hY Y  ; E N _ p    t}           + 7 B O \ h  y         s D   / ? P ` .k^v(c s         V   0 E [ n        /  Vű         ( &> L X p           Az    + :  . _Gv]\Y4 w I#v9 p u z = A  E   I  M Q U Y ] a e j o t y ~    ju                           " ' + 0 5 : ? D I N S W [ _ c g k o s w {       1`111111 1 1` 1@1@11@00000 0`000 00000`000@0 000`0 00@0000@0000@00033 000`0 000 000000 0000@00u0`i0 i0h0 f0e0e0`e0e0`d0b0 b0a0Z0@Z0 Y0X0X0T0R0`N0N0M0`M0 M0L00`00033 0@0000@0000@00 0` 0 0 0 0` 0 0 0 0@ 0 0 0` 0 0 0 0` 0 000`0 000`0 000`00`0 0`0 0/`//`/ //`////@/// //@///`/ ///`/ ///`/ ///`/ ///`/ /@///////`/ /`/ //k/@c/`.//`...`. ...`. ... ...`...`. ..@...`. .. ..@..`.{.@u.q.@q.p.d.J.J.I.@I. G.F.E. .:. :.9.'. '.`....@...`. ..`. ...`.@ ...@....-- --@- -@--- ----`- --- ---@-@-- -j-@i-i-g-`g- g-`d-b-b-@b-a-@a-a-_-_-_-^- ^-]-@]-\-*-)-(--@,,,,, ,,, ,l,e,_,`^, ^,3,@3,3,2,o(o(BH f (A BBBC V (A BBBC `|GBBB B(A0A8D@ 8A0A(B BBBJ W 8A0A(B BBBO ` hEBBB E(D0A8D@ 8A0A(B BBBH  8F0A(B BBBD LpTBEA D(D0h (A ABBB  (A ABBA (LBDG y GBI 4ȠBBA A(G0}(F ABBH$0BEB B(A0A8G 8A0A(B BBBG (pJEDD  AAI <QHD J0V AABGH0(\LtykBB B(A0A8D`28A0A(B BBBEd@FBB B(A0A8DP 8A0A(B BBBG  8A0A(B BBBH $,+FDG IJB 4ED ^ AH ,xFDH M ABA $(<9EDD  AAE h\|fFBB B(G0A8DNVA 8D0A(B BBBK DD,FBD A(D` (E ABBF zhBp]hA`H8,{FBB B(A0A8Dp 8D0A(B BBBG `opIG E `й$FBE B(D0C8DPo 8A0A(B BBBE i 8A0A(B BBBE 4BBK E(H0(A ABBH@4FBB B(A0A8Dp 8A0A(B BBBF  p(xHFIG fDB(EIG@ AAE H@9FEE B(A0A8DP 8D0A(B BBBK 4P4EAG j AAG  AAH _EAD`EH|HtFBB B(K0A8I`d 8C0A(B BBBG EN$$+FDG IJBHLKBBB B(A0A8DP 8A0A(B BBBF HXFBB E(D0D8D` 8A0A(B BBBE $xAFG gAAL HFDB B(A0A8D 8D0A(B BBBC P\9FBB A(A0DP 0A(A BBBI )XG`WXAP Hj F Z A HAFEB B(A0A8DP 8A0A(B BBBC 4 EDD _ GAD a DAB \X|yBEB B(A0D8Ij 8D0A(B BBBH _ATBLDBBB B(A0A8G S 8D0A(B BBBG H*BBB E(A0E8FP 8D0A(B BBBG tTBEA E(D0i (D ABBE D (A ABBF m (D ABBB  (A ABBA LBBB B(A0D8M6 8A0A(B BBBF 0BGD  DBH JDB|P4sBBE E(D0A8D 8D0A(B BBBJ  8A0A(B BBBK  8A0A(B BBBO L4 BBB B(D0A8G4 8D0A(B BBBK X BBB B(A0D8GGRAk 8D0A(B BBBD X|8%FLE E(A0D8FP~XM`MhEpIPa 8D0A(B BBBE l&jFBB F(D0D8GGREf0 8D0A(B BBBC HVAGWAX`T-hBBD A(D0 (D ABBE U8N@IHAPI0D (D DBBB (h.BAD@ DBH /Bn H Tp0OBE D(A0b (C BBBJ J (D BBBD <\1BEA D0S8G@Q8A0  DBBJ |2BEB B(A0A8Gp 8A0F(B BBBC  8A0A(B BBBF { 8C0A(B BBBA d7MBBB E(A0A8G 8A0A(B BBBE x 8A0A(B BBBN \G FBB B(A0A8G 8D0A(B BBBA E^BHU=BBB B(A0A8D` 8A0A(B BBBI d0[mBBB B(D0A8Gy 8D0A(B BBBF   8A0A(B BBBF H w!BEB B(A0A8Fp 8A0A(B BBBF L~BBB B(D0D8GM 8A0A(B BBBB H4BBE B(A0H8D 8D0A(B BBBH H$ BBB E(A0D8D` 8A0A(B BBBD '%BBB B(A0A8JZHDGIH 8A0A(B BBBD > dcABLABKBNWB>HRBxHVCHFEB E(A0A8D 8D0A(B BBBD FEB B(A0A8Dw 8D0A(B BBBG KMIIHHILoKMII<tZBBB A(A0# (D BBBA L LBBD A(F0 (A ABBB L (A ABBF  4HBBB K(A0D8DvGBBN_ 8A0A(B BBBF b'TUHIAIAKGBBNRNMAGBB]; BIB B(A0A8GKEBBEN^ 8A0A(B BBBA tEABSJJBIl 8A0A(B BBBE | HDBE LKEBBBIBBBI@# 1BIB E(A0H8K` 8A0A(B BBBF  8D0A(B BBBE  8A0A(B BBBE t 8D0A(B BBBG c 8E0A(B BBBE  8D0A(B BBBE  8A0A(B BBBE ~ 8D0A(B BBBE A hJpIxBI`n 8A0A(B BBBE  8A0A(B BBBE Sw"FBB B(A0A8D 8D0A(B BBBK S 8I0A(B BBBK  8A0A(B BBBE Pu7AAD ` DAE L DAG K AAK F DAA `wBFD A(G0v (F ABBK M (F ABBH  (A ABBI @$yT y!hMAH b ABA x>G E H|?FBB B(A0A8D@ 8A0A(B BBBD H@FBB B(A0A8DP 8A0A(B BBBE HPBFBB B(A0A8DP  8A0A(B BBBK HCFBB B(A0A8DP9 8A0A(B BBBK (EOEPD0  DAH ]P]pohE8KpM@OP:c}cpyc{pms} @Âςڂ'@: HVcu @ă˃փ @  @!( 2@=FQ[fl t@{ ń@τ؄! +@7FKQ[dk q@w} @lrx#%*.:<ʅ@ՅBcDdEef"g(H8hAINiUk`LilsN}noPpqrƆS̆sӆtކUuVvwXx"Y,y7ZBzJ\V]_^l~xQvҡӇ ؇@݇ @*2 DsWc7KNUZ_dU{k QvWc7KpUZ_dxk}üѼݼx? $3=HMVdnwɽ׽ !1?KWav3v?vJvQv|nv{ľо׾߾ ɾ!) (06>=DKRZbk|wſѿ޿F ԇ!&,28=CJQX`hpx!+5DKWi$6BS\js-;NYir   ` p   P d ` p 0      p P @ г P 0  ` 0  P =QU#*@0n5DC%IR\jz)>Si(=Qgg4,Gc[~v^)8GVfv&0:Dd|\t 8[gbzxyxlqv{qDW#HnUT["67mciqy| )4IO7^&$$iW  &6Mj (<6K_k%v~'0! [mKym '-75;@HQdi\mmt|wmm"%(+.14D 7:=@nCFI~LORUX[r ^ nd&nn-nk~rz"> '-3:AIRYEn`gmt&{*;GUcny > )ASmeeex *2AUgy5_=_E_M_R_X_m?DC%IR0Y &,I65c\8{#=FOYc>kq{މ" V',#1-67;A@GELPTX\bktajs{2[gbzxyxlqv{qDW#nUT["67mciqy|  %I075<ENXblu~-"  !'-27A'0!TKXer[mK '-75;@Hdmmt|wmm',3;CKT]dkqw~^ nd&nn-nk~rz"> '-3:AIRYEn`gmt&# $,5@JS\env > m"*3=HPUZgt%_-_5_=_E_M_R_X_&s|!Qv *1$s7;S@EJNRW\afkpw| $*06<BHNTZ`flrx~G=$qWVVWXWWWWWWWW #&*.36:>CFJNUWGWSVZafkpu{~p `[ 0 pE ~p 8A0A(B BBBH HZyEFBB B(A0A8DP 8A0A(B BBBF HZzKFBB B(A0A8DP 8A0A(B BBBD H0[|FBB B(A0A8Dp 8A0A(B BBBK H|[8FBB B(A0A8D`I 8A0A(B BBBK <[FBI A(A0 (D BBEG P\FBB B(A0A8G I  8A0A(B BBBH `\\FBB B(A0A8D@ 8A0A(B BBBG ^ 8A0A(B BBBH L\DFBB B(A0A8D 8A0A(B BBBD H]FBB B(A0A8DP 8A0A(B BBBH H\]HFBB B(A0A8D`f 8A0A(B BBBF `]FGB B(A0A8D` 8A0A(B BBBJ p 8A0A(B BBBF T ^8FMA B DBL W ABF l DBF  ABM Dd^p^FFA  ABN K ABB  ABM P^,FAA S ABR P ABE E DBE H ABM 0_ddFAA D@g  AABI d4_S FBB B(A0A8G 8A0A(B BBBG  8A0A(B BBBH _W H_x4FBB B(A0A8D@ 8A0A(B BBBH 8`lFBA A(D0 (A ABBD <D` FBB A(H0 (D BBBD H`гJFBB B(A0A8D@ 8A0A(B BBBF H`Դ}FBB B(A0A8DP 8A0A(B BBBE Da/FBB A(A0G I  0A(A BBBC Hda:FBB H(A0A8DP8 8A0A(B BBBF HaFBB B(A0A8DP 8A0A(B BBBK HaeFBB B(A0A8D@ 8A0A(B BBBF dHbSFBB B(A0A8D@6 8A0A(B BBBF V 8A0A(B BBBH Lb0FII A(A0 (D BBBF X (D BBBF <c FBB H(A0 (D BBEH ,@cTFHA T DBG 8pcFBA A(D0u (A ABBG Lc.FBB B(A0A8G 8A0A(B BBBF @chFBB A(A0D@W 0A(A BBBA H@dFBB B(A0A8D` 8A0A(B BBBK LdcFBB B(A0A8Gr 8A0A(B BBBG Hd%FBB B(A0A8D@ 8A0A(B BBBK ,(eFAH q AEJ 8XeLFDA A(D0 (A ABBD He FEB B(A0A8D@ 8A0A(B BBBG HeFBB B(A0A8D@ 8A0A(B BBBB H,fXFBB B(A0A8DP 8A0A(B BBBH ,xfFCH } AED @f,FBB A(A0Dp 0A(A BBBF XfFBI A(A0D~EEUb 0A(A BBBG LHgLFBA A(D0 (A ABBB { (A ABBG @gFBB A(A0DP* 0A(A BBBF 8g2FBA A(D0 (A ABBE LhFBA A(D0 (A ABBF a (A ABBI Lhh-FBA A(D0 (A ABBF I (A ABBA HhlvFBB B(A0A8DP 8A0A(B BBBJ `iFBB B(A0A8D@ 8A0A(B BBBF x 8A0A(B BBBF `hiFBB B(A0A8D@ 8A0A(B BBBI x 8A0A(B BBBF `iFBB B(A0A8D@  8A0A(B BBBI x 8A0A(B BBBF ,0j$FAA m DBE (`jEAD | AAH `jFBB B(A0A8DP 8A0A(B BBBD x 8A0A(B BBBF `j&FBB B(A0A8D@ 8A0A(B BBBB x 8A0A(B BBBF 8TkFAH Z DBA ^ AED hkDFBB B(A0A8G?DfAz 8A0A(B BBBE D L kxlt$lp8ll>H0p A TlM4hlmFAD | ABF GGJllAAMlA A lumPfXmBBA D(F0m 8A@S S8I@L8A0R (A ABBG ] 8C@P HtmBBJ M(F0C8N@ 8D0A(B BBBE m!D\HmfBBB E(D0A8DP{ 8A0A(B BBBG 4$nADG Z KAN D AAJ \n,\ILtnBBE E(D0D8G@qHHP[8D0A(B BBBLnIBE A(N0 (A BBBD l (A BBBA o&(o,;(<(FBB E(D0 (E BBBJ hVFEB B(D0D8DP 8A0A(B BBBG  8A0A(B BBBG  8A0A(B BBBM O 8A0A(B BBBG h 8D0A(B BBBK H|FBB B(D0D8DP 8A0A(B BBBB Dd@FBB E(A0A8D@8A0A(B BBB(XFDD uAS؍FBB B(A0D8DPl 8A0A(B BBBE 7 8A0A(B BBBG J 8A0A(B BBBD M 8A0A(B BBBI  8A0A(B BBBO h "UFEE E(A0A8D@ 8A0A(B BBBJ _HIPOHA@l8I0K(B BBB#(V $#E](,$H<$BBE B(A0A8F` 8D0A(B BBBH H|)CBBB B(A0D8G@C 8J0A(B BBBF ԏ*|BEB B(A0D8GPp 8A0A(B BBBG  8A0A(B BBBB j 8F0A(B BBBG  8F0A(B BBBE lh-H0.FBB E(D0A8G@ 8A0A(B BBBD $А/sEMP NAAH<0FBB B(A0D8Dp# 8C0A(B BBBD DMaFEE B(A0A8GKRBHH` 8A0A(B BBBC NKOAoKBBHHl) ADBHHXKBBHH[AOIMAZHA_AAQBHSA BSAKABHHSHBBHHV ȒD$HtL?FBE B(A0A8G( 8A0A(B BBBA P# PpFEB B(A0A8GM 8A0A(B BBBA ēCؓCCD>pd8(BBH D(A0n (A BBBJ XdBBH D(A0I@c 0A(A BBBK Q 0A(A BBBG $J D S E $J A S E (ADG AAH<[BDE E(G0A8N` 8A0A(B BBBA rNttTIp̕8AA N P H R F P P P H P H P P G I P P P P P P Q G P H P H F A L@VBMB B(A0A8J 8D0A(B BBBH @QBDD G0  AABG   AABK Ԗ`TPT(dUEDD { AAA L,VBEB A(A0D@T 0A(A BBBE GHHPSHA@$|8XOD j B (H0V(A P`Y BBB A(A0D@ 0A(A BBBA  HHPVHA@X[fBBB B(A0A8D` 8A0A(B BBBA NhNpUhA`HT0]}BDB I(D0D8D 8A0A(B BBBI XdcBEB B(A0C8Dp 8D0A(B BBBK xHVxAp8gAAD0m AAK X8H@S8A0H8liBKI B(A0A8G` 8A0A(B BBBI P kBEE A(A0D@HHPVHA@[ 0A(A BBBA HؙmBIE B(H0D8D 8A0A(B BBBA |$ pBFB E(A0A8DP 8A0A(B BBBD h 8D0A(B BBBK GXH`VXAPQXG`WXAP\tBEE E(A0A8J 8A0A(B BBBA yHOAz!BHE E(D0D8Gr 8D0A(B BBBA GWAQHVBPHVAQGWAQHWBoHWAHVAHWB|؛FBB B(A0A8DP 8J0G(B BBBI j 8A0A(B BBBA XG`TXAPLXH`VXAPLXllFBB B(A0A8G 8D0A(B BBBC ,ɣBBB B(A0A8G 8D0A(B BBBA  BYBBSAFBXB IHBQ\ABV)BTBNfD H[BG\AIgDFEZABYB` HOBkKNBeBSABgBHNAHNBHOABXABVAYBXAxBYBWEMBBYBUXAHSA؞R  FfBBB B(A0D8GVEBIx 8D0A(B BBBA 9PdBKSAKNAbESB.IOAKOBHZAKNAKOBKNBKOBKNBGKOAKNAYKOA5HNCHVAIHKBKSAXHKAHLBHWBOHWBHWBwHTBLFBE E(A0A8Gv 8D0A(B BBBA `FEE B(D0A8G 8A0A(B BBBF iHgB  KY H`A$HbB"HNB I0co F F B BI OAJS0D`yEDF @ DAL TCA4xFAA  ABJ QCBD4f<ĢpiAD FDBV PP HFBB B(A0A8FP 8A0A(B BBBC pPTFGA D(D0G (D ABBJ  (A ABBJ  (D ABBE I(G CGDTģFBB B(A0A8F`jhIpIhA` 8D0A(B BBBD $R`^] C D E DP XLRdlX,FBB A(D0W (D BBBH  (A EBBE  (D BBBE Ԥ WEp K V`AAM4dBBD0M EBD g EBB HLW E Hh\FBE E(A0A8K@e 8D0A(B BBBG  HȥFLB B(A0A8D@ 8A0A(E BBBF 8PFBA A(D0u (A ABBG 4PnFBA A(D0Y(A ABB,FFH S ABF L4̦XFQD A(D0b(D ABB,nFHH B ABE 4O0H, FAD D0  AABC |!ET(4ԧ@W|FBB B(A0C8G@ 8A0A(B BBBE U 8A0A(B BBBI / 8D0A(B BBBL 4hFAG0U ABJ nAB4tFAG0I ABF VABب#EVOLO0OD0OXll(DwEDD U AAD ԩw(4$@G8|LxwYdW@xL.FBB A(D0G@ 0A(A BBBE 8WЪOO8FAA  ABL H DBR T4&FBE A(D0G@ 0A(A BBBG f0D(A BBB\FEB E(A0D8GP 8A0A(B BBBH ~8D0A(B BBB(8EAG0~ AAC _8,FEA A(N0Y (D ABBC XhFBB B(A0A8Dp 8A0A(B BBBG  xESxApĬ05ج\(XFGD0 AMM ,EL|40kFBB B(A0A8DP 8C0A(B BBBF  8F0A(B BBBD d 8C0A(B BBBH  ȭYܭAAMWAAK0@BDD G0  AABG (HABIE D(G0tKHl8̮h!FBA A(D0 (A ABBB H\FBB B(D0C8G@ 8D0A(B BBBG (TvEAG G AAJ Tf(AAG P AAE tD/IBB A(C0c (D BBBB g (A BBBB  (A BBBB V (A BBBC $8AEDG nAA`$H C iE G z F 0"4"FAD ~ ABD ` DBJ #WVWcF4D#vFDG s ABI  ABA H$|FI A X A l$4$rFAG0> FBL a ABD <'Ma B ر'FJ H @(FEB D(A0D` 0D(A BBBG $<-*FDG IIBd-gLP D H-2BBB B(A0A8GP 8A0A(B BBBE Xв2 FBB B(A0A8D`[ 8A0A(B BBBI hEpJhA`(,<Fz H U C T L X=-Hl=FBA A(D0 (D ABBA S(C ABB$,>Uu F tMH>bFBB B(A0A8DPV 8A0A(B BBBF `,CLEB B(A0A8D@ 8C0A(B BBBK hH@D D`DFFBD A(G@r (A ABBD  (A ABBE H (C ABBH F|N4`Go| r LGM R I FJ (p4HyE{ H K E A G XH9XXHG^W K FԵHTFM$IQHpI FLB B(D0A8D@ 8A0A(B BBBA @P4JFHH U0k  ABBE O  DBBE (JQJDD kDA($KOAD A AAI LHV LCNc G CE(LFBB B(A0A8D` 8A0A(B BBBD  8D0A(B BBBH  8G0A(B BBBH ! 8I0F(D BBBN  8D0A(B BBBK b 8G0A(B BBBN  8D0A(B BBBK \$\8\1L\)ET G D,l\FAD  ABI ]FT F ,^FAA d ABA @8_FAA D0  DABB   FABO 0`ZFA I P`da_BBB B(A0A8D` 8D0A(B BBBD  8A0A(B BBBJ q 8A0A(B BBBE   8A0A(B BBBL WhIpOhA`%hKpOhA`hJpQhB`( `(HtFAG0k ABD HtvB FBB G(D0D8D 8D0A(B BBBE fH I G ܺ(H s E @FBE D(A0GP\ 0A(A BBBC <H PDH } K K E |tFIB B(A0A8D`C 8A0A(B BBBJ  8A0A(B BBBB T 8A0A(B BBBB ,dFAD  DBA L$PBBA A(G0O (A ABBF s (E ABBK t FBB B(A0A8DPy 8A0A(B BBBK D 8G0A(B BBBL  8A0A(B BBBF Z 8I0A(B BBBL \ 8D0A(B BBBE T$0KEDD g AAJ ~ AAH k OAM \ DAO DAAH|(FBB B(A0A8G 8A0A(B BBBA $Ƚ5FDG YDB\ĒpOBA A(G0 (A ABBE pH0d (A ABBF (PԓEDG  AAG |!EO D D )IO H D8оĔFBA A(G0 (D ABBE H FEE E(A0D8FP 8D0A(B BBBE XYH ^ R xtFBB B(A0C8D@ 8A0A(B BBBI  8A0A(B BBBC M 8A0A(B BBBI DKBA GBBGH M HKE <8lMBE A(D0 (D BBBK `xLrBBB B(D0A8DPm 8I0D(G BBBH  8D0A(B BBBF hDpt H 8 FEA D(D0 (D ABBH 84FEA D(D0z (D ABBI pDH J F ȞEG I AJ DM IR 4؟FAG V AEF S DBG 4psFEA C(L0N(D ABB(<FAL S DBD 8h, FBD D(D0Q (A ABBE (FDD N DBF (t~BDD0d ABG 8ȣFBA D(DPo (D ABBG 8,<d S8PT]FHG D(D@ (A ABBE dx.BBB B(A0A8G@U 8A0A(B BBBH  8A0A(B BBBA d@KEE E(D0D8GPx 8A0A(B BBBE @HPd\FBB E(A0D8GpZ 8D0A(B BBBF ^x^KxAp]xKSxAp(`vEDD0L AAE HqFBB B(D0D8D` 8D0A(B BBBE 8<FBA A(GPF (A ABBC Hx<FBB B(A0A8DPP 8D0A(B BBBA !JSC4FDD m DBG |AE8FED C(GP (D ABBE 0TPQFBD GP  ABBG |LxFBE D(D0 (A BBBG  (D BBBE 8FBD D(G0s (D ABBE 8(}FED  BBD n BBN @dFAA D0  AABI   FABO (EDG0b AAD 8FED c BBJ Q BBK !EO D DL04FBB D(D0 (A BBBH y (D BBBE DFDD I ABF Y ABD X ABE L!EO D Dd\BBB B(D0D8G@ 8A0A(B BBBI ( 8A0A(B BBBN LPFBD A(G0 (D ABBH V (D ABBA ,$FAD  ABC 8FEA D(D0 (D ABBJ ( .FED ZBB88PBBA D(D@ (D ABBF 0tFAD F0g  AABD (HFBB B(A0A8DP 8D0A(B BBBD 0<FAD F0g  AABD (<AG Q AF d CI @hLPFAD F0@  AABK   DABG 8XZFAD l ABF  GKE |!EO D D0DFDG _ ABE DAB<!EO D D$\,FDG TDB(OFDD \ DBH $,FDG TDB4pFAG0n ABA  IIE $!EO D D040FG ]EDPDFAD ABE ( NBH  DBE <d SLOAG0y ABE ABHH0P ABM 4<d S\)BDD 88ljFBD D(F@w (A ABBE $t?EIG gAAH/FBB B(A0A8DP 8A0A(B BBBG !EO D DHFEE E(D0D8D`J 8A0A(B BBBK @T@FBB A(A0D@ 0D(A BBBG 8FED c BBJ Q BBK 9Ec H @JFBE D(D0F@ 0A(A BBBB 04FAA D@  AABB (h0FEG REB$>EKG dAAT1 FBB B(A0A8G L@LB  8A0A(B BBBI 8 bFBD D(GP (A ABBG 4P FAG0> FBL c ABJ <~FFEE B(A0A8J 8A0A(B BBBE _iFIIA BLB ME @,TFEB A(G0X8K@R(D BBBD0\TK A dxLUY FBB E(A0D8DpK 8A0A(B BBBC 8 8I0F(D BBBO 8DaFDJERAW ABA XaFEE E(A0D8Gp 8D0A(B BBBD xVbxAp4xFAA  ABG 8?FBA A(D0R (A ABBJ 8T@FBA A(D0 (A ABBE (DBEAD@w AAE 8CFBA A(DP (A ABBG ,lDFHA ] AEF (D/EcDDETAH  ABJ ~ AED K DBG DhFmFAA y ABL T AEF Y AEI @GFBB A(A0D@; 0A(A BBBE (lIEAD@ AAK (DLEAD0 AAG HpMFBB B(A0A8DP 8A0A(B BBBF 8hOFBA A(D0c (A ABBI HOMFBB B(A0A8DP 8A0A(B BBBI LDPFBA A(D0$ (A ABBH ? (A ABBK @pUFHA s AEH A DBI RAE@UFHA s AEH A DBI RAEdhV\FBB B(A0A8DP 8A0A(B BBBA W 8A0A(B BBBK X`[\FBB A(A0D@6 0A(A BBBB S 0A(A BBBE Xd`FBB A(A0D@ 0A(A BBBC  0A(A BBBF d<c,FBB B(A0A8D`= 8A0A(B BBBG  8A0A(B BBBK HphFBB B(A0A8Dp 8A0A(B BBBB dneFBB B(A0A8DP 8A0A(B BBBG * 8A0A(B BBBD dXsFBB B(A0A8D@ 8A0A(B BBBD  8A0A(B BBBD d$vFBB B(A0A8D@ 8A0A(B BBBD  8A0A(B BBBD P(xFDG0v ABF ` ABE d FBD J GBE |8zEf M  {Ef M  {Eb I x |Eb I x }Ed G x80T~FAA  AEE H ABM `l(FBB B(A0A8D@ 8A0A(B BBBE 8A0A(B BBBtEJ Q xEJ Q x`t}FBB B(A0A8D@ 8A0A(B BBBB  8A0A(B BBBK dtFBB B(A0A8DP 8A0A(B BBBF  8A0A(B BBBE LFBB A(H0 (A EBBC  (A BEBN 8,FAA X AEJ H ABM dhLgFBB B(A0A8D`< 8A0A(B BBBH  8A0A(B BBBD dTFBB B(A0A8DP 8A0A(B BBBI W 8A0A(B BBBG L8| FBA A(D0 (A ABBJ S (A ABBG 8FBB B(A0A8Dpx 8A0A(B BBBD !xGQxAp\ 8A0A(B BBBF  8A0A(B BBBC d&,IFBB B(A0A8Dp 8A0A(B BBBA  8A0A(B BBBD d'2FBB B(A0A8DP 8A0A(B BBBG L 8A0A(B BBBB @h',6>EAD  AAG G AAG V AAH |'(7mFBB B(A0A8D@f 8A0A(B BBBF L 8A0A(B BBBB T 8A0A(B BBBB H,(:FBB B(A0A8D` 8A0A(B BBBE x(AjHs E Y A (EAD  AAF r AAD L8@FBI H(A0} (A BBBB P (A BBBI d9UFBB B(A0A8DP 8A0A(B BBBG * 8A0A(B BBBD <l9FBB A(H0 (A EBBF 89hMBI A(H0U(D BBBd9FBB B(A0A8DP 8A0A(B BBBB  8G0G(D BBBK PP:d{FHA  ABI \ DBF A DBI c DBG `:VFBA A(D@ (J ABBJ U (A ABBE P (A ABBB ;FBB B(A0A8DP 8A0A(B BBBJ Q 8A0A(B BBBE B 8J0A(B BBBK  8A0A(B BBBN ;FBB B(A0F8D 8A0A(B BBBH SQJALOB}HTBfKNAH4<@jFBB B(A0A8D@U 8A0A(B BBBG h<dD FBB B(A0A8G!B^B GT  8A0A(B BBBA H<HFBB B(A0A8G 8A0A(B BBBG `8=FBB A(H0 (A BBBJ h (A BBBI  (A BEBI H=h ;FBB B(A0A8DpU 8A0A(B BBBG =\(vFBB B(A0A8GERBSHMD+ 8A0A(B BBBA IYBPl>X96FBB A(H0 (A EBBI G (D BBBG H>D=FBB B(A0A8Dp} 8A0A(B BBBG \ ?BFBB A(D0R (D BBBE k (N BBBA y(D BBB8l?hD*FAH  ABH  AEF ?\FGdYH?F FBB B(A0A8Dp 8A0A(B BBBI  @QEJ8(@RFDA z ABH ' DGN Ld@UFBA A(D0d (A ABBH y (A ABBA d@V\FHB B(A0A8D`_ 8A0A(B BBBG nhGpJhA`VhNpFhB`AxZ1FGB B(H0A8DPXI`UXAP 8A0A(B BBBD XM`QXAPAXK`RXBPNXM`UXAPDXM`KXAP|XM`TXBPHAiFBB B(A0A8D`= 8A0A(B BBBG 0BmEAD Z AAJ TAATFSB B(A0A8D` 8A0A(B BBBE L$UA FBE E(A0A8N 8A0A(B BBBG tUPF@HU|FoBBB E(D0D8DP 8A0A(B BBBG HUH'FBB B(D0A8D@ 8A0A(B BBBB d VJ`FBB B(A0A8DP 8A0A(B BBBB I 8A0A(B BBBE 8V|NFAH k AEH  AEC dVPOnFBB B(A0A8DJ 8D0A(B BBBG D 8A0A(B BBBJ d,WXVoFBB B(A0A8DP  8A0A(B BBBH  8J0G(D BBBM HW`YyFBB H(A0A8DP  8A0A(B BBBD hWZ FBB B(A0A8G L![ 8A0A(B BBBJ + 8J0D(H DBBG dLXfFBB B(A0A8D 8A0A(B BBBC ? 8J0G(D BBBF pXlsFBB B(A0A8DPq 8A0A(B BBBC + 8A0A(B BBBK XM`NXAP`(Yo+FBB B(A0A8DP 8A0A(B BBBF  8J0G(D BBBO TYhqFBB B(A0A8DP@XN`NXAPf 8A0A(B BBBA dY0sFBB B(A0A8DP 8A0A(B BBBD  8A0A(B BBBI HLZuFBB B(A0A8DFBA A(D0 (A ABBJ DZxpFII E(A0A8K@8A0A(B BBBLZqUFBB B(A0A8D 8A0A(B BBBE LD[ sFIL I(H0H8NPI8F0K(B BBB4[tFBA G I   ABBD H[Hu"BBJ E(A0A8DP 8A0A(B BBBH (\,vBGD@c DBE HD\vBEB B(H0G8F` 8A0A(B BBBE H\TwFBB B(A0D8DP 8A0A(B BBBK X\ydFBB B(A0A8DP|XH`WXAPR 8A0A(B BBBF P8],{:FBB A(D0|8M@K8A0z8C@T8A0A (A BBBB H]}{ FEB B(A0A8D` 8A0A(B BBBD ]L0_8]hQFBA A(G0 (D ABBK X(^|FBB B(A0A8D`nhLpShA` 8A0A(B BBBD X^FBB B(A0A8Dpn 8A0A(B BBBF xEYxApH^tFIB B(A0A8D@ 8A0A(B BBBA L,_ȗFBA D(D0 (A ABBI T (C ABBL 8|_hKAD K DBO FDBl_` FBB B(A0A8DJPAvFTA 8A0A(B BBBA (`WU#H` \`DH{t`8Erd`TFBB B(A0A8DPG 8D0A(B BBBJ L 8C0A(B BBBH 8`ܨFBA D(L0V (A ABBK 84a0KAD K DBO FDBHpaFBD C(G0 (A ABBG l(A ABB8aFBD A(D0P (G ABBK a*\< bFBA A(D0d (A ABBH Lbx<H0n A hb|bbSb\bܫHbث_BEE E(D0D8GP 8D0A(B BBBA 0cBDC F0Q  AABD (FBB A(C0o (A HBEC W (A BBBB E (D BBBA a (D BBBE pn}FBA D(F0 (F ABBA W (G ABBM c (G ABBI D (G ABBH Lo VFBF B(D0A8J 8D0A(B BBBE 8To PFBB D(D@ (A BBBJ <o"FBB A(A0X (D BBBB @oFBB A(A0G@% 0D(A BBBE LpFBB B(D0A8Gv 8A0A(B BBBH Ddp@0FBE A(F0D@k 0D(A BBBB p(FBB B(A0A8GY 8D0A(B BBBE D KNAcKNBhKTBoHTAcKNALLqH'FHE E(A0D8K" 8A0A(B BBBD Dq+FBD D(GPXW`KXAPy (A ABBE @qP- FBE A(D0F@ 0A(A BBBK H(r0FBB B(A0A8D` 8A0A(B BBBE Ltrp3FBB E(D0D8G| 8A0A(B BBBD dr@:FBB B(A0A8D@ 8A0A(B BBBE u 8A0A(B BBBI @,s=FBB D(D0F 0D(A BBBI HpsT?FEE E(A0D8DP 8A0A(B BBBA HsBFEI E(D0D8D@ 8A0A(B BBBF \t,CFHE E(A0A8G+NNA 8D0A(B BBBF htFFHE E(D0A8G~ 8D0A(B BBBA hWVAVNBWVAtK0utLBDG a ABG DIID4uL$BBB E(A0D8DP8H0D(D BBB@|uMBEA o BBE A EPJ TBB8uDN&BBA A(D@ (A ABBH Lu8PBBD G(N0@ (G DLDH K (D ABBL LLvPqBBB B(A0D8I 8A0A(B BBBA \vR FEB B(D0A8J~ 8A0A(B BBBJ KKA8vx\BPA G(D@ (D ABBA L8w]FBE E(A0D8G 8A0A(B BBBF Pw\`xFKG D(G8B@F8A0T (A ABBJ a(A ABBdw`FBB B(A0D8D@2 8K0A(B BBBE 8 8A0A(B BBBA (DxhJMLD dBBpxiK A LxiFBB B(G0A8G 8A0A(B BBBG LxHk9FIA K(D@ (A ABBD t (J ABBM 8,y8mzFFD  IBL Y NDM 0hy|nEIQ _ NCI DIAHynOFGA D(Q0 (K DDBJ D(I ABBXyo*FGB E(A0H8D` 8D0A(B BBBI ohPpLhH`DDzsFIB A(A0g8N@Y8A0m (D BBBG 4zXtFAG  CBK  CBC HzvFBB B(A0A8D@ 8C0A(B BBBH 4{wq [t y A F A h P H{\{ BBB B(A0D8Jt 8A0A(B BBBK [LA FP TYAIZF"J[A{ȌBPE E(A0D8D`rhLpPxPK` 8A0A(B BBBF T 8J0K(D BBBM D 8A0A(B BBBB ||8!|TFO|X|dFOp|hbFBA D(D@x (D ABBN H (A ABBB  (I HDBJ \ (L ABBK P}d 4d}`FAA Q ABL FHID}PEE E(A0 (A BBBB `}!} ~JE{ H A,~@~UH{ M D`~42FBB E(A0A8GmFPAOWBG[ALURB\URA_OUB 8A0A(B BBBH  8D0A(B BBBL R 8J0A(B BBBK RTBmNNAJZASdBfG\BJXAJOBINjBG[D~GZBG\AkLXAkLYAoLYALWApLFBB B(A0A8D` 8A0A(B BBBK HhKpWhA`hgphB`\hKpWhA`$4.FLH PAB,<8FDF I(H0SABL*,h@d$T`JFBG `KK<|FBI A(A0e(A BBBЁdTE { F,FGA  SBK 44*FDG  ABE | GBK 0lXFDD m GBL DAB8MFEA D(J0 (I DBBF ܂GDwT bpFBB B(A0A8Dpt 8A0A(B BBBH xBJxAp2 8M0A(B BBBE $|iEAD ZCA(0EKM0Q AAH HЃFEB B(A0A8D@O 8A0A(B BBBB |HYFEB E(A0D8Dp 8A0A(B BBBF | 8A0A(B BBBJ  8G0A(B BBBF 8(FED C(G@q (A ABBH 4؄?FED G(F0I(G JBBD]FAA o(B0M(A g ABG  ABI X`0  t7EAD`!FEB B(A0A8G 8D0A(B BBBG GNAI`tIBB D(A0m (D BBBA i (A BBBF d (A BBBE LX,7BBE B(A0I8IZ 8D0A(B BBBK @ `FBA D0C  DBBH y  DBBG H8 FBB B(A0A8G 8D0A(B BBBF 8 ENdT &PBB B(D0A8D@w 8A0A(B BBBH H@XЇFKL L(A0A8L\BIAq 8D0A(B BBBC ,$@*FDG IIB`hBBB E(D0A8D` 8A0A(B BBBH c 8A0A(B BBBK ̈XT6BEG B(D0A8GBQBNSARAHII 8A0A(B BBBC 4dAFED G(F0I(J GDB(H4FEE E(A0D8G@Q 8D0A(B BBBA 8FED C(G@q (A ABBH 48L ?FEG D(F0I(G GEBHpT FBB E(A0D8Fp 8D0A(B BBBB 0%FDD G0o  AABH (4&0FEG REBX8&FDG E(E0D8F`  8D0A(B BBBD  hPpFhA`0xl*FDD G0o  AABH (*0FEG REB؋*L*FEB B(A0A8G 8D0A(B BBBA 4<h/+VAA WABFH Xt`1FEB B(A0C8I 8D0A(B BBBH s Ex LЌLLFBD A(F@B (A ABBE J (C ABBF X MFBE A(A0F@ 0F(A BBBE H 0C(A BBBF 4|OyAC PABHA ,pPFAA  ABF @PQFED G@~  HDEK S  ABBA ((Q-FED UBB(TQUMDA nFJ0RFDC G0g  AABA TR8`KA M ABD Q(B0J(A jA ](B0J(A L hTFOD D0n  ABBH f  ABBE b ABBH\UzBEB E(A0D8J@~ 8D0A(B BBBH HEk H EFEl O E` 2FBE E(F0I8FcHWE`Q 8D0A(B BBBA \|FEE E(F0A8DwXHEk^ 8A0A(B BBBA 4ܥtFGJ A(D0C(J BBBL= FBB B(A0A8G 8A0A(B BBBF 8d%:FDA A(LP (D ABBA (&Ec P S E e K L̦' BBB B(A0A8G 8A0A(B BBBB 42LV N AH<4FBB B(D0A8G@ 8D0A(B BBBJ 6L6= FBB B(A0A8G3 8D0A(B BBBK $CfFHD KFBC(C <CPCdCxCCCCȨCܨC CCC,C@CTChC|C>Ei J EC>Ei J ECЩC CC C C 4CHCHB B(D0IhC|CCCC ̪C!HJC KC(HLD O C)HFK O,C"HGI ILD-HKN KlD=KYL L8D?HZM OXDBH]J R̫D:KZK I(DFAD  DBD (|EFAD  ABE DpFXlFlhFdFpFlFxF ЬtFpFlF( hF4FAD  ABG 8|GLxG`tGtpGlGhGtGĭpGحlG]GgHH(H<HPH 4dH7EAG0 AAE _8H@I8A0TIFBB B(D0D8DP 8A0A(B BBBD gXH`LXAPPJ4LJBED D(F0e(A ABB@J TJAp O j F x\a HxkEI  CH lHyVEu F K E XyFBB B(A0D8DpxPPxApO 8C0A(B BBBK \}IFBB B(A0A8GGKA 8C0A(B BBBE LF`4(tP?EY B ^pHKhxFBA D(G@xHIPIHA@ (A ABBG n (A ABBD H (A ABBB ,!E[H4@RGB A(A0j8F@R8A0 (A BBBG E A(WEs H lHPлtHO|xt3ZR( <3N[GX)QWtЄ%E_EWD<FAA  CBE D(C0J(A S CBF HFBB B(A0D8G 8C0A(B BBBD `@TFEI D(E0Q (A BBBK Z (A BBBG R (D BBBD 0М)FAD D0y  CABB hؽ̝FBB B(A0D8Jl 8C0A(B BBBE NGjA Hd $D)EFG MDAlnH J F lELLp2 FEB B(A0A8G 8A0A(B BBBB `| ح  ԭ L4ЭFBH B(A0A8L 8A0A(B BBBE PL H(DhFDA WCB0EAG L CAC mCA (Eb(<EIJ0G FAJ h9Eb I #HZtȰRBEE B(A0D8GPJXO`KXBPUXR`PXBP_XB`UXAPiXI`MXCPU8A0A(B BBB4YEJG L(B0P(A R AAG DLرFBE A(D0u8B@F8A0J (D BBBD AHNM IAS4~EAG a(H0I(A I AAA 9Es r FBB B(A0A8D 8D0A(B BBBC IHAX 8J0A(B BBBL MPBFcI$"0ITԽBEB B(D0A8JmGaEUMMBnG`BIWEFWA@BOA 8A0A(B BBBH INDBKBDPB> dFBB B(A0A8D`# 8D0A(B BBBF MhJpRhA`dhJpqhA`DFBB B(A0A8DBNAAJAJGUAW 8A0A(B BBBC BJBJKRB 8E0A(B BBBE \FBB B(A0D8D^BJAt 8A0A(B BBBB X`DFBA A(D0P8L@P8A0s (A ABBD U (A ABBE 8FBA A(D0r (A ABBA 8\FDA E ABM A ABD 4<HoLLBBD D(D0{ (G ABBI  (F ABBD  X`XnnHd FEB B(A0A8D 8D0A(B BBBH L8 HN Ih< HN I@#HQ I,TES@qHFPNHA@t AE ,ES@qHIPNHA@y AE ,tES@qHFPNHA@t AE H0FBB B(A0D8GP\ 8D0A(B BBBG H|HFEB E(E0D8I` 8D0A(B BBBH `EFBB B(A0D8G` 8D0A(B BBBH hBpPhC`QhBp, ,@FDD  DBF @pFBE D(G0D` 0D(A BBBB 0FAD D0  AABI   %  H0w A \ L 4 rH, AAM`d0 tIBB D(A0m (D BBBA i (A BBBF d (A BBBE Lm7dR(FAH AB DH4mFBB B(A0A8D@ 8D0A(B BBBF ,FAA  ABH W\Ftx@FBB B(A0A8DPUXb`MXAPxXF`HhDpLPU 8A0A(B BBBD MXF`DhDpPP\D@'FBD D(G0v (D ABBJ q (D ABBF p (D ABBA _ 0HSFBB B(D0A8D@ 8A0A(B BBBD 8 FBD D(G@d (A ABBG `H|FEH B(A0A8D`U 8A0A(B BBBF  8A0A(B BBBO (mFAL J ABH (KFAH xABJED84P(RAG k DBE c ABJ 8pDFBD D(G0R (D ABBF HFBB B(A0C8GP 8D0A(B BBBG L<#mBBB B(D0D8DD 8D0A(B BBBK H h<5(ZH|X5IFBE B(A0A8D` 8D0A(B BBBB <\8BGB D(D0_ (D BBBD \8 FEB B(A0A8D 8D0A(B BBBJ CKA4h|<=FED D(G0I(G JBB0<FED G0S  ABBB t< BBB B(A0A8D 8D0A(B BBBK RGJDIWBDQPLXF,FBB A(A0DPoXT`FhIpLP 0D(A BBBA $4G+FDG IJB $.@>.d>$/>/>1>De?de?Df?fD@4gl@g@DjAlAl@Am|AmAoA$qAt4BvpB$~B~BT$C8CDtCCTCDLDԆDćDdD ED\>>t>DX?d?4?$@|@@$A4AtAAAATBlBTBBtBB4BC(CXCCCTCD0EDE4 pFFDdGGG,HD@H`HtHHHH$H4H$I!pI!I"I$(4J(HJ)J*Jd+K+0K/|Kt0K0 L$18LD1TL1pL4L4L5L46 MT6(M6DMT7M7Md8M;NT;HN\nEG AG L0>FIB B(A0A8G 8A0A(B BBBH >EAD >v >||BMD >ܴ[AAK \> FAA DPXH`WXBP  DABA XN`FXAPXM`]XDP`X?A%FDB B(D0D8Gw 8D0A(B BBBG  qBAK,?xhFCG DBF ?E@mu@ML@`<@HiBBB E(D0D8GP_XK`ZXAPQ 8A0A(B BBBF eXB`FXAP@t P(@4EAD  AAK 8@FJK K BBF w BBE H(ALFIB B(A0A8D` 8A0A(B BBBG HtAeFBB B(A0A8DPZ 8A0A(B BBBJ xAIBBB E(D0D8GP 8J0D(B BBBH T 8C0A(B BBBH D 8F0A(B BBBE H@BDFHJLNPRTVXZ\^bdfhjlnprtvxz|~(8HY[]_h2!`!!$,`,:>g,i,k,r,u,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@BDFHLNPRTVXZ\^`bdfhjl"$&(*,.2468:<>@BDFHJLNPRTVXZ\^`bdfhjlny{~ħ§ǧɧ̧Ч֧اڧ!p| P @nJ`b*"!&!E+!SK*!a   !#%')+-/357:<>@BDFHKMOQSUWY[]_acegikmoqsuwz|~STVY[`cihoru   #%')+-/13e,<f,BGIKMOqsw{P0acegikmoqsuwy{}   !#%')+-/a-'---p   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{} 0@QSUW`prvzx|kN!p!!$0,a,k}}h,j,l,QqPRs,v,?,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,ACEGIKMOQSUWY[]_acegikm#%')+-/3579;=?ACEGIKMOQSUWY[]_acegikmoz|yef\aljSçȧʧdͧѧק٧ۧA( p `n"ia   !#%')+-/357:<>@BDFHKMOQSUWY[]_acegikmoqsuwz|~sSTVY[`cihoru   #%')+-/13e,<f,BGIKMOqsw{P0acegikmoqsuwy{}   !#%')+-/a-'---24>ABJcK   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}a 0@QSUW`prvzx|kN!p!!$0,a,k}}h,j,l,QqPRs,v,?,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,ACEGIKMOQSUWY[]_acegikm#%')+-/3579;=?ACEGIKMOQSUWY[]_acegikmoz|yef\aljSçȧʧdͧѧק٧ۧA( p `n"tm~vtktetvstfflffiflfiffBB|BBBBBBtBBpgfedcba`'&%$#"! Bay w th1ej nissOperation "%s" returns its argument for UTF-16 surrogate U+%04lXOperation "%s" returns its argument for non-Unicode code point 0x%04lXpanic: Unexpected case value in utf8n_to_uvchr_msgs() %u%s: %s (unexpected continuation byte 0x%02x, with no preceding start byte)%s: %s (too short; %d byte%s available, need %d)%s: %s (unexpected non-continuation byte 0x%02x, %s after start byte 0x%02x; need %d bytes, got %d)%s: %s (any UTF-8 sequence that starts with "%s" is overlong which can and should be represented with a different, shorter sequence)%s: %s (overlong; instead use %s to represent %s%0*lX)UTF-16 surrogate (any UTF-8 sequence that starts with "%s" is for a surrogate)Any UTF-8 sequence that starts with "%s" is a Perl extension, and so is not portableAny UTF-8 sequence that starts with "%s" is for a non-Unicode code point, may not be portablepanic: force_out_malformed_utf8_message_ should be called only when there are errors foundCan't do %s("\x{%lX}") on non-UTF-8 locale; resolved to "\x{%lX}".panic: utf16_to_utf8%s: odd bytelen %lupanic: to_upper_title_latin1 did not expect '%c' to map to '%c'Can't do fc("\x{1E9E}") on non-UTF-8 locale; resolved to "\x{17F}\x{17F}".Can't do fc("\x{FB05}") on non-UTF-8 locale; resolved to "\x{FB06}".Unicode surrogate U+%04lX is illegal in UTF-8\a\b\e\f\n\r\tutil:safesysmallocutil:safesysreallocutil:savesharedpvutil:savesharedpvnpanic: POPSTACK util:safesyscalloc at %s line %u, <%-p> %s %ld during global destructionEXECCan't fork: %sexecute on PATH, '.' not in PATHCan't %s %s%s%sunopenedclosed%s%s on %s %s%s%-pInteger overflow in versionv.InfvinfInvalid version objectalpha->numify() is lossy%d.%03dv%ld.%ld/dev/urandomDETERMINISTICRANDOMPERL_HASH_SEED_DEBUGSBOX32_WITH_SIPHASH_1_3%02x PERTURB_KEYS = %d (%s)util.c%.9f.,C.UTF-8secondXS_VERSION%-p::%s$%-p::%s %-pbootstrap parameter %-pPERL_HASH_SEEDPERL_PERTURB_KEYSp11 1011@1P11111111111111`1$~$~lL$~$~$~,$~$~ $~$~~$~$~$~~$~$~$~$~$~$~$~$~$~$~$~$~$~~$~$~$~$~$~$~$~~$~$~$~$~$~|~_Out of memory in perl:Can't fork, trying again in 5 secondsFilehandle %2p opened only for %sputFilehandle opened only for %sput (Are you trying to call %s%s on dirhandle%s%-p?) Invalid version format (dotted-decimal versions require at least three parts)Invalid version format (no leading zeros)Invalid version format (maximum 3 digits between decimals)Invalid version format (no underscores)Invalid version format (multiple underscores)Invalid version format (underscores before decimal)Invalid version format (0 before decimal required)Invalid version format (negative version number)Invalid version format (non-numeric data)Invalid version format (alpha without decimal)Invalid version format (misplaced underscore)Invalid version format (fractional part required)Invalid version format (dotted-decimal versions must begin with 'v')Invalid version format (trailing decimal)Integer overflow in version %dUnknown Unicode option letter '%c'Invalid number '%s' for -C option. Unknown Unicode option value %luHASH_FUNCTION = %s HASH_SEED = 0xpanic: my_snprintf buffer overflowVersion string '%s' contains invalid data; ignoring: '%s'panic: my_vsnprintf buffer overflowPerl API version %s of %s does not match %s%s: loadable library and perl binaries are mismatched (got %s handshake key %p, needed %p) %-p object version %-p does not match perl: warning: Non hex character in '$ENV{PERL_HASH_SEED}', seed only partially set perl: warning: strange setting in '$ENV{PERL_PERTURB_KEYS}': '%s' vaJp@librefDynaLoaderfilename, flags=0DynaLoader.cDynaLoader::dl_load_fileDynaLoader::dl_unload_fileDynaLoader::dl_find_symbolDynaLoader::dl_undef_symbolsDynaLoader::dl_install_xsubDynaLoader::dl_errorPERL_DL_NONLAZYperl_name, symref, filename="$Package"libhandle, symbolname, ign_err=0;GHԾ(lHtH4HHtH$HdH4 IT$AttBL@LT4MltMQdR,RhST$UUDV`Vt$VVVXY44Z`tZ|ZZZ[̫D[t\@]cdhḙg,$htijXkdm n$tddĊh$̳ ԚT44$xĭȵԽLDtȷ \Dd4ܹD l$hT4`t  ,D t 4Dtt0d Կ4)<)h4*$,d.$/`016<68:>@PVtVW$WDWYHY\TZt[[[\$4\8\X$D$d$8Lt4,4d4dtԦdĬtlTP$0LD$8$`$4t\0ht$Tp4lt!"t%t$&4'( 4(L(x4)t+d,T,.D08$1X44T689(:XT:l::;4;d;d>\>t???4@T@d@,4AtABDDE04FTTHK L<4LTMNR RlUtUdV0VTXY ssx{p}|DTPd\$48$L$0d@TlD<t44PDD44xL$dt D\T#$$44&D&33 4 4444HD4\T4pd4t44444444$485L$5`45tt55555566,$6@D6`T6td6t66666$7$T7D7d78T889:<:P:d:x;;4;D;T;d;t;<0$> D> T>4d>Ht>\?DATAA8BLBp4CDFF(DG@MlNOO 4P4PHtQRR SH$TUDVTV$W<DWTXccfHghggDh4jdj8j`dkTll4mm$qtdrr s@Ttxudu4vvHw4yyyz(Dz@zd{~DDXĂl$Dt,4xć$DdtĈ Ԉ4PDltԋ8tT<dT,Զ|tD4`4|dĺ $D  d  $   D<  X  T ,$D$dD`|t4( t$$8$h4$,t@\!!!d"$#,$x%D&'<)++@T333444,5hT64:L`Lt$PPT`$UU_D`aa$bb@eTfdktkk(lttnr0sPsd}TĕĘ$TdtԽ0D4XTldt T l     !!T4!p!!!d!!"4 "L"t"D""T"$#l##D#T###$tX$$$T$$ %$$%p%T%%48&`&&$&D&'<'X't'''4`(($((()t0)P))4)t*$L***$*T+4+DP+h++D++++D,p| | | | | | | | | X| | | | | | | | | | | | | | | | | | X| | | | | p| | X| | | | | Xs ) s3#s " 2! a s P!#sss T "p#" n! " a `  @ P "l " %l l l l l l l %l l l l l B#l l "l l l l l l l l "`#"l "l l l l L#$$l l j#l V#l l "0 "A"00000B!:1:B!B!B!B!B!y#D#D#D#D#D#D#D#D#D#D#D#D##D#D#D#D##D#y#D#y#D#D#D#D#y#D#D#y#D#D#D#D#D#y#-pE//E=B`A//E`AL4JLJlIJL J8JXIJ(null)00010203040506070809101112131415161718192021222324252627282930313233343536373839404142434445464748495051525354555657585960616263646566676869707172737475767778798081828384858687888990919293949596979899DESTROYA@ A( (!0 `  0000PP(( hhhhn  ((@ while running setuid while running setgid while running with -T switch while running with -t switchIFSanother variable%%ENV is aliased to %s%s%%ENV is aliased to %%%s%s$ENV{PATH}Insecure %s%sInsecure directory in %s%s-_.+Insecure $ENV{%s}%sCDPATHBASH_ENVUTCmn;Zx0N<[y1Ov@v@vvN@8@@@@A0oUnC,msyqqwxr $#+-'";&/|})]oaiuwf!=No comma allowed after %sParse error\x%02Xlex_stuff_pvnlex_stuff_svlex_unstufflex_read_tolex_discard_to$@%*;[]&\_+%s had compilation errors. at EOFnext token ???at end of linewithin patternwithin stringnext char ^%c at %s line %u, near "%d%lu%4p" %-p lex_start ;lex_next_chunk;}lex_peek_unicharlex_read_unicharlex_read_space[...]{...}[\]^_?*[{[#!%*<>()-=])} =wds]abcfnrtvxaA01! zZ79~BarewordBad name after %d%lu%4p%sperl -indirCan't exec %sToo late for "-%.*s" option} is not definedCall to &{$^H{PropagatedConstant(%.*s)%s %s%s%s:short:fullUnknown charname ''Unknown charname '%s'lvalue{$:+-@Array lengthScalarFinal $ should be \$ or $nameYou need to quote "%d%lu%4p"$@"'`q&*<%)>]}(<[{([{<Unterminated attribute listExcessively long <> operatorUnterminated <> operatorGlob not terminatedMissing name in "%s"Prototype not terminatedCan't redeclare "%s" in "%s"__PACKAGE__No such class %.1000smsixxnopnadlumsixxnopnadlugcSearch pattern not terminated([{< )]}> )]}>:'{$()| \%c better written as $%clLuUEQFMissing right brace on \N{}%02X.\N{U+%X.%X0o37777777777floatpanic: scan_num, *s=%dMisplaced _ in numberIllegal octal digit '%c'Illegal binary digit '%c'%s number > %s non-portableNumber too long+-0123456789___CLASS__ is experimentalADJUST is experimentalall is experimentalany is experimentalclass is experimentaldefer is experimentalDB_File::NDBM_File::AnyDBM_File::ISAODBM_File::SDBM_File::GDBM_File::field is experimentalMissing $ on loop variable|&*+-=!?:.msixxnopnadlugcereval do {subroutine namemethod is experimentalFormat not terminatedLINE: while (<>) {chomp;our @F=split(%s);our @F=split(' ');=====+-*/%.^&|<Reversed %c= operator!=~ should be !~<<<<<>>>>>StringBackticksBackslashUseless use of \EL\uU\lLUFpanic: yylex, *s=%u$:@%&*;\[]=~>Unmatched right curly bracketparse_exprparse_blockparse_barestmtparse_labelparse_fullstmtparse_stmtseqparse_subsignatureBinaryOctalHexadecimal0xffffffff%s (...) interpreted as functionWarning: Use of "%d%lu%4p" without parentheses is ambiguousOperator or semicolon missing before %c%d%lu%4pAmbiguous use of %c resolved as operator %cCan't find string terminator %c%d%lu%4p%c anywhere before EOFUnrecognized character %s; marked by <-- HERE after %d%lu%4p<-- HERE near column %dLexing code internal error (%s)Lexing code attempted to stuff non-Latin-1 character into Latin-1 inputPrototype after '%c' for %-p : %sMissing ']' in prototype for %-p : %sIllegal character in prototype for %-p : %sIllegal character after '_' in prototype for %-p : %sSource filters apply only to byte streamsfilter_del can only delete in reverse order (currently)panic: utf16_textfilter called in block mode (for %d characters)panic: utf16_textfilter called after error (status=%ld)%-p%s had compilation errors. %-pExecution of %s aborted due to compilation errors. Execution of %s aborted due to compilation errors. (Might be a runaway multi-line %c%c string starting on line %u) %s found where operator expected (Missing semicolon on previous line?) (Do you need to predeclare "%d%lu%4p"?) (Missing operator before "%d%lu%4p"?)Use of non-ASCII character 0x%02X illegal when 'use source::encoding "ascii"' is in effectVersion control conflict marker;}continue{print or die qq(-p destination: $!\n);}Ambiguous use of %c{%s%s} resolved to %c%s%sAmbiguous use of %c{%-p} resolved to %c%-pBareword "%d%lu%4p" refers to nonexistent packageUnsupported script encoding UTF-32LEUnsupported script encoding UTF-32BE}} did not return a defined valuecharnames alias definitions may not contain trailing white-space; marked by <-- HERE in %.*s<-- HERE %.*sMalformed UTF-8 returned by %.*s immediately after '%.*s'Invalid character in \N{...}; marked by <-- HERE in %.*s<-- HERE %.*scharnames alias definitions may not contain a sequence of multiple spaces; marked by <-- HERE in %.*s<-- HERE %.*s:const is not permitted on named subroutinesUnknown regexp modifier "/%.*s"Regexp modifiers "/%c" and "/%c" are mutually exclusiveRegexp modifier "/%c" may not appear twiceRegexp modifier "/a" may appear a maximum of twiceMultidimensional syntax %d%lu%4p not supported«»»༺༻༼༽᚛᚜‘’’“””‵′‶″‷‴‹››⁅⁆⁍⁌⁽⁾₍₎→←↛↚↝↜↠↞↣↢↦↤↪↩↬↫↱↰↳↲⇀↼⇁↽⇉⇇⇏⇍⇒⇐⇛⇚⇝⇜⇢⇠⇥⇤⇨⇦⇴⬰⇶⬱⇸⇷⇻⇺⇾⇽∈∋∉∌∊∍≤≥≦≧≨≩≪≫≮≯≰≱≲≳≴≵≺≻≼≽≾≿⊀⊁⊂⊃⊄⊅⊆⊇⊈⊉⊊⊋⊣⊢⊦⫞⊨⫤⊩⫣⊰⊱⋐⋑⋖⋗⋘⋙⋜⋝⋞⋟⋠⋡⋦⋧⋨⋩⋲⋺⋳⋻⋴⋼⋶⋽⋷⋾⌈⌉⌊⌋⌦⌫〈〉⍈⍇⏩⏪⏭⏮☛☚☞☜⚞⚟❨❩❪❫❬❭❮❯❰❱❲❳❴❵⟃⟄⟅⟆⟈⟉⟞⟝⟦⟧⟨⟩⟪⟫⟬⟭⟮⟯⟴⬲⟶⟵⟹⟸⟼⟻⟾⟽⟿⬳⤀⬴⤁⬵⤃⤂⤅⬶⤇⤆⤍⤌⤏⤎⤐⬷⤑⬸⤔⬹⤕⬺⤖⬻⤗⬼⤘⬽⤚⤙⤜⤛⤞⤝⤠⤟⤳⬿⤷⤶⥅⥆⥇⬾⥓⥒⥗⥖⥛⥚⥟⥞⥤⥢⥬⥪⥭⥫⥱⭀⥲⭁⥴⭋⥵⭂⥹⥻⦃⦄⦅⦆⦇⦈⦉⦊⦋⦌⦍⦐⦏⦎⦑⦒⦓⦔⦕⦖⦗⦘⦨⦩⦪⦫⦳⦴⧀⧁⧘⧙⧚⧛⧼⧽⩹⩺⩻⩼⩽⩾⩿⪀⪁⪂⪃⪄⪅⪆⪇⪈⪉⪊⪍⪎⪕⪖⪗⪘⪙⪚⪛⪜⪝⪞⪟⪠⪡⪢⪦⪧⪨⪩⪪⪫⪬⪭⪯⪰⪱⪲⪳⪴⪵⪶⪷⪸⪹⪺⪻⪼⪽⪾⪿⫀⫁⫂⫃⫄⫅⫆⫇⫈⫉⫊⫋⫌⫏⫐⫑⫒⫕⫖⫥⊫⫷⫸⫹⫺⭆⭅⭇⭉⭈⭊⭌⥳⭢⭠⭬⭪⭲⭰⭼⭺⮆⮄⮊⮈⮕⬅⮚⮘⮞⮜⮡⮠⮣⮢⮩⮨⮫⮪⮱⮰⮳⮲⯮⯬⸂⸃⸃⸄⸅⸅⸉⸊⸊⸌⸍⸍⸑⸐⸜⸝⸝⸠⸡⸡⸢⸣⸤⸥⸦⸧⸨⸩⸶⸷⹂„⹕⹖⹗⹘⹙⹚⹛⹜〈〉《》「」『』【】〔〕〖〗〘〙〚〛〝〞꧁꧂﴾﴿﹙﹚﹛﹜﹝﹞﹤﹥()<>[]{}⦅⦆「」→←𝄃𝄂𝄆𝄇👉👈🔈🕨🔉🕩🔊🕪🕻🕽🖙🖘🖛🖚🖝🖜🗦🗧🠂🠀🠆🠄🠊🠈🠒🠐🠖🠔🠚🠘🠞🠜🠢🠠🠦🠤🠪🠨🠮🠬🠲🠰🠶🠴🠺🠸🠾🠼🡂🡀🡆🡄🡒🡐🡢🡠🡪🡨🡲🡰🡺🡸🢂🢀🢒🢐🢖🢔🢚🢘🢡🢠🢣🢢🢥🢦🢧🢤🢩🢨🢫🢪🢶🢴)>]}»«༻༽᚜’‘”“′″‴›‹⁆⁌⁾₎←↚↜↞↢↤↩↫↰↲↼↽⇇⇍⇐⇚⇜⇠⇤⇦⬰⬱⇷⇺⇽∋∌∍≥≧≩≫≯≱≳≵≻≽≿⊁⊃⊅⊇⊉⊋⊢⫞⫤⫣⊱⋑⋗⋙⋝⋟⋡⋧⋩⋺⋻⋼⋽⋾⌉⌋⌫〉⍇⏪⏮☚☜⚟❩❫❭❯❱❳❵⟄⟆⟉⟝⟧⟩⟫⟭⟯⬲⟵⟸⟻⟽⬳⬴⬵⤂⬶⤆⤌⤎⬷⬸⬹⬺⬻⬼⬽⤙⤛⤝⤟⬿⤶⥆⬾⥒⥖⥚⥞⥢⥪⥫⭀⭁⭋⭂⥻⦄⦆⦈⦊⦌⦐⦎⦒⦔⦖⦘⦩⦫⦴⧁⧙⧛⧽⩺⩼⩾⪀⪂⪄⪆⪈⪊⪎⪖⪘⪚⪜⪞⪠⪢⪧⪩⪫⪭⪰⪲⪴⪶⪸⪺⪼⪾⫀⫂⫄⫆⫈⫊⫌⫐⫒⫖⊫⫸⫺⭅⭉⭊⥳⭠⭪⭰⭺⮄⮈⬅⮘⮜⮠⮢⮨⮪⮰⮲⯬⸃⸂⸅⸄⸊⸉⸍⸌⸐⸝⸜⸡⸠⸣⸥⸧⸩⸷„⹖⹘⹚⹜〉》」』】〕〗〙〛〞꧂﴿﹚﹜﹞﹥)>]}⦆」←𝄂𝄇👈🕨🕩🕪🕽🖘🖚🖜🗧🠀🠄🠈🠐🠔🠘🠜🠠🠤🠨🠬🠰🠴🠸🠼🡀🡄🡐🡠🡨🡰🡸🢀🢐🢔🢘🢠🢢🢦🢤🢨🢪🢴(<[{«»༺༼᚛‘’“”‵‶‷‹›⁅⁍⁽₍→↛↝↠↣↦↪↬↱↳⇀⇁⇉⇏⇒⇛⇝⇢⇥⇨⇴⇶⇸⇻⇾∈∉∊≤≦≨≪≮≰≲≴≺≼≾⊀⊂⊄⊆⊈⊊⊣⊦⊨⊩⊰⋐⋖⋘⋜⋞⋠⋦⋨⋲⋳⋴⋶⋷⌈⌊⌦〈⍈⏩⏭☛☞⚞❨❪❬❮❰❲❴⟃⟅⟈⟞⟦⟨⟪⟬⟮⟴⟶⟹⟼⟾⟿⤀⤁⤃⤅⤇⤍⤏⤐⤑⤔⤕⤖⤗⤘⤚⤜⤞⤠⤳⤷⥅⥇⥓⥗⥛⥟⥤⥬⥭⥱⥲⥴⥵⥹⦃⦅⦇⦉⦋⦍⦏⦑⦓⦕⦗⦨⦪⦳⧀⧘⧚⧼⩹⩻⩽⩿⪁⪃⪅⪇⪉⪍⪕⪗⪙⪛⪝⪟⪡⪦⪨⪪⪬⪯⪱⪳⪵⪷⪹⪻⪽⪿⫁⫃⫅⫇⫉⫋⫏⫑⫕⫥⫷⫹⭆⭇⭈⭌⭢⭬⭲⭼⮆⮊⮕⮚⮞⮡⮣⮩⮫⮱⮳⯮⸂⸃⸄⸅⸉⸊⸌⸍⸑⸜⸝⸠⸡⸢⸤⸦⸨⸶⹂⹕⹗⹙⹛〈《「『【〔〖〘〚〝꧁﴾﹙﹛﹝﹤(<[{⦅「→𝄃𝄆👉🔈🔉🔊🕻🖙🖛🖝🗦🠂🠆🠊🠒🠖🠚🠞🠢🠦🠪🠮🠲🠶🠺🠾🡂🡆🡒🡢🡪🡲🡺🢂🢒🢖🢚🢡🢣🢥🢧🢩🢫🢶Use of unassigned code point or non-standalone grapheme for a delimiter is not allowedUse of '%d%lu%4p' is experimental as a string delimiterUse of '%d%lu%4p' is deprecated as a string delimiterUse of := for an empty attribute list is not allowedUnterminated attribute parameter in attribute listInvalid separator character %c%c%c in attribute listSubroutine attributes must come before the signatureUnterminated delimiter for here documentUse of bare << to mean <<"" is forbiddenDelimiter for here document is too longIndentation on line %d of here-doc doesn't match delimiterIllegal declaration of anonymous subroutineIllegal declaration of subroutine %-pUse of /c modifier is meaningless without /gAmbiguous range in transliteration operatorInvalid range "%c-%c" in transliteration operatorInvalid range "\x{%04lX}-\x{%04lX}" in transliteration operatorPossible unintended interpolation of $\ in regexUnrecognized escape \%c passed throughMissing right brace on \N{} or unescaped left brace after \N%.*s must not be a named sequence in transliteration operatorMissing control char name in \cpanic: constant overflowed allocated space, %lu >= %luInteger overflow in decimal numberHexadecimal float: exponent underflowHexadecimal float: exponent overflowNo digits found for %s literalHexadecimal float: mantissa overflow"%s" not allowed in expressiontry/catch/finally is experimentalPrecedence problem: open %d%lu%4p should be open(%d%lu%4p)Possible attempt to separate words with commasPossible attempt to put comments in qw() list<> at require-statement should be quotesSubstitution pattern not terminatedSubstitution replacement not terminatedUse of /c modifier is meaningless in s///Transliteration pattern not terminatedTransliteration replacement not terminatedCORE::%d%lu%4p is not a keywordBad plugin affecting keyword '%s'Bad infix plugin result (%zd) - did not consume entire identifier <%s> dump() must be written as CORE::dump() as of Perl 5.30Ambiguous call resolved as CORE::%s(), qualify as such or use &Missing right curly or square bracketBEGIN { require 'perl5db.pl' };use feature ':5.42'; use builtin ':5.42';Unmatched right square bracketCan't use \%c to mean $%c in expressionNo package name allowed for %s %s in "our"Possible unintended interpolation of %d%lu%4p in stringBad evalled substitution patternSequence (?{...}) not terminated with ')'Illegal character following sigil in a subroutine signature'#' not allowed immediately following a sigil in a subroutine signatureIllegal operator following parameter in a subroutine signatureA signature parameter must start with '$', '@' or '%'Parsing code internal error (%s)}bcdbbbbbbbbPcPcbPbbpppppppppppppp~pppppppppo`QB3$pppppppph@@@X@@@8H@@@@ ee d ddedencnce de||||||||ttttttttttttttttttttttU~tttttttttttttttttt?2tttttttt]ttSt1ttt~@@666666,,444444444444U'mϹ77ȭȭȭȭȭȭȭ{8 lP4M1Op-]Ao=mNa;Up-ExxW}"հ7nR6׷fJ Իd[aįour @F=split(qlll lllld|dddllllllllllll llllldT+ |< | 4 #V,m] 44444444444444444444444444 x4444444444444444444444Q 4K44 { + X684X65(-F-3H0.BBvBvBvBM=vBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBvBB?@@ @0@Numeric variables with more than one digit may not start with '0'Identifier too long@ A( (!0 `  0000PP(( hhhhn  ((@@Awarn_categoriesflag_bit(nil)immediatelyU+%s (empty string)%d bytes%s: %s (overflows)%s %s%s_reversedMalformed UTF-16 surrogateuppercasetitlecaselowercasefoldcaseẞſt\\\x{%lx}K][ ]]]\\mlQxmwmmm wmmmmmmmummmmmmmmmmmmmmmmmllmlmmmlmmmmmmmlmmmmmmmmmmmmmmm;mCode point 0x%lX is not Unicode, may not be portableUnicode non-character U+%04lX is not recommended for open interchangeUTF-16 surrogate U+%04lXMalformed UTF-8 character (unexpected end of string)Malformed UTF-8 characterAx   "$&(*,.I2469;=?ACEGJLNPRTVXZ\^`bdfhjlnprtvy{}SC=ܧ   "$&(*,.02;~,AFHJLNo,m,p,˧b,n,d,ŧDEprv`bdfhjlnprtvxz|~   "$&(*,.1!"*bJ}c,Ƨ   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~`(8HY[]_h2!`!!$,`,:>g,i,k,r,u,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@BDFHJLNPRTVXZ\^`bdfhjl"$&(*,.2468:<>@BDFHJLNPRTVXZ\^`bdfhjlny{~ħ§ǧɧ̧Ч֧اڧ!p| P @nD=NFD;D5DFSTFFLFFIFLFIFFBBBBBBBBBBonmlkjih/.-,+*)(     BAY W TH15RJ NSSAx   "$&(*,.I2469;=?ACEGJLNPRTVXZ\^`bdfhjlnprtvy{}SC=ܧ   "$&(*,.02;~,AFHJLNo,m,p,˧b,n,d,ŧDEprv`bdfhjlnprtvxz|~   "$&(*,.1!"*bJ}c,Ƨ   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~`(8HY[]_h2!`!!$,`,:>g,i,k,r,u,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@BDFHJLNPRTVXZ\^`bdfhjl"$&(*,.2468:<>@BDFHJLNPRTVXZ\^`bdfhjlny{~ħ§ǧɧ̧Ч֧اڧ!p| P @nDmNvDkDeDvStFflFfiFlFiFfBEBEEBBBBBEBEEBEBEEBAY W TH15J NSsa   !#%')+-/357:<>@BDFHKMOQSUWY[]_acegikmoqsuwz|~sSTVY[`cihoru   #%')+-/13e,<f,BGIKMOqsw{P0acegikmoqsuwy{}   !#%')+-/a-'---24>ABJcK   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}                                                                                                                                                                          1 <%:98:5 9-*-=4-%59 5 2 &589!7!8965 & & - -9  % ))48- % % 484 % 4 4 4 -% 9 4 4 4 4889 4 49 4 49 4  4 48 4 9 4 4&&%&% 4 5 5    & 4 4 .0/ 5   39 4%% & 4 %44 44  @++ + 4 ? 44 & & &B C >&7657657, &876$3-5 3$8A 5 5 989989898989 889!!!!9,5 5 !!!!#!!!!!!#!!!#!##!!#!!#!!!!!!##!##!#!#!#!#!!##!#!##!!!!!!!!:%"#!5 5 5 5 5 5 5 !5 5 5 5 5 5 !5 5 5 5 5 5 5 5 5 5 5 5 5 5 ! %% :7676:76:76576765 5 5 5 %5%5 5 5 5 +%4  8% 4  4  .  @+++ 4   +   4'('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('(0/) ))))))) 58 & & & & & & & A  4  , 44    @++  & 4 44 4   4   4   @  + @ ++ 4 4 % 4 44 4 4 @     4 4% 4 4    @+ 85 5 5 5 5&5 &5 5 5  44  44   4 4  4 49 4 4 4588## # # # # # !!!!! ;     ####!##### ###!########!#!#:3### # # # ##   ! ! ++! #       4                     Wide character (U+%lX) in %sInfinite recursion in regexREGMARK%lx %d regexp memory corruptioncorrupted regexp pointersREGERRORpanic: unknown regstclass %dcorrupted regexp programpanic: stack_grow() negative count (%ld)Out of memory during stack extendpanic: savestack overflows I32_MAXpanic: pad offset %lu out of range (%p-%p)panic: save_alloc elems %lu out of range (%ld-%ld)panic: corrupt saved stack index %ldpanic: leave_scope inconsistency %uCan't call destructor for 0x%p in global destruction `x``8`@ @ h@h0PPPPX(PPpP8Pp `sv_vcatpvfnpanic: del_backref, svp=0Can't unweaken a nonreferenceReference is not weakNot a subroutine referenceBad filehandle: %2pBad filehandle: %-p$_$.length(${$/} in sv.c%.*gVSTRINGLVALUEOBJECTGLOBCan't upgrade %s (%lu) to %luArgument "%s" isn't numericCan't weaken a nonreferenceReference is already weaksv_len_utf8utf8_mg_pos_cache_updatesv_pos_u2b_cachesv_pos_b2uWide characterAttempt to bless into a classcat_decodeBizarre copy of %s in %sBizarre copy of %sCannot copy to %s in %sCannot copy to %sWide character in $/sv_vcatpvfn()BbDdiOouUXxCannot printf %g with '%c'panic: frexp: %Lg%c%+d"%\%03oend of stringMissing argument in %sRedundant argument in %s%2p::%2p{%s}[%ld]within Integer overflow in format string for %sHexadecimal float: internal error (entry)Hexadecimal float: internal error (overflow)panic: %s cache %lu real %lu for %-ppanic: del_backref, *svp=%p phase=%s refcnt=%lupanic: del_backref, *svp=%p, sv=%pDESTROY created new reference to dead object '%2p'Attempt to free unreferenced scalar: SV 0x%lxUndefined value assigned to typeglobsemi-panic: attempt to dup freed stringsv_upgrade from type %d down to type %dpanic: attempt to undefine a freed scalar %ppanic: sv_chop ptr=%p, start=%p, end=%pDon't know how to handle magic of type \%opanic: sv_setpvn_fresh called with negative strlen %ldArgument "%s" isn't numeric in %spanic: sv_pos_b2u: bad byte offset, blen=%lu, byte=%lupanic: sv_setpvn called with negative strlen %ldCan't bless non-reference valueCan't bless an object referencepanic: reference miscount on nsv in sv_replace() (%lu != 1)Invalid argument to sv_cat_decodeCan't coerce %s to integer in %sCan't coerce %s to number in %sLost precision when incrementing %f by 1Argument "%s" treated as 0 in increment (++)Lost precision when decrementing %f by 1panic: attempt to copy value %-p to a freed scalar %ppanic: attempt to copy freed scalar %p to %pCan't coerce %s to string in %spanic: sv_insert, midend=%p, bigend=%pCannot yet reorder sv_vcatpvfn() arguments from va_listinternal %%p might conflict with future printf extensionsvector argument not supported with alpha versionsNumeric format result too largeMissing argument for %%n in %sInvalid conversion in %sprintf: panic: magic_killbackrefs (freed backref AV/SV)panic: magic_killbackrefs (flags=%lx)0 | p d X L @ 4 (    $$$$$T_3|66\744D6d43d4d4pL(J(JULLL(J(JM(J(J(J(J(J(J(J(J(J(J(J(J(J(J(JXM(JXM(JXMXM(JxJ(J(JfKfK(JEP(J\K(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(JCQ(J(J(J(J(J(J(J(J(J(J(J(J(J(J(JLyPPTN(J(J(J(J(J(J(J(J(JvQLN(J(JQ(J(J(J(J(J(J(J(J(J(J(JOO(J(J(J(J(J(J(J(J(J(J(JMM(J(J(J(J(J(J(J(JhI(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(JhI(J(J(J(J(J(J(J(J(J(J(J(JT(J(J(J(J(J(J(J(J(J(J(J(J(J(J(J(JOOOGGEuLEGEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEXFEEEEEEEEEEEEEEEEEEEEEEEXFEEEEEEEEEEEEsMXFEEEEEEEEEEEEEE0HLMP?JEEXFEEXFEEEM0H?JEEMXFEEEEEEEEXFEIKIKEXFEEEEEEEEEIIEEEEEEEEEEEEEEXFEEEEEEEEEEEEEEEEEEEEEBBF4FlElEBBlFLLLLLMLM`K\K\K`KMM|d|d|d|dd|d|d|dde$ee|eLe\edlefhPhfhfff;khh0g0g0g0g0g0g0g0g0f0f0g0g0g0fDNDNNNNNN,, !!**--*&*& ZZZZ""YY""YY. . x)x). . . . 00. . k'k'&&$$e$e$,,. . ##((xx((010100//""{{NN////v.v.NN{{!! 3 }1 713 OOO3 { { < < < < < < < < { { < < < < < 55uu< < < < < < < <         210|/3p.<8T7686:599N9Use of (?[ ]) for non-UTF-8 locale is wrong. Assuming a UTF-8 localeUse of \b{} or \B{} for non-UTF-8 locale is wrong. Assuming a UTF-8 locale                                    &   ++++++ #0000700000000000000000@000000@0000000I000@00R000000000++++++                                                                                                                                                                                                                                                NNNNNNNN;;;;;;;-;-;;;N-----------888mmYY ; 0000000000000000..............||||||||||||||BBBBBBBBBBBBXXXXXXXMMMMMMMMMMMgg)))))''''''''''''''''''p6HHHdddddPPPPPkkkkH; OOOq)) jN-N-N-NN-;;;N----------------;NNN;-NNNN*N)))'''''''''#SNNNNNN EE???gg^'''''NN-N^^N888888;;NNRRRRRRR--;Ttt+vww~~}}%QQQNNN::hh777UUa```FFFFFFFFyuZZZ==<<zsss55(((x{&AAVIIfffffJJ,,,,,,,,,,,,,,,,llccdg"!!!!!!!!jjj [[[\\\\\\\//////WDDDS$$1eee K]bbbnGGGn#####;;;;;;-NN*****ooooirr''''__;0P0000P000 P0f000000P00000000f Pf 00000@ 000 0 f 0a0000 00000000Щ0f 0P00 pm00@F00000f 0f 000P00000P`jf 0 P0@0P000000000f 0Pk00000000Ш000 00 000@0 j0f `P 000 0 0`        Z{QRRRm?ENg ".0AIJVc ".0AIJVc ".0ABIJVcj ".0ABIJVXcj23@LN@C9@239@CL9@C 23@L 2349@CL 2349@CLSd 2349@CLd 2349@CL 2349@CLd 2349@CLd23@L23@Ls)AUszN ,N-as)*TszNdN ,B , ,BXj| j BX| ,B ,Bd64L)*NgBj,.I0f  "AV ",./01BJPVX\jr| ",./0BJVX\jr| ,.0BNX| ,.0BNX|55YZ{(5m(5m)*N*v-NN}+NNN#N#@CNN-NvN'NNNN}#NN#+-8Nv#8Nv-Nv%*+@CN+-N}*NN-N}-Nv 3NNS 3N  NS#%)*+-/23@LNUVv                                                                                                                               SWX[\cKSUW\]_`pq12457:;=>?BCDEFGHIY\< = M N R S < = M N < = M N < = M N U W ; = M N 8;HL56789:qstuz~789;459:;<`a45DElm78 --*00000,-ĨŨ+.ST'.  9 ; ? @   FHKLMQFGpq35st57;=MNBCFG?@+,9;=?CD45GH?@BCDFAC/a0ajjooejms{JK A[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123:;<=>?ABCDEFGHIJKLMNOpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp&!'!*!+!,!2!3!`!p!!!$$,0,`,a,b,c,d,e,g,h,i,j,k,l,m,n,o,p,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}~§çħŧƧǧȧɧʧ˧̧ͧЧѧ֧קا٧ڧۧܧݧ!;(p{|  P f @n`n"A[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123:;<=>?ABCDEFGHIJKLMNOEFpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNPQRSTUVWYZ[\]^_`hp&!'!*!+!,!2!3!`!p!!!$$,0,`,a,b,c,d,e,g,h,i,j,k,l,m,n,o,p,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}~§çħŧƧǧȧɧʧ˧̧ͧЧѧ֧קا٧ڧۧܧݧp!;(p{|  P f @n`n"HANGUL SYLLABLE Insecure user-deReference to nonInvalid referencCode point too l%s[%lu] 0x%04lX .. INFTY %s[%lu] 0x%04lX .. 0x%04lX %s[%lu] 0x%04lX panic: attempting to append to an inversion list, but wasn't at the end of the list, final = %lu, start = %lu, match = %cpanic: Incorrect version for previously generated inversion list%sCan't dump inversion list because is in middle of iterating Quantifier unexpected on zero-length expression in regex m/%d%lu%4p/panic: unexpected varying REx opcode %dLookbehind longer than %lu not implemented in regex m/%d%lu%4p%s/Variable length %s lookbehind with capturing is experimental in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic: %s regnode should be resolved before optimization'  m O        \     |           $ h - w w T6   { x{ { { { { { { { D&{ { "{ " j    m 8 D @||||||||,||||| x Q Q Q Q Q Q Q  Q Q Q Q Q Q Q J Q Q Q Q Q Q Q Q Q Q  Q Q Q Q Q Q Q Q Q Q Q Q Q :f7LLLLLLLLLLLLLLLLLLLLLL7>=}9LLL=LLLLf7~PTrLrLrLrLrLrLrLrLOOPfOfO{NO{NOvN&PvNOhPgggPPPPPPPPM`0`PP_P_yPPPPyPPPvvPPPPPahPPPPPPPPPPPGh_uuufuuuuuuuuu,u uuututp_pfffpppppppppp_pp^p^ _-x xww-x-x-x-x-x-x-x-xwow-x-xNw-xNwEs!O!O!O!Os!O!O!Orq!O!O!O!O!O~q!O!O!O!O!O!O!O!O!O!O!OpzNNNNYzNNNQyyNNNNNzpositivenegativeE_TRIE_MAXBUFregcomp_study.cpanic! In trie construction, unknown node type %u %serror creating/fetching widecharmap entry for 0x%lXpanic! In trie construction, no char mapping for %ldĉ݈݈݈݈݈݈݈݈݈C!݈݈݈X‰‰‰‰0‰‰‰ѬH‰‰‰‰‰‰‰‰‰‰‰‰‰‰‰‰pN,Ԥܥ٣v٣٣٣٣٣٣٣٣*٣٣^٣^fD ̦̳ΤΤΤΤΤΤΤtΤΤΤΤΤrΤΤΤΤΤΤΤΤΤΤΤԴLLLLLLLhLLLLL'panic: paren_elems_to_push, %i < 0, maxopenparen: %i parenfloor: %ipanic: paren_elems_to_push offset %lu out of range (%lu-%ld)Malformed UTF-8 character (fatal)panic: isFOO_lc() has an unexpected character class '%d'Matched non-Unicode code point 0x%04lX against Unicode property; may not be portablepanic: regrepeat() called with unrecognized node type %d='%s'Pattern subroutine nesting without pos change exceeded limit in regexEVAL without pos change exceeded limit in regexpanic: Unknown flags %d in named_buff_iterpanic: Unknown flags %d in named_buff_scalarpanic: Unknown flags %d in named_buffX0Ppb !]vvˑqotduqquuLnLnԚęz*ܝA߬XԐU%GƎVׇٍɇua܅xuuaupu.q/ q6uuuuzuԂkKluvuvual0}l|m{pzyu>x~uu}rur,x{wuruVwu=wm ln%;Eh%v\xx((xx\]^_`bcefgqv{WX        8 ; ? @ P X      9 @ $ ( 0 : @ J i n o FQ8FGINRfpqsuv'56@DEGstuv,8:;=>?AB )*1245:;=>EGIKMNPQWX]^`bdfmpu5GKOPZ\^_0ACPZ`m,0:<?,;   0679;>?@ABDGPZ 3:;?@AEFGHQ\ /78@AFPZpqr17:;<>?FGHPZ4;>BCEPZ[ p$u$X2[2^22222222y3z3|3/404748494<4=4>4?4@4A4G4V4EEEaa0a:a`jjjnjpjjjjjj0k7k:kDkEkPkZknmpmzmnnOoPoQooooooooop֌ #23PSUVdhp.0GejmBEW`w7;muv"#%&+07@JDKPZ^`,0 /0lr~/02;<@IPR`f!-67}~?@ABDFQfy|}%2>FJKOPhtvz{EHKPvy|tw{ HPZ`   &'0:;<?FGwxT`np} ?aklst{      !"#$%&'()*+,-./0345678:;<=>?@ABCDEFGHIKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      #$%&'()*+,-./01234<=?ABCGHIJKLMNOPQRSTUVXYZ[\]`abcdefghijklmopqrsuv}~qrstwx{~02345>?ABCJKP`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0ayz}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FQRSTUVWX`hprvxz|~N!O!p!!!!$$0,`,a,b,e,f,g,h,i,j,k,l,m,s,t,v,w,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./03456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopz{|}§çħȧɧʧ˧ͧΧѧҧקا٧ڧۧܧSTA[(P  p  `nn"D}  pK`pq0K$%().Y\   : ; < = > A I M N P Q X ` b d x    < = > A C G I K N Q R p r u v     ) * 1 2 4 5 : < = > @ A E G I K M N U X \ ^ _ ` b d q r     ) * : < = > A E F I J M N U W X [ b d    ; = > ? A E F I J M N O W X b d 1234;GO56789:>@q-1289;=?VXZ^aqu`]`25RTrt  #'),0239<UVWX_`abcems}4>BEkt$,468   ( / < = I J ` p "!#!9!:!!!!!##(#)#########$$%%%%%%%%&&&&&&&'''''''''!'"'(')'3'5'D'E'G'H'L'M'N'O'S'V'W'X'c'h'''''''''4)6)++++P+Q+U+V+,,---.*00010=0>0002222ost~ #%'(,-Ĩƨ&.GRST`})/1357CDLMN|}ª89TUpqĬŬ45PQlmܭݭ01LMhiخٮ,-HIdeԯկ ()DE`a|}аѰ $%@A\]xy̱ͱ !<=XYtuȲɲ89TUpqijų45PQlmܴݴ01LMhiصٵ,-HIdeԶն ()DE`a|}зѷ $%@A\]xy̸͸ !<=XYtuȹɹ89TUpqĺź45PQlmܻݻ01LMhiؼټ,-HIdeԽս ()DE`a|}оѾ $%@A\]xy̿Ϳ !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5EGst,/248>?AB;=>?@AEGIKMNWXbdfmpu58@BEFG^_03;=>?A "&',,/89;01679;?@ABCD 39:;?GHQWY\/078>?@17:;<>?FGH46;>@CZ[04@4A4G4V4a*a-a0ajj0k7kcmdmgmkmOoPoQoooooooo.0Gejms{BE7;muv"#%&+07DK /0lr~/02;<@I>FPt HPZ` ;<FG =EFGJMO      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FHNPXYZ[\]^_`hp~      $ % ( * / 0 9 ; < > E G J _ ` e f p q r }  !!!! ! !!!!!!!!!$!%!&!'!(!)!*!.!/!0!4!5!9!:!!@!E!F!J!N!O!`!p!!!!!!# #)#+#$$$['a'h'v''''')))))),0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-0-h-o-p---------------------.... .*.../.0.<.=.B.C.S.U.].0000000000 0!0*000106080=0A000000000110111111124MNФ  *,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnost~ "#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧΧЧѧҧӧԧէ֧קا٧ڧۧܧݧ #(,-@tvxƨΨШڨ &./0GT`}ȩʩϩЩک)7@CDLNPZ]`wz{~ªê۪ު  '(/0[\jpnp)*78=>?@BCEF>@P 0135EGIPRSTVXY_cdpuv  !;<=>A[\]^_abdef  '(;<>?NP^@u -KPv{(P(0dp{|7@V`h  679<=?V`w   :                6 8 ; ? @ V X ` }         6 @ V ` s    I      $ ( 0 : @ J P f i n o p  '(0FQUZp8GIfpqsuv'56@ADEGHPstvw,8:;=>?AB )*1245:;=>EGIKNPQWX]bdfmpu5GKMPZ^_b0ACDEPZ,0:<?@G,;   0679;?@ABDEFGPZ 3:;?BDGHPQ\  /78@ACPZr  17:;<>?FGHPZ`fgij4;>CEPZ[ #$o$$D%//004@4A4G4V4`4CDGFaa0a:ah9j@j_j`jjjnjpjjjjjjjjjk0k7k9k@kDkEkPkZkckxk}kk@mmmnmpmzm@n`nnnnoKoOoPoQoooooooooooop֌ #23PSUVdhpkp}.0Gejms{BE4NUVh  8:;?@EFGJQRl"<Vp56OPVop7;muv  %+"#%&+0n-07>@JNO"DKLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjpvy:@ ^KP# 3   !"#$%&'()*+,-./0:<?@[\]^{|}~OP\cp~   K`jkmpq0K$%().Y\ : = > P Q X b d f p   < = > C G I K N Q R f p r u v   < = > E G I K N U X b d f p  < = > E F I J N U W b d f p w x  ; = > E F I J N W X b d f p y z 124;?@GOPZ\     *456789:;<=>@q+?@JLVZ^abegnqu`]`ab257RTrt   ,0<DFPU_`}4DEMNPZ\]akt}$8;@JPZ~                $ ' ( * / 0 8 9 : ; < = > D E F G I J V W X \ ] ` a f p } ~  !! ! !!!"!#!9!:!!!!!""""# # # # ###(#)#*#+#############$$%%%%%%%%%%%&&&&&&&&&&&& &0&8&9&<&H&T&h&i&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&''' ' '''''''''!'"'(')'3'5'D'E'G'H'L'M'N'O'S'V'W'X'['a'b'c'd'e'h'i'j'k'l'm'n'o'p'q'r's't'u'v'''''''''''''''''''''''4)6))))))))))))))))))))))))))))))))++++P+Q+U+V+,,,,,,,-p-q----...... . . . . .......... .!.".#.$.%.&.'.(.).*.../.0.2.3.5.:.<.?.@.B.C.K.L.M.N.P.S.U.V.W.X.Y.Z.[.\.].^.....///000000 0 0 0 0 00000000000000000 0*000105060;0=0>0?0@0A0B0C0D0E0F0G0H0I0J0c0d000000000000000000000000000000000000001101111111122 2H2P22222MNǤ  *ost~ #(,-89tvxƨΨШڨ &.0GT`}ǩʩΩϩЩکީ)7@CDLNPZ\]`{~ª89TUpqĬŬ45PQlmܭݭ01LMhiخٮ,-HIdeԯկ ()DE`a|}аѰ $%@A\]xy̱ͱ !<=XYtuȲɲ89TUpqijų45PQlmܴݴ01LMhiصٵ,-HIdeԶն ()DE`a|}зѷ $%@A\]xy̸͸ !<=XYtuȹɹ89TUpqĺź45PQlmܻݻ01LMhiؼټ,-HIdeԽս ()DE`a|}оѾ $%@A\]xy̿Ϳ !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm)*78=>?@BCEFP>?@ !"#$%&()*+,-/056789:;<=>?@ABCDEGHIPQRSTVXYZ[\]^_ghijkl  ;<=>[ 035MPQRSTUVpuv !;?@A[f  '(;<>?NP^@u -KPv{(0dp{|7@V`h  679<=?V`w   :                6 8 ; ? @ ` }         6 @ V ` s    I      $ ( 0 : @ J f i n o  '(0FQp8Gfpqsuv'56@DEGHPstvw,8>?AB )*1245:;=>EGIKNPQWX]bdfmpu5GKPZ^_b0ADEPZ,0:,;   0679;?@ABDPZ 3:;?GHPQ\  /78@APZr  17:;<>?FGHPZ`fgij4;>CPZ[ #$o$$D%//004@4A4G4V4`4CDGFaa0a:ah9j@j_j`jjjpjjjjjjjjk0k7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoPoQoooooooooooo #UVdhkp}.0Gejms{BEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-07>@JNODKLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0JPjlpr~/02;<@I>FPt HPZ` ;<FG PA[a{      !#$%&-./012BCEFXY^_cptvxz~01WY   @AKV`jpqKMP.0?@\^_`kp Q R S U d e f p       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f p w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?@\HImq@JIJNPWXYZ^`[]} 57@T`mnqrt y ,0<@ADPnpu _`}MN8;JMP&+,]bfkxy FHNPXYZ[\]^_~  / 0 O P Z [ ] ^ e f q r t  !&!'!*!,!2!3!N!O!`!!!!*$@$K$`$()t+v+++,`,,,,-&-'-(---.-0-h-o-q---------------------...0.1.2.<.=.A.B.C.D.^.....///0000000 0 00000 0!0*0.00010607080<0>0@0A000000000110111111111122 2H2`222222223X3q3{33334MNǤФ,@op"ΧЧҧӧԧէݧ-03689:@xƨΨڨ./0T_`}ΩϩЩکީ7@NPZ\`ê۪  '(/0[\efjlpnp78=>?@BCEFP>@ .0EGSTghlpuv!;A[afpq  '(;<>?NP^47@$-0KP{P(0dop{|7@V`h  679<=?@VW`    : ? @                6 8 ; ? I P Y `          6 9 @ V X ` s x        I       ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;=EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[ #$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjpjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOooooooooooop֌  #23PSUVdhpkp}.0GP')gj{FW`ryUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#    !"#'*,./0:<?@A[\]^a{|}~      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOpqrstuvwxz~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./01WYZ]^`  K`jkmnpq0KM$%().789:=?@Y\`kp : = > P Q X b d f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f p r u v       ) * 1 2 4 5 : < = > E G I K N U X \ ^ _ b d f p q r     ) * : < = > E F I J N U W X [ ] ^ ` b d f p     ; = > E F I J N O T W X _ b d f p z 124;@GOPZ *56789:>@HImq+?@JLPVZ^abegnquIJNPWXYZ^`[]`bcgimno257@RT`mnqrt    y ,0<DFPnpu U_`}4EMNPZ\^`kt}$8;=@JMPZ~,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./03456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopz{|}§çħȧɧʧ˧ͧΧѧҧקا٧ڧۧܧSTpA[(P  p  `nn"DUa{      !"#$%&'()*+,-./012345678:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      #$%&'()*+,-./01234<=?ABCGHIJKLMNOPQRSTUVXYZ[\]`abcdefghijklmopqrsuv}~EFqrstwx{~0P`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0ayz}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPQRSTUVWX`hprvxz|~N!O!p!!!!$$0,`,a,b,e,f,g,h,i,j,k,l,m,s,t,v,w,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./03456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopz{|}§çħȧɧʧ˧ͧΧѧҧקا٧ڧۧܧSTpA[(P  p  `nn"D+A[      !"#$%&'()*+,-./2345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123:;<=>?ABCDEFGHIJKLMNOEFpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp&!'!*!+!,!2!3!`!p!!!$$,0,`,a,b,c,d,e,g,h,i,j,k,l,m,n,o,p,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}~§çħŧƧǧȧɧʧ˧̧ͧЧѧ֧קا٧ڧۧܧݧp!;(p{|  P f @n`n"  !"#'(,-./0:;<A[_`a{puvxz~01WY]^_`  K`jklmnpq0KM$%().@Y\`kp : = > P Q X b d f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f p r u v       ) * 1 2 4 5 : < = > E G I K N U X \ ^ _ b d f p q r     ) * : < = > E F I J N U W X [ ] ^ ` b d f p     ; = > E F I J N O T W X _ b d f p z 124;GOPZ *56789:>@HImq+?@JVZ^abegnquIJNPWXYZ^`[]`mo25@RT`mnqrt  y ,0<FPU_`}4EMPZkt$8@JMPZ~ FHNPXYZ[\]^_~     $ % ' ( * / 0 < = ? A D E I J T U _ ` e f p q r  !!!! !!!!!!"!#!$!%!&!'!(!)!*!.!/!9!:!0000000110111111122222223X3Ф  *,@ost~ΧЧҧӧԧէݧ #(,-@tƨШڨ &.0GT`}ϩЩک)7@CDLNPZ{~ª  '(/0jp)*78=>?@BCEFP>P      !"#$%&'()*+,-./0`,kxy      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPX`hp~ ! !!!!!/!0!4!5!9!:!!F!J!N!O!!!0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqyz{|}§çħȧɧʧ˧ͧΧѧҧӧԧէ֧קا٧ڧۧܧ0[`ipA[(P  p  `nn4NUVh8Rl"<Vp6OPVp  %+"D#A[a{ptvx{~01W`,kxy FHNPXYZ[\]^_~!!!! !!!!!!$!%!&!'!(!)!*!.!/!5!9!:! C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# a{      !"#$%&'()*+,-./012345678:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      #$%&'()*+,-./01234<=?ABCGHIJKLMNOPQRSTUVXYZ[\]`abcdefghijklmopqrsuv}~EFqrstwx{~0P`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0ayz}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPQRSTUVWX`hprvxz|~N!O!p!!!!$$0,`,a,b,e,f,g,h,i,j,k,l,m,s,t,v,w,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, I      ( J f i j o  '(0FpFqv3DHPsvw578>B )*1245:=EGIKMPQWX]dBCFGK_b?@ADE+@G9   679;=?C35?P  78?@Ar  7:;<>?BCDFH`fgij;>A #$o$$D%//004A4G4`4CDGFa/ah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoOoooooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+"#%&+0n-7>NODGHKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjp:@ ^KP#E0:A[a{EFcuvxz~01WYZ` XYjn@M-@Y`kp< = M N Q U d f p q       ) * 1 2 4 5 7 8 : > C G I K M Q R Y ] ^ _ f v       ) * 1 2 4 5 : = E G I K M V X \ ^ _ d f p q r    ) * : = E F I J M U W X [ ] ^ ` d f p    ; = E F I J M N O T X _ d f p z ;@GMNPZ *@HImq789;JPIJNPWXYZ^`[mo4@T`mnqrt y ,09Fnpu _au45DEMPZ7@JM~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF>Ppuv!;A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 ` }        6 @ V ` s    I      ( 0 : @ f i j o  '(0FpFfpqv36@DHPsvw578>B )*1245:=EGIKMPQWX]dBCFGKPZ_b?@ADEPZ+0:@G9   679;=?CPZ35?P  78?@APZr  7:;<>?BCDFHPZ`fgij;>APZ #$o$$D%//004A4G4`4CDGFa/a0a:ah9j@j_j`jjjpjjjjjjk0k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+"#%&+0n-7>@JNODGHKLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjp:@ ^KP# ( * A[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp!!!! !!!!!!!!$!%!&!'!(!)!*!.!0!4!>!@!E!F!!!,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧ!;(p{|  P f @n`n4Nh  8:;?@EFGJQl"<Vp5Vo"0:AGag 0:A[_`a{A[  ! !0:A[a{ a{!0:  !A[a{0:A[a{-a{      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOqrstwx{~0`abcdefghijklmnopqrstuvwxyz{|}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# Ga{      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOEFqrstwxz~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0`      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPX`hp~q r  ! !!!!!/!0!4!5!9!:!!F!J!N!O!p!!!!$$0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧΧѧҧӧԧէ֧קا٧ڧۧܧ0[\jpA[(P  p  `nn4NUVh8Rl"<Vp6OPVp  %+0n"D!xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ ( * / 0 _ ` e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///00@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# 0:`jf p f p f p f p f p PZ *@JFPPZ@JPZ *Шڨ ЩکPZ0 : @ J fp6@PZPZ0:PZPZPZPZ0a:a`jjjjjPkZkpmzm@JPZ  ! / 0 _ ` 00A[a{EFcuvxz~01WYZ` XY`n@M-@Y`kp< = M N Q U d q       ) * 1 2 4 5 7 8 : > C G I K M Q R Y ] ^ _ p v       ) * 1 2 4 5 : = E G I K M V X \ ^ _ d q r    ) * : = E F I J M U W X [ ] ^ ` d    ; = E F I J M N O T X _ d z ;@GMN@HImq789;@PIJNPWXYZ^`[mo4@T`mnqrt y ,09Pnpu _au45DEM7MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF>Ppuv!;A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 ` }        6 @ V ` s     ? A T U q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF>P 035MPpuv!;?@A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QpGfv56@DHPtvw8>B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:@G;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}.0Gejms{BEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjp:@ ^KP#!A[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp!!!! !!!!!!!!$!%!&!'!(!)!*!.!0!4!>!@!E!F!`!p!!!$$,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧ!;(p{|  P f @n`n4Nh  8:;?@EFGJQl"<Vp5Vo"0JPjp  ! ( * / 0 _ ` 00!0:A[a{~Z`    jn0?^_d f p q v w w x OPZ\:>JP`ino57 DF NPZa};@~ ( 0 D E R S _ }  # #)#+#h'v''''')))))),,,-p-q-./.0.P.R.^.00000 00010=0>00000 st~txΨШ.0_`Ωީ\`ު>@0STbcdhijl !;>?@[\]^_fopWX  ? @ P Y     9 @   n o UZGN@Dtv8>KPZ\]^AD`m<?;<DG?G AFprCP p$u$//njpjjj7k C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ ( * e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#;01IJPQRSTUVWI !(*-.0:A[_`a{uvx{~01WYZ` jnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789:>HImqJPIJNPWXYZ^`[]`mo5@T`mnqrt  y ,0<Fnpu _`}MPZkt8@JM~ FHNPXYZ[\]^_~  ? A T U q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF^d>P 035MPqrstwxyz{|}~!;?@A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QpGfv56@DHPtvw8>B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:@G;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}.0Gejms{BEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#WA[a{puvx{~01WYZ` Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 123@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF^d>Pqrstwxyz{|}~!;A[f  '(;<>?NP^ -ABJPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#A[a{1289!"4:UVXYZ[]`bcghmopqsuv}~     12BCEFptvx{~01Wayz}~ FHNPXYZ[\]^_~&!'!*!,!2!3!N!O!`!!!!$$,q,r,t,u,w,~,,,,,,-&-'-(---.-@n"02pyΧЧҧ֧ݧSTp!;A[Pp{|    P f p  @nnD 0:AGag!'AG90:A[_`a{uvxz~01WYZ` jnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789:>HImqJPIJNPWXYZ^`[]`mo5@T`mnqrt  y ,0<Fnpu _`}MPZkt8@JM~ FHNPXYZ[\]^_~PWXYZ^` GH[a}w x/ 0 H N 9!;!!!!!##{#|#}##%$'$%%&&p&r&()....////80;0>0?0114M¤ŤƤǤ ;HIjq  _NP'$*$11˧Χڧݧ@ f i    Z[`4Ca:a@mzm/011^A ?B ;>Z/40494V423UV%+0ntw{ux9:P#p< = ] ^  LM} /,0,_,`,S.^.§Чҧӧԧէڧ@Pp{|ppv@G//pjjjj#.0GPyz{}ަ59wU V   ++P.S.11MMǧ˧,-hlGHZ[`b   679;GPZoooo֌  mp  rswytuצަK23yw x +++,O.P.§ǧfh_` 0494EoKoOoPoooooPSdh-0>@JNPKL>lm ?@qr{|Tptx{w`a v w   xy++++++J.O./1014 6 H I  ( 0 : (0ZDG;<^_<`fgij@nnryq/0MPlqswz{|`nQ`k  ; =  #$++E.J..1/1֟-0HP  7:;<>?HPZoop`f  (013LM_l@ @AO P A.B.LPZ^`N0:A[_`a{OP_a  ? A T U p !`$%v'',..000!00010d1e1>@EGs{02IJxy*!,!02IJxy*!,!Oabfghklmnosuwxyz     12BCefklmntuvw~ (`hpqtu|}]A[_`a{puvx{~01WYZ` Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 123@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF^d>Pqrstwxyz{|}~!;A[f  '(;<>?NP^@u -KPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$o$$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#C0:A[_`a{uvx{~01WYZ` jnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789:>HImqJPIJNPWXYZ^`[]`mo5@T`mnqrt  y ,0<Fnpu _`}MPZkt8@JM~ FHNPXYZ[\]^_~  ? A T U q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF^d>P 035MPqrstwxyz{|}~!;?@A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QpGfv56@DHPtvw8>B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:@G;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}.0Gejms{BEUV  :;?@EFGJQR56OPop ,,---.*0.000ost~ %',-Ĩƨ&.GR)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/24568>?AB;=@Afmpu8@BEFG^_3;=>?A "&',/89;;=>?CD  39;?GHQWY\078>17:;<>?FGH6;@ABCZ[@4A4G4V4a*a-a0ajj0k7kOoPooooo.0Ggj{BE7;muv"#%&+07DK- . f g * + A[a{ptv~ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d x   ; = A E M N b d 124;?@GO56789>q-1289;=?XZ^aqu]`24RTrt #')239<@ADFVWX_`abcems}456;<=BCkt,468   q t  !!!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?AB;=@Afmpu8@BEFG^_3;=>?A`m "&',/89;;=>?CD  39;?GHQWY\078>17:;<>?FGH6;@ABCZ[@4A4G4V4a*a-a0ajj0k7kOoPooooooo.0GgjsFW56OPop7;muv"#%&+07,0/0jp`fw{ HPZ`T`np} h i 1#&  jk ?@0 5 .!/!""8:_`ik+,-.z | "")*bd 0:p q t z $$ ,-.0:;  / 0 D E PQRSUV @   ` f j p s{   ) * `jkm0 : @ J `;    Kmpq0K`P>Pp $ ( 0 : @ 0FQppPjjjjh@jh9jMN 0.2. 6 9 @ !"  1WY@VW`PpPp oPp O P A.B.Ppuv` !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~@PP,0G 12^_0dopi O P T W X _ v y ##C.E.Ũƨ>?Z[\]^`m  78FPmpoop"#%&+KPZ^`;<z{ (013?@LP_w Z [ _ `  !!++֟͟`dp.0             PQ,0@##$D%DGF-0~KPCE (0 x y  4 5    ##''M+P+Z+t+v++++++++<.C.|0`df'. P{(0dop7@V`h`            Pw> )*1245:<EGIKNWX]dfmpuEPZo##c$o$t$u$@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kkkp}  !-67}~?@AB>@DKhz{ACP HPZ`f j   '''',,'-(---.-f-h-2.<.̟͟t|.0    56DoEoPoooo !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~jl@D &(,-.045&( !_`@\^_: < O P V X s x r x ) * : ; N O ]_ ##&&&&&&'' ' '(')'L'M'N'O'S'V'_'a'''''''''p-q---11`b  '(/NRph9j012=>?@BCFGJOWX_`jpyz{}2;PR!067}?@AB>Ph &(,-.045AEPt@$&.0?  N O U V y { Z_w _`} P!S!!!##&&&&&&&&&&&'W'X'U+Z+p,q,~,,,,1.2.D2P2ğ̟Ф0:`}Ωϩکީ`|ê۪kn@VW`  `   6 9 V X s x   I `0/4 /12=>?@BCFGJOWX_`yz{}2@I5ptvx$ ;@nq s Q R u v D E b d = > X Z b d x = > D E b d p v y km"#()+,36:@Z8;JMd e O!P!!!&&&&&&''''+ +$+M+P+U+m,p,q,t,x,~,-....1.-1.111ğ,@`bt| "ŨΨڨT_`7@NPZ\`$' : ? @ )*,0GBP{~{ } ~ LP} M!O!!!##&&''++ +$+`,m,t,x, "@x     o#$c$p$t$`r7BX]  Y_Pn} ~ GH GH_a lU W X _ ?NP^47@&(N  679<=?@Ww !OPcpnp  7@T`mnqrtG H N S W X _ d q r =!L!!""#|#}###$$%%%&&&r&~&&&h'v''''()+;0>000000112Q2`222¤ŤƤ0kEGst_aI $0K&(N'*UV  :;?@EFGJQRצ  "4FObc PQ]^SV-0K jk"#()+,36:@ZGHIJNDJV W uM N M N M N M N ; = M N :;9;45`aDE--,-ĨŨST? @ FGpq3556MNBC?@+,9:=?45GH?@DFAC/a0aU V 005< = < = < = < = 784578st67;=FG:;CDBCJKoopqRSQRPQOPNOMNLMKL 9:egns!#')tursz~qrHL8:49 9 : jjgjOPpK`pq0K$%().Y\ < = M N Q U < = M N < = M N < = M N U W ; = M N 8;HL56789:qstuz~789;]`459<`au}45DEkt78 ,,---.*00000opt~,-ĨŨ+.STª 0v{    8 ; ? @   $ ( i n FQFGpq35st57;=MNfmpuBCFG^_?@+,9;=?CD45GH?@BCDFAC/a0ajj0k7kooejms{BE"#%&+07DK Z [ ] ^ 1.2.  @J56H xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~  * / ` p r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')s{FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#57@T ϩЩ()NRv()[\{|:;<=E F } ~ # # # #)#*#h'i'j'k'l'm'n'o'p'q'r's't'u'''''''''''''))))))))))))))))))))))))))))".#.$.%.&.'.(.).U.V.W.X.Y.Z.[.\.0 0 0 0 0 0000000000000YZ[\]^ ;<[\_`bc=(*[\]^{|}~:>E G }  # #)#+#h'v'''''))))))".*.U.].0000Y_ ;<=>[\]^_abd)*]^}~;<=>F G ~  # # # #*#+#i'j'k'l'm'n'o'p'q'r's't'u'v'''''''''''''))))))))))))))))))))))))))))#.$.%.&.'.(.).*.V.W.X.Y.Z.[.\.]. 0 0 0 0 00000000000000Z[\]^_ =>]^`acd%%1100000 0*0.0001070800010111EGaf%%(*<=>?[\]^{|}~:>9 ; E G }  @!A!"""""""""""#"$"%"&"'"+"4"9":";"M"R"V"_"a"b"c"d"l"m"""""""""""""""""""## # #"#)#+#h'v''''''''''''''')))))))))))))))))))))))))))) ***"*$*%*&*'*)***+*/*4*6*<*?*W*Y*d*f*j*n*o*q*s*u*y********************++.. . . .... .*.U.].0000Y_df ;<=>[\]^_abdOP   * / f j   78FPm7Q S d f  ! ( ) _ ` 00  . / g h + , S$%().Y\`  )*P        8 ; ? @   9 @  J i o `0pDKpPi j , - !#&+;A[a{tv~ x  :> @ADF ( 5 D E _ |  !!!!! !!!!!!$!%!&!'!(!)!*!:!P0PQRTUV_`bdghikl !;A[f@  9 @ n o Rf`mooBEFW56OPop,0 /0jp`fw{ HPZ`T`np}pK`pq0K$%().Y\ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d  ; = A E M N b d 124;GO56789:q-1289;=?XZ^aqu]`24RTrt  #')239<VWX_`abcems}456;<=BCkt,468NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp&!'!*!,!2!3!`!p!!!$$,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧp!;(p{|  P f @n`n" $$47@  679<=?@//`tv,,,-..$@$@BCEtu~X ` 3 4 6 7 Y \ ^ _ \ ^ CDMNRSWX\]ijstuwxyqrstuvwxyz{|}~  &!'!*!,!)#+#** !"#%'*np *78=>?@BCEFO^e011xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# 0@011./`P#P @ @4M 0P34N'(./:;^_`aptvz{YZ_`@AK`pq0K.Y\ : ; < = A I M N Q X b d q r   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d  ; = A E M N b d 124;FO56789:q-1289;=?XZ^aqu]`24RTrt CD #')239<VWX_`abcems}456;<=BCkt,468x~,kxy    $ % ' ( * / ` e f p q r  |,~,,,o-p----./.0.00*0.01060;0<00000 ost~"pq %',-Ĩƨ&.GRϩЩ)/1357CDLMpq|}ªݪު[`il 0RSUV>?@Apqv{      8 ; ? @   $ ( N O i n o p FQ8Gpqsu',-5st/24568>?AB;=@Afmpu8@BEFG^_3;=>?A "&',/89;;=>?CD 39;?GHQWY\078>?@17:;<>?FGH6;@ABCZ[04A4G4V4a*a-a0ajj0k7k@kDk@mCmkmmmOoPooooooo.0GgjsBE7;muv"#%&+0n0>DL pp  #%02p 7@NPZ\`+  * / ` e f p 04@4s{ CX ` 3 4 6 7 Y \ ^ _ \ ^ CDMNRSWX\]ijvwxy** *78=>?@BCEFO^emn.000EF \]_`bc]_`b 9:-0.0*0+0!#')49=GJMOSWY[UW\]_`12457:;=>?BCDEFGHIY\R S 5678;<lm +.'.  : ;   FHKLMQ{ XY,0-0 +0,0=EFGJMPSWX[\cpSUW\]_012457:;=>?BCDEFGHIK$%(). Q R S U ]`:;u}klmt ,,-.opt~ª '.0v{  8 9   $ ( i n HKLMfmpu^_0k7kBE"#%&+07EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./03456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopz{|}§çħȧɧʧ˧ͧΧѧҧקا٧ڧۧܧSTpA[(P  p  `nn"DA[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp&!'!*!,!2!3!`!p!!!$$,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧ!;(p{|  P f @n`n"A[      !"#$%&'()*+,-./0125679:;<=>?BCDEFGHIKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNO@BCFOPpqrstuvwz{~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1WuyX ` 3 4 6 7 Y \ ^ _ \ ^ 34  CDMNRSWX\]ijstuz_a ,/0;<NOkxy      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hpqrstuvwxyz{|}~      $ ' * 0 3 5 6 8 < = > ? G J W X _ r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!:!;!A!E!J!P!!!!!!,"."/"1")#+#`$$ * *t*w***,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,|,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,o-p-....//00607080;00000011111122 2H2P2224@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧ\`ijp !"#%'*np78=>?@BCEF>P0EGSTghlpstuv(p{|  P f @n`n^es{UV  :;?@EFGJQR0n" !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPRA[a{89!"4:UVXYZ[]`bcghmopqsuv}~EFptvx{~01Wayz}~ FHNPXYZ[\]^_~&!'!*!,!2!3!N!O!`!!!!$$,q,r,t,u,w,~,,,,,,-&-'-(---.-@n"02pyΧЧҧ֧ݧSTp!;A[Pp{|    P f p  @nnDA[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHIKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOEFpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMP!`!!!!! !!!!!!$!%!(!)!,!.!/!2!3!5!9!:! ? G J W X _ ` !!!!!! ! !!!!!"!5!9!;!@BCD FHNPXYZ[\]^_~  &!'!*!,!!!!!!!"" " " " "$"%"&"'"A"B"D"E"G"H"I"J"`"a"b"c"m"r"t"v"x"z""""""""""""")#+#**L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0e0f0g0h0i0j0p0r0s0u0v0x0y0{0|0~000000000000000000000000000000000000000000000000000 !"#%'*np *78=>?@BCEFO.0KM89!a)ahmkm^eP0d p 0:<''   679;GPZ !p^_`aOPX]ctvz{YZKSWY0K< = M N Q U q r < = M N < = M N U V < = M N ; = M N :;GMNO56789:>@789;cein]`459<`au}45DEkt68x~,k,,/.0.*0000000op|~",-ĨŨ+/ST{~ê[`il 0>?@Apq8 ; ? @   " ( N O i n FQFGpq35st57;=MNfmpuBCFG?@+,9;=?CD45GH?@BCDFACZ[G4V4/a0ajj0k7kkmmmoooo.0Ggjms{0n07DGHK#OP_a   * / ` p d1e1s{` S U  0: IJstwxyzj p )#+#1-.  S T { | ""....:.<.@.A.].^.0000100013XYcd n o %   0+,xy-.C.D.@.00n00@-.@a{      !"#$%&'()*+,-./012345678:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      #$%&'()*+,-./01234<=?ABCGHIJKLMNOUVXYZ[]`bcghmopqsuv}~EFqrstwx{~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0ayz}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPX`hp~N!O!p!!!!$$0,`,a,b,e,g,h,i,j,k,l,m,s,t,v,w,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./03456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopz{|}§çħȧɧʧ˧ͧΧѧҧקا٧ڧۧܧSTpA[(P  p  `nn"Da{      !"#$%&'()*+,-./012345678:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      #$%&'()*+,-./01234<=?ABCGHIJKLMNOUVXYZ[]`bcghmopqsuv}~EFqrstwx{~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0ayz}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPX`hp~N!O!p!!!!$$0,`,a,b,e,g,h,i,j,k,l,m,s,t,v,w,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCD$$%%%%%%%%&&&&&&&'''''''''!'"'(')'3'5'D'E'G'H'L'M'N'O'S'V'W'X'c'h'''''''''4)6)++++P+Q+U+V+0010=0>02222 /0lr~/02;<@I>FPt HPZ` ;<FGS@Aq r U V FG  CD67{|0010600000 ϩЩpqݪުpqN O j k o p 78]^BkDkoooo<>DG0--KIJNPWXYZ^`[]}------------------  '(/########%%&&H&T&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '(')'L'M'N'O'S'V'W'X'''''''++P+Q+U+V+/0278;PR!-67}~?@AB>KOPhz{P ;<FGp}23`$%P-#$*+0:< = I J "!#!9!:!!!!!##(#)#######$$%%%%%%%%&&&&&&&&&&&& &!&"&$&&&'&*&+&.&0&8&;&@&A&B&C&H&T&_&a&c&d&e&g&h&i&{&|&~&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&''''''''''''''''!'"'(')'3'5'D'E'G'H'L'M'N'O'S'V'W'X'c'e'''''''''4)6)++++P+Q+U+V+0010=0>02222pr~/02;PR"$>IOPhoqs{P ;<FGp}(`4D04`40V4`4C#$*+0:   Q&&&& ''BDFQfy|}tvz{EHKP   &'0:<?wx$P%`##)#+#######%%&&0&8&H&T&&&&&&&&&&&&&&&&&&&&&&&&&&&&&'' ' '(')'L'M'N'O'S'V'W'X'''''''++P+Q+U+V+....///00?0A00011011111112 2H2P2Ǥ`}0STghloooop֌ #23PSUVdhpW`w<@IPR`f!-67}~?@AB>KOPhz{P ;<FGp} ''))5 &(+,1489?CDEHLMNRTfhklQRabpPQR`        # $ ( 0 1 2 4 5 6 ; < > ? t u  !!!! ! !!!!!!!#!&!'!+!,!S!U![!_!`!l!p!z!!!!!!!!!!!!!""""" " " """"""""""!"#"$"%"&"'"-"."/"4"8"<">"H"I"L"M"R"S"`"b"d"h"j"l"n"p"""""""""""""####)#+#######`$$$L%P%t%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&& & &&&&&&&&&0&8&@&A&B&C&H&T&`&b&c&f&g&k&l&n&o&p&&&&&&&&&&&&&&&&&&&&''' ' '(')'='>'L'M'N'O'S'V'W'X'v''''''''''))++P+Q+U+Z+....///?0A00011011111112 2Ǥ`}0STghloooop֌ #23PSUVdhpW`w .0jp<@IPR`f!-67}~?@AB>KOPhz{P ;<FGp} a00ag&(+,1489?CDEHLMNRTfhklQRabpPQR        # $ ( 0 1 2 4 5 6 ; < > ? t u  !!!! ! !!!!!!!#!&!'!+!,!S!U![!_!`!l!p!z!!!!!!!!!!!!!""""" " " """"""""""!"#"$"%"&"'"-"."/"4"8"<">"H"I"L"M"R"S"`"b"d"h"j"l"n"p"""""""""""""##`$$$L%P%t%%%%%%%%%%%%%%%%%%%%%%%%%%%&& & &&&&&&&@&A&B&C&`&b&c&f&g&k&l&n&o&p&&&&&&&&&&&&&&&&&&&&&&&&'='>'v''V+Z+H2P2 .0jp   #%<.=.kp} 00010EGI?,/0;<NObxyp r t !!!"!#!},~,o-p-11pq\`ij0Qknjm bk |,},QkP2Q2222X3q33340P<PSTghl1&(1289ACJLRTfh &4@BCEtuz{~ 9:PRSTWX\_vx"'uy) * 1 2 4 5 X ` 3 4 6 7 Y \ ^ _ H I K M \ ^ H I J M 34  CDMNRSWX\]ijstuz&'     ;<=>@BCD,/0;<NOkxy FHNPXYZ[\]^_~     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!2!3!:!;!A!E!J!P!!!!!!!!!!"" " " " "$"%"&"'","."/"1"A"B"D"E"G"H"I"J"`"a"b"c"m"r"t"v"x"z""""""""""""")#+#`$$ * *t*w***|,~,o-p-....//00607080;0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0e0f0g0h0i0j0p0r0s0u0v0x0y0{0|0~000000000000000000000000000000000000000000000000000011111122 2H2P2224pq\`ij !"#%'*np78=>?@BCEF>P0EGSTghlpstuv.0KM89!a)ahmkm^eUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR24?AIJz{uy34  wxyz,/0;<NOkxy     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!(!)!,!.!/!2!3!:!;!A!E!J!P!!!!,"."/"1"`$$ * *t*w*|,~,o-p-....//00607080;00000011111122 2H2P2224pq\`ij *O>P0EGSTghlpstuvUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR       / 0 amUVYZ]^abefijmnqruvyz}~4<qrwxyz{|}~PQRSVWZ[^_bcfgjknorsvwz{~d=>pqrstuvwxyz{|}~TUXY\]`adehilmpqtuxy|}-4PQRXYZ\^`bcdefhiklmnpqrtwx}~oooooo.0Gejms{BE7;muv"#%&+07DK Y BCEFpxz~&+]bfk FHNPXYZ[\]^_~] ^ &!'!ef@F  pxz01WYK`pq0M$%()0?@Y^_`kp : ; < = A I M N Q X b d       ) * 1 2 4 5 7 8 : > A Y ] ^ _ f p r u v w       ) * 1 2 4 5 : = > @ A G I K M \ ^ _ b f x       ) * : = > A E X [ ] ^ ` b f p w     ; = > ? A F I J M N P T W X b f 124?GO\56789:HIm-1289;=?XZ^aquIJNPWXYZ^`[`}257@R`mnq  y#'),0239@ADnpuVWXabcems4>BEMNkt,46;JM FHNPXYZ[\]^_~  ( / ` p r t !!!*$@$K$`$t+v+++,,,,&-'-(---.-0-h-o-q-------------------.^.....///*000@0A00011011111112 2ǤФ,@ost~ΧЧҧӧԧէݧ %',0:@xĨΨڨ&.GRS_}Ωϩکީ)/135@CDLMNPZ\|}ªê۪  '(/0lpnp78=>?@BCEF0STghlpuv  '(;<>?NP^47$-KPv(0do{|7@V`h  679<=?VW  : ? @            6 @ I P Y `       6 9 V X s x       I      $ 0 : @ f n    `(0FQZp8GNRpqsuv',-6HPstw/248>?A )*1245:=>?@AEGIKMPQ]d8@BEFG\]^_b3;=>?AEPZ`m "&'0G/89;<   01679?CDGPZ 39;?GPQWY\   0>?@FPmp  1FGPZ`fgij6>@CZ#$o$p$u$$D%//004A4G4`4CDGFaa*a-a0a:ah9j@j_j`jjjnjjjjjjjjk0k7kFkPkZk[kbkckxk}kk@mzm@nnoKoPoooooop֌ #23PSUVdhpkp}P')ejmBEFW`yUV  :;?@EFGJQR7;muv%+0n-7>@JNPDKLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#3Q S d f   )*1245:;EGIKNPQWX]dfmpu  120Kd f   7:;<>?HPZd f `fgij0!Z [ ,`,C.D.op"#%&+-0-Z [ -&-'-(---.-1.2.%& pK`pq0K$%().Y\ : = > P Q X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J O W X b d 123;GO56789:>@q-89?VZ^aqu]`25RTrt  ,0<U_`abce}4Ekt$8  ( / ` p ,,---.*00000ost~ #(,-ƨ&.GT`})7CDLN|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu'5EGst,8>?AB;=>EGIKNWXbdfmpu5G^_0A ",,;0679;D 3?GHQ\/78@17:;<>?H4;>CZ[04A4G4V4a0ajj0k7kcmdmgmkmOoPoQoooooooo.0GejmBE7;muv"#%&+07DK `cmdmgmkm7  ; < > A I M N P   > A   @ A G I K M   A E   ? A F I J M 34>@12;=VX#'),0239UVWXms>B$,46#%'(ĨRS/135MN,-EG,/24?@AEGIKMbd58@BEF03;=>?&',/891679@ABC9:WY/0>?46>@*a-aQoo!N O ?@AB:;FG``}pK`pq0K$%().Y\ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = > @ A E M N U X b d    < = > A F I J N U W b d  ; = > ? A E M N W X b d 124;GO56789:q-1289;=?XZ^aqu]`25RTrt  #')239<VWX_`abcems}4>BEkt,468 ,,---.*00000ost~ %',-Ĩƨ&.GRST)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/248>?AB;=>?@AMNWXfmpu8@BEFG^_3;=>?A "&',/89;01;?CD 39;?GHQWY\078>?@17:;<>?FGH6;@CZ[@4A4G4V4a*a-a0ajj0k7kOoPooooooo.0Gejms{BE7;muv"#%&+07DK &     ( / ` p 04@4s{     @ f i    < = I J "!#!9!:!!!!!##(#)#########     ) * 4 5 : < E F I J N U W ] ^ ` b f p        ; = D F I J O T X ` b f p z 34;@OPZ   *5678>CDHIMNRSWX\]ijmqstuzJPIJNPWXYZ^`[]` FHNPXYZ[\]^_qrstuvwxyz{|}    ' ( '-(---.-------------------00A000000001.1/101114MN ˧Чҧӧԧէڧ`wz  '(/fh !"#%'*;=oo#23PSUVdh%+:@ ^KP#'(-/0;A[_`a{24?AIJ &4YZ #)-/02568:BCEFuv{~`*.01WYZa @AV`jpstuyPp N O Q V X ` d f p q x y       ) * 1 2 3 5 6 8 : < = > C G I K N \ ] f u       ) * 1 2 4 5 : < D G I K N U X _ b f p q r     ) * 4 5 : < E F I J N U W ] ^ ` b f p        ; = D F I J O T X ` b f p z 34;@OPZ   *5678>CDHIMNRSWX\]ijmqstuzJPIJNPWXYZ^`[]` FHNPXYZ[\]^_qrstuvwxyz{|}    ' ( '-(---.-------------------00A000000001.1/101114MN ˧Чҧӧԧէڧ`wz  '(/fh !"#%'*;=oo#23PSUVdh%+:@ ^KP#""""""56OPop%p q t  """"""56OPop30:A[_`a{uvxz~01WYZ` jnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789:>HImqJPIJNPWXYZ^`[]`irmo5@T`mnqrt  y ,0<Fnpu _`}MPZkt8@JM~ FHNPXYZ[\]^_~  ? A T U q r  !!!! !!!!!!$!%!&!'!(!)!*!:!?@BCEF>P 035MPpuv!;?@A[e  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QpGfv56@DHPtvw8>B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:@G;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}.0Gejms{BEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#-.  ..00cd efZ [ ] ^ 1.2.A.B.      ` `} -0>@JNP kFkPkZk[kbkckxk}kkDGF#00000 000607080<0>0A000000EGafpq 23PS 78=>?@BCEFP  7+00000 0.01070800011122`22`}EGafU....///000000 0!0.0001070@000111111 2H2222223X3q3{33334MNnpEGafoooo`rPR:@ ^KP# 0'Q S d f       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w 0:e f a:a#Q S d f 0:pK`pq0K$%().Y\ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = > @ A E M N U X b d    < = > A F I J N U W b d  ; = > ? A E M N W X b d 124;GO56789:q-1289;=?XZ^aqu]`25RTrt  #')239<VWX_`abcems}4>BEkt,468 ,,---.*00000ost~ %',-Ĩƨ&.GRST)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/248>?AB;=>?@AMNWXfmpu8@BEFG^_3;=>?A "&',/89;01;?CD 39;?GHQWY\078>?@17:;<>?FGH6;@CZ[@4A4G4V4a*a-a0ajj0k7kOoPo--------00A00000000001.1/101114MN ˧Чҧӧԧէڧ`wz  '(/fh !"#%'*;=oo#23PSUVdh%+:@ ^KP#wx|}ctvx`*.@AnpN O Q S x y  4 5 X Z     ; = _ ` _airV W X _ '!(!2!3!N!P!!!m,w,~,,-&--.*.0.1.3.5.6.9.:.00.000.1/112*,@op|"pq`}0[df@uooF  '(-/0;A[_`a{Z` jn0?^_d f p q v w p q r x w O P X _ p z ?@OPZ\   *56789:>JP`ir}mo57 @ADF NPZkt;@~     $ ( * 0 3 5 6 8 < = > A G J T U W X _ !!! !!!!!! !#!$!%!&!'!(!)!*!:!;!A!E!J!N!O!P!!!!,"."/"1")#+#*$@$K$$ * *t*w***t+v+++,,,,-p-q-.^......./0000!000107080=0@0111111H2P222MNǤ pt~ "(,0:txΨШ.0_`Ωީ\`wzު[\jl>PEG47@u $opW`w     ? @       @ I P Y }        9 @ X ` x        n o   `'QZGNRf@Dtv8>KPZ\]^AD`m:@;<DG?G AFZmprCP p$u$//04@4njpjjj7k@kDkFk[kbkmmpmnnooP')^jmBEFW`y7;muvOP^`q>,0 /0Pjm`fw{ HPZ`T`np}24?A@BCEtuz{~uyX ` 3 4 6 7 Y \ ^ _ \ ^ 34  CDMNRSWX\]ijstuwxy,/0;<NOkxyqrstuvwxyz{|}~     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!2!3!:!;!A!E!J!P!!!!,"."/"1"`$$ * *t*w***|,~,o-p-....//00607080;000000111d1e111122 2H2P2224pq\`ij !"#%'*np78=>?@BCEF>P0EGSTghlpstuv^eUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR  xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# KMP@\^_`k ,0<@ADnpu _`}MN8;JM0-h-p-q---ǤФ,-ƨΨڨ./0Ωϩکީ7@NPZ\`ê۪p ( 0 : 56H\]b`fgijh9joKoOoooo-0>@JNPLPZ^`'(-/:;uv      ' ( 0000.0?7@T`mnqrt  y ,`,,,,-0.1.<.=.@x0T_`  '(;<>?NP^47@$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I       @ f i    (0ZpNRvPwB )*1245:=EGIKNPQWX]dfmpuEPZ`m,0G<   679;GPZHP  78FPmp  7:;<>?HPZ;>[ #$o$p$u$$D%//0V4`4CDGFa:a@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoooop֌ pkp}"#%&+%OP_a   * / ` e f j d1e1s{ '(-/0;A[_`a{24?AIJ &4YZ #)-/02568:BCEFuv{~`*.01WYZa @AV`jpstuyPp N O Q V X ` d f p q x y       ) * 1 2 3 5 6 8 : < = > C G I K N \ ] f u       ) * 1 2 4 5 : < D G I K N U X _ b f p q r ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v++++++++++,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------J.....////0@0A00011/1111111112 223MMǤФ,@,0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0fpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$-KP{(0dop7@V`h  679<=?VW  : ? @              4 8 ; ? H P Y `       6 9 V X s x       I       `NRp56DPw? )*1245:<EGIKNPQWX]dfmpuZ[\]^EPZ`m,0@HP  78FPmp  7:;<>?HPZ #$o$p$u$$D%0/4DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kkoEoPooooooppkp}')FW`rUV  :;?@EFGJQR"#%&+KPZ^` !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp<@IPR`ft HPZ` ?@MPlצ5@   @PF`btvz{~ PQ]^1WY`a   !;@S`np   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\Z_ FHNPXYZ[\]^_~ / 0 G j q t !9!S!!!!""###{#$%$@$K$`$$%%%%&&&p&''' ' '(')'L'M'N'O'S'V'W'X'_'a'h'v''''''080?0@0A0000001-11111122 2D2`2|22222223w3{3333N.78=>?@BCEF@P $0EISTghlpstuv_a/0//////11KA[a{puvxz~01WYZ` Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 124@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!:!?@BCEF>Ppuv!;A[f  '(;<>?NP^@u -KPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$o$$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#op+00!0*080;04MNnpoop֌ p:@ ^KP# &7PSUVX[\cdhjrs !#234567XYV` U V Q R u v D E b d Z [ b d D E b d 9:T U !!++h,m,op|~˧ΧڧݧϩЩ`d.0@j_j`jjjOP47PYZ!)-/03478:@FOPXYc`a@KS U   kt,/0;<NOkxy? A !!.!/!!!$%()`,h,w,|,,,..!0001060;0=022MN"0hi>P 0EGst.0GP')^es{BEW0:A[_`a{24?AIJ &4YZ #)-/02568:BCEF{~`*.01WYZa @AV`jpstuyPp N O Q V X ` d f p q x y       ) * 1 2 3 5 6 8 : < = > C G I K N \ ] f u       ) * 1 2 4 5 : < D G I K N U X _ b f p q r     ) * 4 5 : < E F I J N U W ] ^ ` b f p        ; = D F I J O T X ` b f p z 34;@OPZ *5678>CDHIMNRSWX\]ijmqstuzJPIJNPWXYZ^`[]` FHNPXYZ[\]^_qrstuvwxyz{|}'-(---.-----------      E F I J P T d f ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt y ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++/,0,_,`,,,&-'-(---.-0-h-o-q--------------------P.....////0@0A0001101111111112 2MMǤФ,@§ǧ,0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0hpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$-KP{(0dop7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZNRp56GPw? )*1245:;EGIKNPQWX]dfmpuZ[\]`EPZ`m,0@<HP  78FPmp  7:;<>?HPZ`fgij#$o$p$u$$D%0/40494DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooopPSdhpkp}')FW`yUV  :;?@EFGJQR"#%&+-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 mp<@IPR`ft HPZ`  rswzT`nptx{צ5@   Jxz01WYKM.0?@\^_`k       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x    ) * : = E F I J N U W X [ ` d f p w      E F I J P T d f ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt y ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++/,0,_,`,,,&-'-(---.-0-h-o-q--------------------P.....////0@0A0001101111111112 223MMǤФ,@§ǧ,0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0hpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$-KP{(0dop7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZNRp56GPw? )*1245:;EGIKNPQWX]dfmpuZ[\]`EPZ`m,0@<HP  78FPmp  7:;<>?HPZ`fgij#$o$p$u$$D%0/40494DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooopPSdhpkp}')FW`yUV  :;?@EFGJQR"#%&+-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 mp<@IPR`ft HPZ`  rswzT`nptx{צ5@   8xz01WYKM.0?@\^_`k       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x    ) * : = E F I J N U W X [ ` d f p x      E F I J P T d f ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt y ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v++++++,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------O.....////0@0A0001101111111112 223MMǤФ,@,0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0fpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$-KP{(0dop7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZNRp56GPw? )*1245:;EGIKNPQWX]dfmpuZ[\]_EPZ`m,0@<HP  78FPmp  7:;<>?HPZ`fgij #$o$p$u$$D%0/4DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kk@nnoEoPooooooppkp}')FW`yUV  :;?@EFGJQR"#%&+KPZ^`q !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 lp<@IPR`ft HPZ` ?@qswz{|`nצ5@   &xz01WY`aKM.0?@\^_`k       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x      ) * : = E F I J N U W X [ ` d f p x      E F I J P T d f 7@T`mnqrt y ,0<@ADnpu_`}MP8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....////0@0A00011011111112 2ǤФ,@˧Чҧӧԧէڧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>Z#$o$p$u$$D%//0V4DGFh9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ KP#  xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MP8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....////0@0A00011011111112 2ǤФ,@˧Чҧӧԧէڧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZpNRv56HPw? )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP  78FPmp  7:;<>?HPZ`fgij#$o$p$u$$D%//0/40494DGFh9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooooop֌ #PSdhpkp}.0GP')FW`yUV  :;?@EFGJQR"#%&+-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`ft HPZ`T`npux}9@ K  \xz01WYKM.0?@\^_`k       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : = E F I J N U W X [ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt y ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++/,0,_,`,,,&-'-(---.-0-h-o-q--------------------S.....////0@0A00011011111112 2ǤФ,@§˧-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$-KP{(0dop7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZNRp56HPw? )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0@<   679;GPZHP  78FPmp  7:;<>?HPZ`fgij#$o$p$u$$D%0/40494DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooooop֌ PSdhpkp}')FW`yUV  :;?@EFGJQR"#%&+-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`ft HPZ`yzT`npux{ަ5@ K  Hxz01WYKM.0?@\^_`k       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x    ) * : = E F I J N U W X [ ` d f p w !!!""###{#$%$@$K$`$$%%%%&&&p&''' ' '(')'L'M'N'O'S'V'W'X'_'a'h'v''''''080?0@0A0000001-11111122 2D2`2|22222223w3{3333N.78=>?@BCEF@P $0EISTghlpstuv_a pPF`btvz{~ PQ]^1WY`a   !;@S`np   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIjqZ_ FHNPXYZ[\]^_~ / 0 G j q t !9!S!!!!""###{#$%$@$K$`$$%%%%&&&p&''' ' '(')'L'M'N'O'S'V'W'X'_'a'h'v''''''080?0@0A0000001-11111122 2D2`2|22222223w3{3333N.78=>?@BCEF@P $0EISTghlpstuv_a xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#  xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MP8;JM FHNPXYZ[\]^_~ e f r t !!!'$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@˧Чҧӧԧէڧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>Z#$o$p$u$$D%//0V4DGFh9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#  xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}[_}w  7@T`mnqrt x ,0<@ADnpu  FHNPXYZ[\]^_~ d j r t !M!S!!!#$'$@$K$`$&&&''' ' '(')'L'M'N'O'S'V'W'X'_'a'''''''''''+,/,0,_,,,,&-0-f-o-p-------------------........////0@0A00011-1111111112 2D2P223MMǤ,.0kp78=>?@BCEF@P $0STghlpuv  '(;<>?NP^47 $0K  679<=?@         4 8 ; ? H P Y '*FWUV  :;?@EFGJQRצ  87PX]ptvz{~1WY`a  !;@Y`KMP : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 5 : < D G I K N V X \ ^ _ b f r       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_GHIJNPWXYZ^` GH[a}w  7@T`mnqrt x ,0<@ADnpul FHNPXYZ[\]^_~ U W X _ d j r t !?@BCEF@P $0STghlpuv  '(;<>?NP^47@ $0K  679<=?@'*WUV  :;?@EFGJQRצ  !"4PP`ptvz{~1WY`a   !;@V`-0K   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_GHIJNPWXYZ^` GH[a}w  7@T`mnqrt x FHNPXYZ[\]^_~ S W X _ d j r t !;!=!L!S!!!#$'$@$K$`$$%&&&&~&&&''' ' '(')'L'M'N'O'S'V'W'X'_'a'''''''''+....////0@0A00011-11111112 2D2Q2|222223w3{33334MNǤ.0k78=>?@BCEF@P $0GISTghlpuv $0K&(N'*UV  :;?@EFGJQRצ  $ "4PO`ctvz{~1WY`a   !;@V`np-0K   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_GHIJNPWXYZ^` GH[a}w x FHNPXYZ[\]^_~ G H N j q t !;!S!!!!""#|#}##$'$@$K$`$$%%%%&&&r&''' ' '(')'L'M'N'O'S'V'W'X'_'a'h'v''''''()....////0;0>0@0A0000001-11111122 2D2`2|22222223w3{33334MN¤ŤƤǤ.78=>?@BCEF@P $0EISTghlpstuv_a $0K&(N'*UV  :;?@EFGJQRצ   "4PO`ctvz{~1WY`a   !;@V`np-0K   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_GHIJNPWXYZ^` GH[a}w x FHNPXYZ[\]^_~ G H N j q t !;!S!!!!""#|#}##$'$@$K$`$$%%%%&&&r&''' ' '(')'L'M'N'O'S'V'W'X'_'a'h'v''''''()....////0;0>0@0A0000001-11111122 2D2`2|22222223w3{33334MN¤ŤƤǤ.78=>?@BCEF@P $0EISTghlpstuv_a pPF`btvz{~ PQ]^1WY`a   !;@S`np   : < N P U X q       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 6 : < D G I K N V X \ ^ _ b f q       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIjqZ_ FHNPXYZ[\]^_~ / 0 G j q t !9!S!       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x       ) * 4 5 : = E F I J N U W X Z ` d f p x       ; = E F I J O W X ` d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e j r t !!!#$'$@$K$`$''''''M+P+Z+,/,0,_,`,,,&-0-f-o-q--------------------2.....////0@0A00011.1111111112 223MM̟ǤФ,@t|,0:@xŨΨڨT_}Ωϩکީ7@NPZ\|ê۪  '(/.0np78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?VW`   : ? @          4 8 ; ? H P Y `   6 9 V X s x   I `NRp o#$c$p$t$0/4h9j')FW`rUV  :;?@EFGJQR,0 /0jp;@IPR!067}?@AB>Ph &(,-.045AEPtצ5@  xz&1WY`a !_`KM.0? : < O P V X s y       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f r       ) * 4 5 : = E F I J N U W X Z ` d f p x       ) * : = E F I J N W X ` d f v y ;?\HImqIJNPWXYZ^`[_}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e j r t !!!#$'$@$K$`$&&&&&&'''' ' '(')'L'M'N'O'S'V'_'a'''''''''''M+P+Z+,/,0,_,`,,,&-0-f-o-p--------------------2.....////0@0A00011.1111111112 223MM̟ǤФ,@`bt|,0:@xŨΨڨT_}Ωϩکީ7@NPZ\|ê۪.0np78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?VW`   : ? @          4 8 ; ? H P Y `   6 9 V X s x   I ` o#$c$p$t$0/4')FW`rUV  :;?@EFGJQR,0 /12=>?@BCFGJOWX_`yz{}2@Iצ5  xz$1WY`a !_`KM : < N P U X s {       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f r       ) * 4 5 : = E F I J N U W X Z ` d f p x       ) * : = E F I J N W X ` d f v y ;?\HImqZ_IJNPWXYZ^`[_}w  7@T`mnqrt x ,0<@ADnpu LP}8;JM FHNPXYZ[\]^_~ e j r t !P!S!!!#$'$@$K$`$&&&&&''' ' '(')'L'M'N'O'S'V'W'X'_'a'''''''''''M+P+U+,/,0,_,`,p,q,~,,,,&-0-f-o-p--------------------1.....////0@0A00011.1111111112 2D2P223MMğǤ,@`bt|,@xŨΨڨT_`7@NPZ\`.0kp78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?@   : ? @          4 8 ; ? H P Y  o#$c$p$t$')FW`rUV  :;?@EFGJQR,0צ  pptvz1WY`a  !;@_`KMn : < N P U X q {       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 5 : < D G I K N V X \ ^ _ b f r       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_IJNPWXYZ^`[_}w  7@T`mnqrt x ,0<@ADnpu LP} FHNPXYZ[\]^_~ d j r t !O!S!!!#$'$@$K$`$&&&''' ' '(')'L'M'N'O'S'V'W'X'_'a'''''''''''+ +$+,/,0,_,`,m,t,x,,,,&-0-f-o-p-------------------........////0@0A00011-1111111112 2D2P223MMǤ ",@x.0kp78=>?@BCEF@P $0STghlpuv  '(;<>?NP^47 $0K  679<=?@             4 8 ; ? H P Y  o#$c$p$t$'*FW`rUV  :;?@EFGJQRצ  \BPptvz{~1WY`a  !;@_`KMn : < N P U X q } ~       ) * 1 2 4 5 7 8 : < = > C G I K N Y ] ^ _ f u       ) * 1 2 4 5 : < D G I K N V X \ ^ _ b f r       ) * 4 5 : > E F I J N U W ` b f p       ) * : > D F I J N W X ` b f p ;?\HIkq"#()+,36:@ZZ_IJNPWXYZ^`--------C.....////0@0A00011.1111111112 223MM͟ǤФ,@,0:@xŨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0`dfnp78=>?@BCEF@P .0STghlpuv  '(;<>?NP^47$0KP{(0dop7@V`h  679<=?VW   : ? @              4 8 ; ? H P Y `       6 9 V X s x       I `NRp56DPw> )*1245:<EGIKNWX]dfmpuEPZ #$o$p$u$0/4h9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kkoEoPooookp}')FW`rUV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp;@IPR-0~KPz{CEt HPZ`צ5@  Jxz(1WY`aKM.0?@\^_ x y       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x       ) * 4 5 : = E F I J N U W X Z ` d f p x       ; = E F I J O W X ` d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!#$'$@$K$`$''M+P+Z+,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------<.....////0@0A00011.1111111112 223MM͟ǤФ,@,0:@xŨΨڨT_}Ωϩکީ7@NPZ\|ê۪  '(/np78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?VW`   : ? @              4 8 ; ? H P Y `   6 9 V X s x   I `NRp56D o#$c$p$t$0/4h9joEoPoooo')FW`rUV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp;@IPR!067}?@AB>@DPhAEPtצ5@  Jxz(1WY`aKM.0?@\^_ x y       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x       ) * 4 5 : = E F I J N U W X Z ` d f p x       ; = E F I J O W X ` d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e j r t !!!#$'$@$K$`$''M+P+Z+,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------<.....////0@0A00011.1111111112 223MM͟ǤФ,@,0:@xŨΨڨT_}Ωϩکީ7@NPZ\|ê۪  '(/np78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?VW`   : ? @              4 8 ; ? H P Y `   6 9 V X s x   I `NRp56D o#$c$p$t$0/4h9joEoPoooo')FW`rUV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp;@IPR!067}?@AB>@DPhAEPtצ5@  Jxz(1WY`aKM.0?@\^_ x y       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x       ) * 4 5 : = E F I J N U W X Z ` d f p x       ; = E F I J O W X ` d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e j r t !!!#$'$@$K$`$''M+P+Z+,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------<.....////0@0A00011.1111111112 223MM͟ǤФ,@,0:@xŨΨڨT_}Ωϩکީ7@NPZ\|ê۪  '(/np78=>?@BCEF@P '0STghlpuv  '(;<>?NP^47 $0K  679<=?VW`   : ? @              4 8 ; ? H P Y `   6 9 V X s x   I `NRp56D o#$c$p$t$0/4h9joEoPoooo')FW`rUV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp;@IPR!067}?@AB>@DPhAEPtצ5@  xz(1WY`aKM.0?@\^_ x y       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v .-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP#  xz01WY`aKM.0?@\^_       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x      ) * : = E F I J N U W X [ ` d f p x       ; = E F I J P T d f ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!#$'$@$K$`$t+v++++++++++,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------E.....////0@0A00011.1111111112 223MM֟ǤФ,@,0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0fpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$0KP{(0dop7@V`h  679<=?VW  : ? @              4 8 ; ? H P Y `       6 9 V X s x       I       `NRp56DPw? )*1245:<EGIKNPQWX]dfmpuZ[\]^EPZ`m,0@  78FPmp #$o$p$u$$D%0/4DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kkoEoPoooooopkp}')FW`rUV  :;?@EFGJQR"#%&+KPZ^` !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp<@IPRt HPZ` (013?@LP_צ5@   xz01WY`aKM.0?@\^_       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x      ) * : = E F I J N U W X [ ` d f p x       ; = E F I J O W X _ d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!#$'$@$K$`$t+v++++++++++,/,0,_,`,,,&-'-(---.-0-h-o-q--------------------C.....////0@0A00011.1111111112 223MM֟ǤФ,@,0:@xŨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0fpnp78=>?@BCEF@P STghlpuv  '(;<>?NP^47$0KP{(0dop7@V`h  679<=?VW  : ? @              4 8 ; ? H P Y `       6 9 V X s x       I       `NRp56DPw> )*1245:<EGIKNPQWX]dfmpuEPZ,0@ #$o$p$u$$D%0/4DGFh9j@j_j`jjjnjpjjjjjkFkPkZk[kbkckxk}kkoEoPooookp}')FW`rUV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0 /0lp;@IPRz{t HPZ`צ5@   xz01WY`aKM.0?@\^_       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N V X \ ^ _ d f x      ) * : = E F I J N U W X Z ` d f p x       ; = E F I J O W X ` d f v y ;?\HImqIJNPWXYZ^`[]}  7@T`mnqrt x ,0<@ADnpu_`}LP}8;JM FHNPXYZ[\]^_~ e f r t !!!#$'$@$K$`$t+v++++++++,/,0,_,`,,,&-'-(---.-0-h-o-q------------>@AEMNWXbd5678@BEF03;=>? ",-./8905=>@A9:WY/0>?FG46AB,a-a@mCmcmmm       : = > P Q S U X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J O W X b d 0;@FGO56789:>@q+9:?VZ^abegnqu25RTrt ,0<U_a}4Ekt$8  #(,-ƨ&.GT)7CDLN{~ª      8 ; 8Gpqsu'345EGst,8>?AB;=>EGIKNWXbdfmpu5G^_0A,,;0679;>?D 3?Q\/78@17:;<>?EFH4;>BZ[a0a@mCmcmmm K L J M @BKM89g? @ N O ? @ G H F I ?@12UVns>@')46/145,-GI67&'-.5678>@*a,a ;<BC/< = A E M N R S V X b d < = A C M N Q R u v < = A E M N b d < = V W b d A E b d 8;5678qrtv/178=?XZ^a34STst"#239:;<VW[_iklm8;lm,-78%&,-ĨŨ+.GJKO-.2357    9 ; <B*,13st/0AB;=8>BCFG39?@$&()/39;CD  35;?RTY\27?@67BCDEGH8;.a0akk p P 0P0  Pp@jpj`oo  @nn`p  @` P @ ФPP@mmP ` `01 @ ` `  @`/0@00  @ @ a@a ` p0P,`,@  0004P`p0@ /0 $,-`PpK`pq0K$%().Y\  ; < = A I M N Q ` b d x   < = A C G I K N Q R p r u v    ) * 1 2 4 5 : < = > @ A E M N U X \ ^ _ ` b d q r     ) * : < = > A F I J N U W X [ b d   = > ? A E M N W X b d 124;GO56789:q-1289;=?XZ^aqu]`25RTrt  #')239<VWX_`abcems}4>BEkt,468  ,,---.*00000ost~ %',-Ĩƨ&.GRST)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/248>?AB;=>?@AMNWXfmpu8@BEFG^_3;=>?A "&',/89;01;?CD 39;?GHQWY\078>?@17:;<>?FGH6;@CZ[@4A4G4V4a*a-a0ajj0k7kOoPooooooo.0Gejms{BE7;muv"#%&+07DK  M N M N M N M N pK`pq0K$%().Y\ : ; < = A I Q X b d   < = A C G I K N Q R p r u v   < = > @ A E U X b d    < = > A F I J M U W b d  ; = > ? A E W X b d 124;GO56789:q-1289;=?XZ^aqu]`25RTrt  #')239<VWX_`abcems}4>BEkt,468  ,,---.*00000ost~ %',-Ĩƨ&.GRST)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/248>?AB;=>?@AMNWXfmpu8@BEFG^_3;=>?A "&',/89;01;?CD 39;?GHQWY\078>?@17:;<>?FGH6;@CZ[@4A4G4V4a*a-a0ajj0k7kOoPooooooo.0Gejms{BE7;muv"#%&+07DK 5 : X ` x  ) * 1 2 4 5 : \ ^ _ ` q r  ) * : X [  ; 0p@` 101p jk @ 0DFP`xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---    cdjkghbcefde`aijhiabfg ! DEjkNO !  CDGH            ! # $ ,/WYnprs|}./;=be$% AB`bOP =@uw%&*+/0 /1Y[z|-.()*,noyPW"$%&'(qtuvsup 9;]`Ωϩکީ`$-0PPp@0-- ppjj  P` P0P0p   ` b r x           ` b      ` b      _ b !+RV #@C`cMSΫЫѫҫqs@A `b   PQ     `fgijlaa: < > M N P U X b d > C G I K M > E G I K M U X b d > E F I J M U W b d > E F I J M W X b d 0:@FGHq~+6VZbcgiqu24RTrt ):;at5D&-#(ĨGO)3      8Fsu'3EG,4AB>EGIKMWXbd5B0=@A +,70679 Q\/78<17:;<>?@CD4;>Aa*acmkm cn^bfg"+PUM          89  EF>?899:>?ABBmCm7M N M N M N M N M N DEĨŨFG56MNBC?@9:?@HL78ceinuz+.{~ªpuªê) 5678;<{}67t u ^_343; = :;NO:;45z{,-STpq45+,=>45DEAB/a0akmmm-.0: P Q S U d f p r       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f t u v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z /0;@FGOPZ 456789:@HImqJKLNOP5@T`mnqrt ,0<Fnpu _`}MPZ8@JMP    t u %%(,-@tƨШڨ.0TЩک7@NPZ`pqwzê         6 8 ; ? I GRv56@DHPt8>B )*1245:;EGIKNWX^dfmpuHPZ^bAPZ,0<@G;   679;DPZ@EFGHP  78APmr  7:;<>?HPZ`fgij;>CP[a:a@mmmpmzmc0:f p f p f p f p f p PZ 4@JFPPZ@JШڨ ЩکPZ@ I fp6@PZPZ0<PZPmPZPZ0a:apmzm9< = < = < = < = 9:45788 ; st67;=FG:;CDBCZ[  9:`a? @ 34>?GHEFBC q r 78  `b),WX[_$&giqr ?@:; N O ABFG-. r t KLNO  %%tw?@EF!u v ;?^aUW37 @ABC;?GH*a-a.a/aLMZ[023:XZ-4OS@N۫  ] ^ T W z A : X ` x  ) * 1 2 4 5 7 8 : Y ] ^ _  ) * 1 2 4 5 : \ ^ _ ` q r  ) * : X [  ; /@HIm!?@PRZ^abegnqu #2CRcmnqPc MSU4EM$MP #@^bfiqrs "0G)`pqtz{~ΫЫѫҫ۫       6 8uv'DEGHUs,?@)*1245:50@G , 0 3\/r 1l4aaCmcmQ S Q R  >?fmpuRf}    p q         MN~6723tu46 stŨƨ  45^`CE_`=>78;=59<>@A-a.a@mBm%= > = > = > = > =>GH@A@0` p     @ W X %'CD24 L M  H I )*=><= H I stvz<=.0  : ; E I Q R U V   G I K M p r   ? @ U W    > A F H J N U V  ; = M O 1248GO9:rsz-/27:;qu23RSrs "'):;X[bceikls}4568BCklmt-467  &'Ũƨ&+JKOR)-./12CDLM|}ª    8 9 8<BGpqsu'*-.0145024568>?@Afmpu>@CE^_9;=>@A "$'(),38;=?@AB 59:;QRTW028>16:;<>?BCD68@AZ[a*a-a.ac  ; < > ? @ A I M O P   > ? @ A   > ? @ A   A E   > A W X 0124EF>?+-89;<VXbegn45#%),0239WXabcemn56DE$'*,#%'(ĨRT34MN{|}~EG,/56`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 124@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF>Ppuv!;A[f  '(;<>?NP^ -ABJPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP# f p 1.2.0:@mzm+Q S d f 06oo֌  0:B          6 8 ; ? I P Y I!0"0?0@0000011211111}2~22222223 3U3V3a3b3q3s344*4,4444444H9I9J9K9::::;;>>>>r?t?@ @@@AA^B_BCCCCCCCC 00000000;>[12//110-#$00000 000607080<0>0000112223X3EGa #UVdh0p !"`ntuKM$%().@\`abfgkp : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d  ; = A E M N b d 124;GO56789:q-1289;=?XZ^aqu]`24RTrt  y #')239<VWX_`abcems}456;<=BCkt,468  * / ` e j p ,,---.*0.000ost~ %',-@sĨƨ&.GR)/1357CDLM|}ª 0v{      8 ; ? @                  ( i n 0EFUp8Gpqsu',-5st/24568>?AB;=@Afmpu8@BEFG^_3;=>?A "&',/89;;=>?CD 39;?GHQWY\078>?@17:;<>?FGH6;@ABCZ[04A4G4V4a*a-a0ajj0k7kOoPooooo.0GgjsBE7;muv"#%&+07L pK`pq0K$%().Y\ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d  ; = A E M N b d 124;GO56789:q-1289;=?XZ^aqu]`24RTrt  #')239<VWX_`abcems}456;<=BCkt,468   * / ` e j p ,,---.*0.000ost~ %',-Ĩƨ&.GR)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/24568>?AB;=@Afmpu8@BEFG^_3;=>?A "&',/89;;=>?CD 39;?GHQWY\078>?@17:;<>?FGH6;@ABCZ[04A4G4V4a*a-a0ajj0k7kOoPooooo.0GgjsBE7;muv"#%&+07DL "&'()*/3HIqtux()*+,-/0MNY\kmqrsuxz@AFHIJTUVYghikp                              " # 34TUtv rs       !&'()*/3@AHIKnpx()*+,-/NY\kmqrsuxzAFHIJTUV`abfhi y@r                         " # $ 034EQTptvD @A      MN&'IKxywx$%HIvxxz)*,- 79+,#$35\]mnpq}() 57'(13[\kmqr)* BCop&'"# FGgjC !"@AKnpqtu0M`kp                       ! # $ !"EFeg                                                  pqĺź45PQlmܻݻ01LMhiؼټ,-HIdeԽս ()DE`a|}оѾ $%@A\]xy̿Ϳ !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm1OP\c       / 0 !"#$%&()*+,-/047494<4oo3!"?@   DFb'd',,,,../.S.U.vxVX qr  )*]^V.W.X.Y.Z.[.\.].z  OP\cpK`pq0K$%().Y\ : = > P Q X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J N W X b d 56789:>@q]`25RTrt  ,0<4Dkt$8   * / f p ,,---.*000506000ost~ #(,-ƨ&.GT)7CDLN!"#$%&()*+,-/0v{      8 ; ? @   $ ( i n FQ8Fpqsu'5EGst,8>?AB;=>EGIKMWXbdfmpu5G^_0A,;0679;>@ABD 3:;?GHQ\/78@17:;<>?FGH4;>BZ[@4A4G4V4a0ajj0k7kOoPoQoooooo.0GejmBE7;muv"#%&+07DK }~;<=>F G ~  # # # #*#+#i'j'k'l'm'n'o'p'q'r's't'u'v'''''''''''''))))))))))))))))))))))))))))#.$.%.&.'.(.).*.00 0 0 0 0 000000000000000 0>?6789:;<=>?@ABCDEHIPQRSZ[\]^_ =>]^`bce[2^2222222z3|38494=4>4?4@4EE;A0B0C0D0E0F0G0H0I0J0c0d0000000000000000000000000000000000012gq23PSUVdh ( * 3w x   tvuv`m?@EF pq |}d f Z\  45JLab57NPZ\]a};@~       ' ( V W X \ ] ` ,,,-p-q-......*...0.2.3.5.<.?.@.B.C.K.L.M.N.P.].^.00 ΨШ.0ǩʩϩЩ@CDL]`WX  P X   9 @ n o GI@D8:;==>]^KOZ\AC<?DGAEAFCE p$u$njpjjj7k:kDkEknmpmnn  :.<.#PZЩک)PZfpPQ^`PZPZaa0a:a ?@AB#$&'*+<?@[^{~pxz~01WY  Kmpq0M$%()0?@Y^_`kp : = > P Q X b p     ) * 1 2 4 5 7 8 : Y ] ^ _ r u v w     ) * 1 2 4 5 : = > \ ^ _ b p x     ) * : = > X [ ] ^ ` b x     ; = > N P T W X b p y z OP *46789@HImLPIJNPWXYZ^`[`ab}2@R`mnq   y@A $MPZ~ FHNPXYZ[\]^_~  " $ 8 9 > D J V \ ] a e p r u } !!!!! ! !!!!!!!#!+!,!P!_!`!l!p!z!!!!!!!!!""""" " " """"""""""!"#"$"%"&"'"-"."/"4"8"<">"H"I"L"M"R"S"`"b"d"h"j"l"n"p"""""""""""""""# #####)#+###*$@$K$$%L%P%u%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&& & &&&&&& &9&<&@&A&B&C&`&b&c&f&g&k&l&n&o&p&&&&&&&&&&&&'''W'X'['a'b'e'h''''''))))))U+Z+t+v+++,,,,,-&-'-(---.-0-h-o-p-------------------..... ./.0.2.3.5.:.?.@.K.L.M.N.P.S.MNФ  *,@ost~ΧЧҧӧԧէݧ #(,089:@t &0G_`  '(/0lp)*P>@puv  '(;<>?NP^47$-KPv(0do{|7@V`h  679<=?VX  : ? @            6 @ I X Y `       6 @ V X s x       I      $ J f o    `(0FQZp'DEGHPstuvw,:;=>?A5GKOP]^_b0CE,;< 3:;@AFGPQ\  /@AZmr  1FG`fgij #$o$$D%//0X2^22222y3|3/4A4G4`4CDEEGFh9j@j_jpjjjjk0k:kDkEkFk[kbkckxk}kk@mnm@nnnnoKoPoQooo֌kp}P')ejmBEFW`yUV  :;?@EFGJQR7;muv%+0n-7>NPDKLq> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ .0jp%2JPv|t HPZ` T+4EM8qsuv )*1245:`b   04  " ; < t u  !!!!!!#!+!,!P!_!`!l!p!z!!!!!!!!!""""" " " """"""""""!"#"$"%"&"'"-"."/"4"8"<">"H"I"L"M"R"S"`"b"d"h"j"l"n"p"""""""""""""##`$$%L%P%u%%%%%%%%%%%%%%%%%%%%%%%%%%%&& & &&&&&@&A&B&C&`&b&c&f&g&h&i&k&l&n&o&p&&&&&&&&&&&&&&&&&&&&&&&W'X'v''U+Z+H2P2 .0jpA[a{ !#&-/02XY^_cpQ S &,]bfkxy/ 0 q r  *!,!2!3!N!O!`!!`,,.."ΧЧҧӧԧէݧ./0[\efj!;A[%+0p `,,P  _`}KA[a{puvxz~01WYZ` Knpq0M$%()@Y0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0kckxk}kkCmkmoKoPoQop֌ #23PSUVdhpkp}  -NO !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#tuz{YZ@A$%()q r FGCDx~,kxyq r  |,~,o-p-/.0.001060;0<00000  pqϩЩpqݪު\`ijpqN O o p @kDk@mCmkmmmoooooo0n7>KL  0 0Ф  '(;<>?NP^47@ 47@V`h e f  ,0<@ADP!P!8;JMP   lxz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ HPZ` ` a DEFGMN>?BC/0 !E;@O@PPnpu _`}`ê۪,:<?G"#'(     9 ; ['a'.... .".vy3$%+,\] ?@ !!""ij3%&  jk y z 0 8 W X !! ! !89jk()[\{|:;<=    E F } ~ # # # #)#*#h'i'j'k'l'm'n'o'p'q'r's't'u'''''''''''''))))))))))))))))))))))))))))..".#.$.%.&.'.(.).B.C.U.V.W.X.Y.Z.[.\.0 0 0 0 0 000000000000000?@56789:;<=>?@ABCDGHYZ[\]^ ;<[\_`bcX2[22222y3z3/4047484<4=4>4?4EE^`0:`jkmf p f p f p f p f p PZ *@JFP@JPZ *Шڨ 0 : @ J 6@PZPZ0:PZPZ`jjjjjPkZkpmzm@JPZ%< > G J 0000;0=000000000TVefooy| ,-./:<~ D E $ ' ""  ]\]akt}####&&&&&&&&& &9&<&h&i&&&&&&&&&&&&&&&&&&&&&&&&&&'' 'd'e'....///0000000 0*0005060;0=0@0B0C0D0E0F0G0H0I0J0c0d000000000000000000000000000000000001101111111122 2H2P2MNǤǩʩΩީ\]05EGIPQRXY_ghikl  ;<=>[\]^_fgqINRfEPp #pBDFQfy|}%2Jtvz{EHKt  &'0:<?wxT-.)*78=>?@BCEFP89TUpqĬŬ45PQlmܭݭ01LMhiخٮ,-HIdeԯկ ()DE`a|}аѰ $%@A\]xy̱ͱ !<=XYtuȲɲ89TUpqijų45PQlmܴݴ01LMhiصٵ,-HIdeԶն ()DE`a|}зѷ $%@A\]xy̸͸ !<=XYtuȹɹ89TUpqĺź45PQlmܻݻ01LMhiؼټ,-HIdeԽս ()DE`a|}оѾ $%@A\]xy̿Ϳ !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm01LMhi,-HIde ()DE`a|} $%@A\]xy !<=XYtu89TUpq45PQlm89TUpqĬŬ45PQlmܭݭ01LMhiخٮ,-HIdeԯկ ()DE`a|}аѰ $%@A\]xy̱ͱ !<=XYtuȲɲ89TUpqijų45PQlmܴݴ01LMhiصٵ,-HIdeԶն ()DE`a|}зѷ $%@A\]xy̸͸ !<=XYtuȹɹ89TU89!a)ahmkm^e #)-/0289@Ftu~SV< = X ` 3 4 6 7 Y \ ^ _ > ? V X \ ^ V W > ? W X CDMNRSWX\]ijstuwxy./av56qrstuvwxyz{|}~  &!'!*!,!)#+#**00 !"#%'*np *78=>?@BCEFO'(>?WX01a*agmim^ec #)-/0289BCEFSV< = > ? V X V W > ? W X ./av5600'(>?WX01a*agmim\]bh//@      P   `PPP```P%/Fa@ahk@mm@nnoooPP`pP` #  d f 06!0:`jf p f p f p r x f p x  X _ f y PZ 4@Ji}FPPZ@JPZp q t z P!!!!`$$$%v'',,00!0*080;011 2*2H2P2Q2`22222 *06Шڨ ЩکPZ4@y $ABJKX`y         @ I }      X ` x      0 : @ J `'QURp6@PZPZ0<PZPmPZPZ$o$0a:a`jjjjjPkZk[kbkpmzmnn`y@JPZq./>  ./`` f p @j_j`jjjnjpj` y/ 0 000 0`m 0:EPZpK`pq0K$%().Y\ : ; < = A I M N Q X b d   < = A C G I K N Q R p r u v   < = ? @ A E M N U W b d    < = > A F I J N U W b d  ; = A E M N b d 124;GO56789:q-1289;=?XZ^aqu]`24RTrt  #')239<VWX_`abcems}456;<=BCkt,468 ,,---.*0.000opt~ %',-Ĩƨ&.GR)/1357CDLM|}ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu',-5st/24568>?AB;=@Afmpu8@BEFG^_3;=>?A "&',/89;;=>?CD 39;?GHQWY\078>?@17:;<>?FGH6;@ABCZ[@4A4G4V4a*a-a0ajj0k7kOoPooooo.0Ggj{BE7;muv"#%&+07DKQ S d f    E F I J P T d f 03#$&')*''+,oKoOoooo] ^        @nn  psTVXY}  ; < > A I M N P   > A   > ? @ A G I K M W X   A E   > A F I J M W X >@+-1289;=VXbegn45#'),0239UVWXabcems56;<=BCE$,46.000#%'(ĨRT/135MN{|}~,-EG,/2456>@AEGIKNWXbd58@BEF03;=>? "&',/890679=>@ABC9:WY/0>?46>@AB*a-aQooooegms"#+,<?^_|}~   2 5 @ A D E R S a e z  !!!! !!!!!!$!%!(!*!,!.!/!2!3!9!?\]^_  UV  :;?@EFGJQR !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~p@A    @A@\^_0 d p 0:PwpK`pq0K$%().Y\ : = > P Q X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J N W X b d 124;GO56789:>@q+?VZ^abegnqu]`25RTrt  ,0<U_`}4Ekt$8 ,,---.*00000ost~ #(,-ƨ&.GT)7CDLN{~ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu'5EGst,8>?AB;=>EGIKNWXbdfmpu5G^_0A,,;0679;?@ABD 3:;?GHQ\/78@17:;<>?FGH4;>CZ[@4A4G4V4a0ajj0k7kOoPoQoooooooo.0Gejms{BE7;muv"#%&+07DK 1.2. : ? @ Z [ @E! @AKnpq0M@Y`kp : = > P Q X b r     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 124@F@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq CDyPnpu U4EM$MPZx5!9!0-h-------------------00<0=0A0000000110111111124MNФ  *,no #@t &0G`})@CDL`pqwz{~ªê۪ݪ  '(/np)*78=>?@BCEF>Ppuvfpq  '(;<>?NP^ -ABJPvP(0d7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I  $ J N O P '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_bNNakbk`kakyyNNQQ_k`kFQGQ^k_k !!  |}!!NN,-+,UV_`  ]k^k%&;<+ r s o!p!!!NNCSDS!""#MNTUqr^_  G H _ `     efG q r {|m!n!}!~!pOqO~vvLMKLRSjk]^     F G   ^ _ ~      rs%&TUdelm\k]kw p q rsi!j!y!z!i$j$}$~$$$$$''''''8090)2*2H2I222NNASBSbbstIJPQWX`e"#[\~    D E     \ ] | }     ij"#RS[\:;cd[k\knnijz{  78Q!R! v w w x [!\!45_$`$P!Q! Y!Z!  a$b$=>^ _ U!V!Y Z  r s s t 01@A  |}`$a$b$d$ S!T!  }~Z$[$]$^$e$f$[ \ #s t t u *+,,12ABuw    H I {|&'d$e$<=X Y   u v v w 34  \ ] R!S!+12abg h g h g h g h y z | } g h QR!"ABijGHQRABQR _!a!p!q!`$a$t$u$$$$$v'w'''''!0"011 2!222NNXXXXz^{^ _ _!"ѨҨѩҩQRBCX[ !XYyz    @ A } ~     X Y x y     1 2 A B `aQRRSgh78QRQR12QRQRZ[QRQR$$$$,$-$4$5$O$P$X$Y$1a2aajbjjjQkRkqmrmnnnn`arswxABQRqr* + 01`af g f g f g f g x y f g PQ !@AFGPQ@APQp q !!$$$%00mm !ШѨЩѩPQ0 1 @ A fg67PQPQ01PQPQPQPQ0a1a`jajjjPkQkpmqmnn@APQ  34P!!E r x x  X _ p y *4r}P!!!!i$t$}$$$$$$$$'''''',,00!0*080;011 2*2H2P2Q2`222224444*8+8M;N;NNNNNN N N$N%N]N^NNNNNNNNNNNNNNN OOpOqOOOPPQQFQGQiQjQkQlQmQnQASBSCSFSLSMSSSVVXXXXz^{^^_ ____bbbbLcMcggmmooss~vvvvyy,-01!"FGLMxy06klstxy4@y $ABJKX`y         D I }      X ` x      i'QU[f:<Zm$o$[kbknn`yq./>  de!"* +             ##));;mbnb)irp q t z `$i$t$}$$$$$$$$%v''''''@ D `iR[ oop r x x  X _ p y *4i}p q t z P!`!!!`$$$%v'',,11 2*2H2P2Q2`22222064uy $X`y         @ I }      X ` x      `'QURf:<Zm[kbknn`yq./> `!!!!00!0*080;0@uABJK$o$    >@1&(1289ACJLRTfh &4@BCEtuz{~ 9:PRSTWX\_vx"'uy) * 1 2 4 5 X ` 3 4 6 7 Y \ ^ _ H I K M \ ^ H I J M 34  CDMNRSWX\]ijstuz&'     ;<=>@BCD,/0;<NOkxy FHNPXYZ[\]^_~     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!2!3!:!;!A!E!J!P!!!!!!!!!!"" " " " "$"%"&"'","."/"1"A"B"D"E"G"H"I"J"`"a"b"c"m"r"t"v"x"z""""""""""""")#+#`$$ * *t*w***|,~,o-p-....//00607080;0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0e0f0g0h0i0j0p0r0s0u0v0x0y0{0|0~000000000000000000000000000000000000000000000000000011111122 2H2P2224pq\`ij !"#%'*np78=>?@BCEF>P0EGSTghlpstuv.0KM89!a)ahmkm^eUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR[24?AIJ #)-/0289@Ftuz{~SVuy< = X ` 3 4 6 7 Y \ ^ _ > ? V X \ ^ V W > ? W X 34  CDMNRSWX\]ijstuz./av56,/0;<NOkxyqrstuvwxyz{|}~     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!2!3!:!;!A!E!J!P!!!!,"."/"1")#+#`$$ * *t*w***|,~,o-p-....//00607080;00000011111122 2H2P2224pq\`ij !"#%'*np78=>?@BCEF>P0EGSTghlpstuv'(>?WX01a*agmim^eUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR24?AIJ@BCEtuz{~uyX ` 3 4 6 7 Y \ ^ _ \ ^ 34  CDMNRSWX\]ijstuz,/0;<NOkxyqrstuvwxyz{|}~     $ ' / 0 3 5 6 8 < = > ? G J W X _ ` p r t !!!! !!!!!! !#!$!%!&!'!(!)!*!.!/!2!3!:!;!A!E!J!P!!!!,"."/"1")#+#`$$ * *t*w***|,~,o-p-....//00607080;00000011111122 2H2P2224pq\`ij !"#%'*np78=>?@BCEF>P0EGSTghlpstuv^eUV  :;?@EFGJQR0n !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~ /0Pjm<@IPR&(1489?CILRTfh &4@BCEtu~ 9:PRSTWX\_vx"') * 1 2 4 5 X ` 3 4 6 7 Y \ ^ _ H I K M \ ^ H I J M CDMNRSWX\]ijstuwxy&'     ;<=>@BCD FHNPXYZ[\]^_~  &!'!*!,!!!!!!!"" " " " "$"%"&"'"A"B"D"E"G"H"I"J"`"a"b"c"m"r"t"v"x"z""""""""""""")#+#**L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0e0f0g0h0i0j0p0r0s0u0v0x0y0{0|0~000000000000000000000000000000000000000000000000000 !"#%'*np *78=>?@BCEFO.0KMd f P@$`$0:`jf p f p f p r x f p x  X _ f y PZ 4@Ji}FPPZ@JPZp q t z P!!!!`$$$%v'',,00!0*080;011 2*2H2P2Q2`222224444*8+8M;N;NNNNNN N N$N%N]N^NNNNNNNNNNNNNNN OOpOqOOOPPQQFQGQiQjQkQlQmQnQASBSCSFSLSMSSSVVXXXXz^{^^_ ____bbbbLcMcggmmooss~vvvvyy,-01!"FGLMxy *06Шڨ ЩکPZklstxy4@y $ABJKX`y         @ I }      X ` x      0 : @ J `'QURp6@PZPZ0<PZPmPZPZ$o$0a:a`jjjjjPkZk[kbkpmzmnn`y@JPZq./> de!"* +             ##));;mbnb   34  -. *+  $%!"JK  z{z{ABqrcdklqr./9:ijo p o p o p o p o p YZ)*IJqrOPYZIJYZy z h!i!x!y!h$i$|$}$$$$$~'''''')0*0(2)222]N^N^^ss)*٨ڨ ٩کYZ  9 : I J hiZ[op?@YZYZ9:YZYZbcYZYZ$$$$$$$$+$,$F$J$n$o$9a:aijjjjjYkZkymzmnnhiIJYZyz  67     23  ,- )*  #$  !  yzyzO2P2pqbcjkpq89hin o n o n o n o n o XY()HIpqNOXYHIXYx y g!h!w!x!g$h${$|$$$$$}'~'''''(0)0'2(222kQlQLcMc()ب٨ ة٩XY  8 9 H I ghYZno>?XYXY89XYXYabXYXY$$ $$$$$$*$+$D$F$m$n$8a9ahjijjjXkYkxmymnnghHIXYxy 56     12  +, ()  "#    xyxyN2O2  opabijop^!_!-.  78ghm n m n m n m n m n WX'(GHopMNWXGHWXw x f!g!v!w!f$g$z${$$$$$|'}''''''0(0&2'222M;N;NNbbggoo'(רبשةWX   7 8 G H fgXYmn=>WXWX78WXWX`aWXWX$$ $ $$$$$)$*$A$D$l$m$7a8agjhjjjWkXkwmxmnnfgGHWXwx45    01  *+ '(  !"  wx9:wxM2N2  no`ahino67fgl m l m l m l m l m VW&'FGnoLMVWFGVWv w e!f!u!v!!!e$f$y$z$$$$${'|'''''&0'0%2&222mQnQFGxy&'֨ר֩שVW    6 7 F G efWXlm<=VWVW67VWVW_`VWVW$$ $ $$$$$($)$@$A$N$O$k$l$6a7afjgjjjVkWkvmwmnnefFGVWvw34    !!/0GHVW  )*!!&'FGNOrs   !n!o!~!!EFLMSTlq  vw5vwl!m!|!}!!!L2M222DEJKQRfjtu#$  ~    mn_`ghh$i$mn~]!^!Z![!  \$]$,-  56efk l k l k l k l k l UV%&EFmnKLUVEFUVu v d!e!t!u!d$e$x$y$$$$$z'{'''''%0&0$2%22244*8+8NN OO%&ը֨թ֩UV  CDHIOP_`st!"}~      5 6 E F de!"VWkl;<UVUV56UVUV^_UVUV$$ $ $$$$$"$#$'$($1$2$9$:$M$N$T$V$j$k$5a6aejfjjjUkVkumvmnndevwxyEFUVuv23!"2222222222223$4$222222   ./  () %&     uv89%uvK2L222LSMS  lm^_fgg$h$lm}~     X!Y!45dej k j k j k j k j k TU$%DElmJKTUDETUt u c!d!s!t!c$d$w$x$$$$$y'z'''''$0%011#2$222NNVV$%ԨըԩթTU  |}  C D [ \ { |   4 5 D E cd !UVjk:;TUTU45TUTU]^TUTU$$ $ $$$$$!$"$&$'$0$1$8$9$<$@$L$M$R$T$i$j$4a5adjejjjTkUktmumnncduvDETUtu12dembnb22222222_2`2^2_2]2^2\2]2[2\2   -.  '( $%  kl  tu'tu:0;0J2K2Z2[2ESFSef  kl$%]^efkl|}    Z [ \!]!W!X! t u u v 23xy  ] ^ +,  w x x y 56#34cdi j i j i j i j { | ~  i j ST#$CDklIJSTCDST b!c!r!s!b$c$v$w$$$$$x'y'''''#0$011"2#222 N NNNSS__#$ӨԨөԩSTkl  Z[{|    B C Z [ z {   3 4 C D bc TUij9:STST34STST\]STST$$$ $$$ $!$$$&$.$0$6$8$:$<$K$L$Q$R$W$X$3a4acjdjjjSkTksmtmnnnnbctuCDSTst01    ));;Y2Z2X2Y2W2X2V2W2U2V2T2U2S2T2R2S22$3$Q2R2   ,-  &' #$  :;vv  stIsts$t$$$$$$$90:0I2J2DSES^_\]    E F     ] ^ } ~   jk#$ST\];<dejk{|  V!W!T!U!wx  ~[$\$^$_$f$g$/23bch i h i h i h i z { } ~ h i RS"#BCjkHIRSBCRS a!b!q!r!a$b$u$v$$$$$w'x'''''"0#011!2"22244$N%NNNOOPPiQjQ ____01"#ҨӨҩөRSxy [_YZz{    A B Y Z y z   2 3 B C abSThi89RSRS23RSRS[\RSRS$$$$$ $#$$$-$.$5$6$J$K$P$Q$V$W$Y$Z$2a3abjcjjjRkSkrmsmnnnnabstBCRSrs/0##r$s$$$$$$$nnq$r$$$$$$$nn23p$q$$$$$$$nn o$p$$$$$$$nn12n$o$$$$$$$nnm$n$$$$$$$nn01l$m$$$$$$$nnk!l!{!|!k$l$$$$$$$nn/0  j!k!z!{!j$k$~$$$$$$nn Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 124@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~5!9!!!!!0-h-o-p-------------------/.0.00!0*0106080=0A0000000110111111124MNФ  *,no  #@t &0G`}ϩЩ)@CDL`wz{~ªê۪ު  '(/np)*78=>?@BCEF>Ppuvf  '(;<>?NP^@u -KPvP(0d7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I  $ J P o p '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$o$$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmmoKoPoQooooooop֌ #23PSUVdhpkp}  -7>NOKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#   * / ` e f p 04@4s{pK`pq0K$%().Y\ : = > P Q X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J N W X b d 124;GO56789:>@q+?VZ^abegnqu]`25RTrt  ,0<U_`}4Ekt$8  ,,---.*00000ost~ #(,-ƨ&.GT)7CDLN{~ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu'5EGst,8>?AB;=>EGIKNWXbdfmpu5G^_0A,,;0679;?@ABD 3:;?GHQ\/78@17:;<>?FGH4;>CZ[@4A4G4V4a0ajj0k7kOoPoQoooooooo.0Gejms{BE7;muv"#%&+07DK ["#'*[\]^{|}~:> 9 ; E G }  # #)#+#['a'h'v''''')))))).... .*.B.C.U.].00000 0>@5EGIY_ ;<=>[\]^_abdvy ./$ % RSƨΨڨ`  .0?1.2.$%+,<?^_`a|}~uv    p q  O P y z ?@ 456789mn@Aakt}D E R S z } !!!!! !!!!!!$!%!&!'!(!)!*!.!/!:!0@0001111111122*2H2P2Q2`222224MNǤ "(,6:wz[\jl)*@Pbcdgij >?@A\]^_7@ywy    ?@?@ABCDGHYZ[\]^ ;<[\_`bc@ V X ` !$%(*+,-.0:<?A\]~Z`    jn0?^_d f p q v w w x OPZ\JP`ino57 DF NPZa};@~  ( 0 9 ; ? A D G R S T U _ ,,,-p-q-... . . ........ .*./.0.:.<.@.A.B.C.P.R.U.00=0>000 st~txΨШ.0_`Ωީ\`ު01EGIMPSTX_bhijl !<=abdfopWX  ? @ P Y     9 @   UZGN@Dtv8>KPZ\]^AD`m<?;<DG?G AFprCP p$u$//njpjjj7kF G ~  # # # #*#+#i'j'k'l'm'n'o'p'q'r's't'u'v'''''''''''''))))))))))))))))))))))))))))#.$.%.&.'.(.).*.V.W.X.Y.Z.[.\.]. 0 0 0 0 000000000000000 0>?6789:;<=>?@ABCDEHIZ[\]^_ =>]^`acd)-.  ....:.<.@.A.].^.0000100013XYcd n o  _`? A T U 35MP?@9!0:A[_`a{ ( 0 ? A T U _ !`$%v'',..000!00010>@EG`!$%+,0:<?A[^_`{|}~~Z`    jn0?^_d f p q v w w x OPZ\:>JP`ino57 DF NPZa};@~ ( 0 D E R S _ }  # #)#+#h'v''''')))))),,,-p-q-./.0.P.R.^.00000 00010=0>00000 st~txΨШ.0_`Ωީ\`ު>@0STbcdhijl !;>?@[\]^_fopWX  ? @ P Y     9 @   n o UZGN@Dtv8>KPZ\]^AD`m<?;<DG?G AFprCP p$u$//njpjjj7k?@BCEF@P 0135EGIPST_cdpuv  !<=>A\]^_ef  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ V X ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QUZpIfv56@AHPtvw:;=>B )*1245:;EGIKNPQWX]dfmpuMPZ^bCDEPZ,0:<?@G;   679;EFGPZ?BDGHP  78CPZr  7:;<>?HPZ`fgij;>EP[ #$o$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjk9k@kEkPkZkckxk}kk@mmmnmzm@nnnnoKoOoooooooooop֌ #23PSUVdhpkp}.0GejmBEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjpvy:@ ^KP# #A[      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOpqrsvw0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./1W      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~(08@HNYZ[\]^_`hp!!!! !!!!!!!!$!%!&!'!(!)!*!.!0!4!>!@!E!F!`!p!!!$$,0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklm"#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧЧѧ֧קا٧ڧۧܧݧ!;(p{|  P f @n`n4Nh  8:;?@EFGJQl"<Vp5Vo"0JPjp!"?@ 789:=?d f JLbcgino57  DFNPZ\^`};=~< > G J ,,../.<.=.S.U.00vxΨШ/0ȩʩ]`VX abV X UZGIAD8:;=KMAC<?DEFGBDACCEnjpjjj7k9kDkEknmpmnn ! / 0 _ ` 00( * ),.:<~]^    0013PRTVXYcd de0:`jkmf p f p f p f p f p PZ *@JFPPZ@JPZ *Шڨ ЩکPZ0 : @ J fp6@PZPZ0:PZPZPZPZ0a:a`jjjjjPkZkpmzm@JPZCa{      !"#$%&'()*+,-./012345679:;<=>?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~      !"#$%&'()*+,-./0123:<=?ABCGHIJKLMNOqrstwxz~0`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0`      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ (08@FPX`hp~q r  ! !!!!!/!0!4!5!9!:!!F!J!N!O!p!!!!$$0,`,a,b,e,g,h,i,j,k,l,m,q,r,s,u,v,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-&-'-(---.-ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn#$%&'()*+,-./23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnoyz{|}§çħȧɧʧ˧ͧΧѧҧӧԧէ֧קا٧ڧۧܧ0[\jpA[(P  p  `nn4NUVh8Rl"<Vp6OPVp  %+0n"DctuYZ`p'    !#&-/01   @AKVpqKMP`kpd f -..*+p ))'( -.12!"./?@ 789:=?d f JLbcgino57  DFNPZ\^`};=~$ % < > G J ,,../.<.=.S.U.00vxΨШ/0ȩʩ]`RSVX abV X UZGIAD8:;=KMAC<?DEFGBDACCEnjpjjj7k9kDkEknmpmnnP(@A0Zw p q  O P y z  456789mn@Aakt}!!!!! !!!!!!$!%!&!'!(!)!*!.!/!:!0@01111111122*2H2P2Q2`222224MNǤ(,689:wz@P7@ywy  ?@?@Ad f  d f 0:Q R 0689PEik/0IJhiVWXYbc-.q r H!J!|,},"$VX&(Z\*,^`LNhi\A[a{tu~   @Ad f ?@57  e f q t  !&!'!*!,!2!3!N!O!`!!!!*$@$K$`$()t+v+++,.^./0000!00080<0@0000000111111 2`22223X34MN"0:./ϩЩ[\jl>@0STghl!;A[fpq47@P')gj{W`yUV  :;?@EFGJQRq>,0<@IPR`fw{ HPZ`T`np} ǤHImq;@\ 0-h-o-q---    ) * : < E F I J N U W X [ ] ^ ` d f p w oop %  Pnpu`mnqrt KMP`k-0Z P.0? ( 0 : ;pKVpqQ U   *0.000 .;<.0Ggj{      @xP{p      ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x  I  `   y`mEPZ    E F I J P T d f       @\^_Pw : ? @ Ф  '(;<>?NP^7@V`h  ,0<@ADPOA[a{&,]bfkxyq r  *!,!2!3!N!O!`!!`,,"ΧЧҧӧԧէݧ0[\efj!;A[%+ B000112223X3fpq #UVdh./0ΩЩکީ       A0000 23PS78=>?@BCEFP 5.00011122`22`}-....//0000!0*080<04MNnpoooo:@ ^KP#!      ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w a:a Iptuxz~&+]bfk FHNPXYZ[\]^_~&!'!ef@F )*1245:<EGIKNPQWX]dfmpu0K  7:;<>?HPZ `fgij ,`,"#%&+-&-'-(---.-@ f i    IIJNPWXYZ^`[]}------------------  '(/( kp}<  Q U d f  0+,xy-.@.00n   679<=?@//,,,-p56H@T 10111  6 9 @  1WYw   @AKVpqPp P>@puv` !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0dopLPZ^`+$%   ?@ 89ij  #'*,/0<?@A\]^a|}~uvxz01WYZ]^` jkmnKM.789:=?@\`kpp q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789HImqLPIJNPWXYZ^`[]`bcgimn7@T`mnqrt   y ,0<Dnpu _`}MN\^`kt}8;=@JM FHNPXYZ[\]^_~     $ % ( 0 9 ; < > E J _ e f p q r } !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//0V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooo #UVdhkp}.0GejmBEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjp   !   _ ` 00'(0:`jklf p f p f p f p f p PZ *@JFPPZ@JPZ *Шڨ ЩکPZ0 : @ J fp6@PZPZ0:PZPZPZPZ0a:a`jjjjjPkZkpmzm@JPZ ( * ,-;<~ lmD E PQTU :;_`' ( UV ./  $ % RSA[a{puvxz~01WY]^_` Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z @HImIJNPWXYZ^`[mo2@R`mnq y4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!Ppuv!;A[  '(;<>?NP^@u -KPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$o$$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQoooooookp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~0JPjp106000000112223X3f #UVdh  * / ` e f p 04@4s{pK`pq0K$%().Y\ : = > P Q X b d   < = > C G I K N Q R p r u v   < = > E G I K N U X b d  < = > E F I J N U W b d  ; = > E F I J N W X b d 124;GO56789:>@q+?VZ^abegnqu]`25RTrt  ,0<U_`}4Ekt$8 ,,---.*00000ost~ #(,-ƨ&.GT)7CDLN{~ª 0v{      8 ; ? @   $ ( i n FQ8Gpqsu'5EGst,8>?AB;=>EGIKNWXbdfmpu5G^_0A,,;0679;?@ABD 3:;?GHQ\/78@17:;<>?FGH4;>CZ[@4A4G4V4a0ajj0k7kOoPoQoooooooo.0Gejms{BE7;muv"#%&+07DK _`/ 0 ? A T U 35MP?@"#    " 0 2 ; = B C G J Q R e f !!! !!!!!!!!$!%!&!'!(!)!*!.!/!5!@!E!K!L!N!O!!!!""4"6"## # #$#)#+#,#}##########$$$%%& &h'v''+0+P+Z++++++++,P.R..00000 00010A0B0C0D0E0F0G0H0I0J0c0d0000000000000000000000000000000000000'1(1122X3{33Ф` 0ISX_cgp  ;<=>?@[  0FoE00A0B0C0D0E0F0G0H0I0J0c0d00000000000000000000000000000000000'1(1122X3{33PS  )#+#000 000100000Y_ ;<=>?@[a  " 0 2 ; = B C G J Q R e f !!! !!!!!!!!$!%!&!'!(!)!*!.!/!5!@!E!K!L!N!O!!!!""4"6"## # #$#,#}##########$$$%%& &h'v''+0+P+Z++++++++,P.R..Ф` 0IPXYcgp a  0Fop{| ,#4MN !"#%'*:@ ^KP#! 06^_pjjjj Q S d f 0:HImq0 0 12;@\   `j 57  0-h-o-q---!",-./:<?@~      067?^_d f Z\  JLaino57 DFNPZ\]`};@~$ % < > G J ,,../.<.=.A.B.L.M.N.P.S.U.00 vxΨШ/0ǩʩ]`ߪPSTX  abdeWX  V X   : @   UZGNAD8=KNZ\AC<?DEFGBDADqrCEp$u$njpjjj7k:kDkEknmpmnn#Q S d f    ) * : < E F I J N U W X [ ] ^ ` d f p w ê۪ /011oop 3Q S d f ;=       @JPnpu d f 0:` 57`mnqrtMN00000000Ǥaf   `j  #$o$p$u$$D%YA[a{puvx{~01WYZ` Knpq0M$%()@Y`kp : = > P Q X b q     ) * 1 2 4 5 7 8 : Y ] ^ _ r u     ) * 1 2 4 5 : = > \ ^ _ b q r     ) * : = > X [ ] ^ ` b     ; = > N O T W _ b z 123@G@HIm+?@PVZ^abegnquIJNPWXYZ^`[mo2@R`mnq yPnpu U4EM$MPZ~ FHNPXYZ[\]^_~q r  !!!! !!!!!!$!%!&!'!(!)!*!:!?@BCEF^d>Pqrstwxyz{|}~!;A[f  '(;<>?NP^@u -KPv(0dp{|7@V`h  679<=?V`w   :            6 ` }        6 @ V ` s    I      $ J f o  '(0Fp8qsuv'DEGHPsvw,?A )*1245:=>PQ]b5GK_b0DE@G,   0?@AB 3:;PQ\  /@Ar  1FG`fgij4 #$o$$D%//004A4G4`4CDGFaah9j@j_jpjjjjk0k@kDkckxk}kk@mmm@nnoKoPoQooooooop֌ #23PSUVdhpkp}UV  :;?@EFGJQR56OPop%+0n-7>NODKL !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#A0:A[_`a{uvx{~01WYZ` jnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z ;@OPZ *56789:>HImqJPIJNPWXYZ^`[]`irmo5@T`mnqrt  y ,0<Fnpu _`}MPZkt8@JM~ FHNPXYZ[\]^_~  ? A T U q r  !!!! !!!!!!$!%!&!'!(!)!*!:!?@BCEF^d>P 035MPqrstwxyz{|}~!;?@A[e  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  '(0QpGfv56@DHPtvw8>B )*1245:;EGIKNPQWX]dfmpuKPZ^bADEPZ,0:@G;   679;DPZ?GHP  78APZr  7:;<>?HPZ`fgij;>CP[ #$o$$D%//004@4V4`4CDGFa:ah9j@j_j`jjjpjjjjjjjjk7k@kDkPkZkckxk}kk@mmmpmzm@nnoKoOoooooooooop֌ #23PSUVdhpkp}.0Gejms{BEUV  :;?@EFGJQR56OPop7;muv%+"#%&+0n-0>@JNOLPZ !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~:@ ^KP#E  !"#'(,-./0<A[_`a{uvxz01WY]^  jkmnKM.@\`kpd f p q       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f v       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f p q r    ) * : < E F I J N U W X [ ] ^ ` d f p    E F I J O T X _ d f p z 124;GOPZ *56789:>HImq+?@JVZ^abegnquIJNPWXYZ^`[]`mo5@T`mnqrt  y ,0<FPU_`}MPZkt8@JM~ FHNPXYZ[\]^_~      $ % ' 0 ? A D E T U _ e f p q r  !!!! !!!!!!$!%!&!'!(!)!*!.!/!:!?@BCEF>P 035MQRSTVpuv !;?@A[f  '(;<>?NP^@u -KP{(0dp{|7@V`h  679<=?V`w   :              6 8 ; ? @ ` }        6 @ V ` s    I      ( 0 : @ f i n o  j H + '   + ,@S Z w Ce  TR=C zj D$u Vyw  $x>0 u CAWw !!(*C @  %wZ =+Z BtRw%v=Z H x  %A  Y  o  @DK  Ji3   RZv4 {wArf6 ?5 &2T`] ] fR#C A f> ;CZ(fi3R 4:% !w R3  !uf O6 _! puQwwwS<uj fC   "!  7L Ff =C   t% Z u Q Fu 5% Dj %  ) U0l    f & qgG B6f_AC,@CJ S  D < W  -RWrR^vfJ !  Z Ik  M4!? &a/ i3u fFvffB" R + Jn '   5CCZ #|3$CT2 u B[t f> ;~ 2) Vi <  Jw $%   VF0Z    %uN  _+[+ uw "Z [+]  =  Z +Z / R xm 0- 3 nf8ctBu2CiW" V %"R`M]R`22  +Cq+k$ (1 !B X  . Z f}uC Z ftw S  $8"b`c" X. % (nA  RZ eh Z  U P&w{iRy1A4 [/AxZ >  @ S $  u RR@An  QR\ $ (B@* Z !"cCRG -  RJ!7Z @  8fvj ;<" @'. O " U 0  Z  fA i   ($ 2  P?Z,x" c*7W>  .M4 A OmlRBk  ;6 *'  82&Rp f3 !Z N*-f px LZ .Ri,R4  UCZ CC' Z "+ / Ci  @ ) ,, 3 KIf C MJ!C|f  4t~C wS'fwm *$V]Z(Z j4  G\j 6 wN(A AMquA] Y9"!f$ HR aA}4 ~  R@ ?jRn gCaRb5$4uzB +pj^ ;  hkE  J     )JJ CF K  nRQ  'bu."5  d) % 2 qt $^nTp ft" yC /2 S  8f67V  *BZ   fw " ; "qP 'X ; jw "-t$Rp:.  , " uS ' nZ V"+RU"CZ  VpwQ Z >Zk  C~ 92X p HX#Z ].5^\Iv;w Z C @ f5xw *  )X] H*  % 7, (4 V     <C + " g7g 3" X 3 f!`2 {".5:O5~  :  > T Q 0 [iw   ep /aR Z  M d,4    CC_  14RLZ n ; f u <\ ? C  js j * C`b0RD+9[ w R.Z 6  A$v0eC_ K )pzZ |rIZ cw#C%) S- $F uL/98$j u  FH2  d O  w t=Z S!  uK-=C sf Z _mt*!   8f  wL  w  Z , 1  e' -w^"!  ft!  f^) wZ(w 0{ARD[0 X      d"pb Z  pRC M%+^  WrCT~" +f^Y <f(MwO<2 9 UuCF@wC mf"RvRCw   s b  =D [wj ]" T ([w m t !  % )GZ D C    ~  ' C'R  5  R`2f{ uN * C uj C v t  +f3A {j Kp/    t @  2f"[ 5f]:!   e f|"A  n  <fhD R 5f~A, wW  j 6 ;p  w   MFE X RJsR wGV&fPCT Rl&cwlmcmocradlmaghbahexahomarmiavstbatkbhksbuhdcakmcanschamchrscpmncprtcwucyrldsrtgonggrekgujrgukhhluwhmngzljtkawikitskndakrailaoolatnlisumedfmteimymrnarbnewaoryaosgeougrpcmphlpphnxqaacrjngrunrsamrsgnwtagstamltavttfngtglgtibttodrtutgwchoxpeoxsuxyiiizanbzyyyzzzzcntrlcwcfcwkcfcwtgarayzpgcb=h2vfjlxxnushu3040nv=90oriyapatwsprintqmarktailetakrivssupfsipdfcarianccc=12318491vre=yeschakmacwcmsmlsqrgothicgrexthyphen3.26.3415161miaototoarmndiakgonmhanokhmrlinamroonkooogamolckonaoorkhphliplrdprtiqaairohgshawsogotnsavaiibehgafhahrehbunkhojkilydiannfdqcnv=3//5nv=7olonalpatsynrejangsb=stangsatodhriebg2.13.04.06.07.08.09.052avestanccc=22e=truedeseretdt=nonewideelbasanelymaicextpictgrbashanunoohst=lvtadlambuhiddogralimbuoghamosagerunicbatakeemnoonseenshinzainkannadakayahlilinearamandaicmarchennfkcqc-1/2/645/217/2olchikiosmanyahmnpkalilananbatsarbshrdsyrczinhsharadashavianstermuaatagalogtaithamtaiviettibetanuideounknownage=10.0age=v1armenianbalinesebassavahbpt=opene=falsecompexduployanextendergujaratigurmukhihiraganahatrankaithilepchalycianteluguwanchoyezidijamoextbgamalkhaphkiratraimahajaninfkdqcnv=1/31/12erlwordlinbmercnshuscx=talupecialstagbanwatifinaghugariticvithkuqipfabhaiksuki2435nuktacirclemedialea=narrowmoticonsbengaliincbincjkexgranthainheritedinkanamakasarmultaninoblockphagspasiddhamsoyombosunuwaruabtirhutaiscjkexlamadhkhudawadinabataeannewtailue1600032000olditalicoldpermicoldturkicolduyghurpalmyrenepaucinhausamaritanthaanawb=mixidstartbasiclatinboxdrawingccc=ccc1chorasmianstrokesdeprecateddivesakuruorizspacebugineseingeorgiajamoextajavanesebinduiskanathinyehkharoshthiiscarrowsnagmundarioldpersianphoeniciansaurashtraolettermallformssoftdottedwarangcitialetternewlineerlspaceblk=cjkextdoverlaycyprominoandominotilesfractionisolatedgurungkhemapfb=linkerisarabicisspaceisvertfarsiyehswashkafkehnomirrorlinefeednextlinemedefaidrinnfcqc=maybepahawhhmongkthiscript=mlymsorasompengerandsubsylotinagriebasegazyisyllablesbidicontrolbidimirroredblk=kanaucasextahesssymbolsambiguousgraphemebasegunjalagondiompatjamooldsogdianvisargayiradicalsisposixsyriacwawjoiningtypekehnorotatebothh3jvmasaramgondiathalphanummendekikakui1.0.111e-01.250e-01.429e-01.500e+00.562e-02.563e-02.667e-01.875e-01nv=2.500e-013.125e-02.333e-01.750e-01nv=4.167e-01.688e-02.000e-02nv=5.833e-01nv=6.250e-02nv=8.333e-02oldhungarianphaistosdiscplayingcardspresentin=14tulutigalariwsegspacexidcontinueegeannumbersblock=cjkexblockelementscaseignorablunassignedreekextendedvoweljamoincyrillicinethiopickatakanaextiscsymbolsinmyanmarnandinagariavagrahatonemarkipaextensionsiscasedletterisgeorgiajoincontrolismyanmarisotheisxposixblankjg=africanfehdalathrishknottedhehreversedpe=nonjoininglb=breaknonstarterwordjoinerowsurrogatesayannumeralsisctechnical-5.000e-01patternsyntax5.26.1verticalformsncientsymbolsbc=righttoleftblk=arabichanreadingemojicomponentgc=othereekandcoptichighsurrogateslphabeticpfkhmersymbolsnonjoineriscyrillicisethiopicmahjongtileskashmiriyehrohingyayehstraightwawyehwithtail=dualjoining=joincausing=leftjoining=transparentbeforeexclamationinseparableinseperableviramafinalnfcquickchecknumerictype=epresentin=v1psalterpahlaviquotationmarkdoublequotesinglequoteany_foldsquotemetaasciihexdigitarabicletterotherneutralblk=georgianblk=myanmardoubleabovekanavoicingontrolpictureseastasianwidth=letternumbergraphemeextendeadingjamoimperialaramaicoverstruckpurekillerdecimalnumberenclosingmarkfinalsemkathverticaltail=rightjoininghebrewletterinfixnumericmeroiticcursiveiscpictographsnfdquickcheck36numericvalue=4oldnortharabianoldsoutharabian=extendnumletglueafterzwjzanabazarsquareblk=cyrillicblk=ethiopicblock=arabicnotreorderedcypriotsyllabarylineseparatorhalfandfullformshighpusurrogatestrailingjamoidsunaryoperatorcompatformsgxiradicalsinlatinextendeddphoneticextsupdevanagariextaislatinextendedisusupplementnonspacingmarklllajg=malayalamnnnamemtawktoviknumeralsaksaraprebaseprefixnumericinearbideogramsiscmathsymbolsanfkcquickchecknumericvalue=1/numericvalue=5/8numericvalue=70numericvalue=80numericvalue=9sentenceterminaltangutcomponentseuropeannumberanadiansyllabicscaucasianalbanianiotasubscriptemojipresentationgmodifiersymbolspaceseparatornotapplicableidcompatmathstartidsbinaryoperatorbraillepatternscurrencysymbolsindicsiyaqnumbersleftandrightnumberjoinervedicextensionsdashpunctuationdiacriticalsexthangulsyllableslowercaseletteropenpunctuationhamzaonhehgoalbethfivehethjg=manichaeankaphqophreshyodhqaphtethkhitansmallscriptcarriagereturncomplexcontextmandatorybreakpostfixnumericetterlikesymbolszwspacenfkdquickchecknumericvalue=3/2regionalindicatorscriptextensions=mallformvariantsttonsignwritingboundaryneutralcommonseparatorblk=latinextendedblock=cyrillicextcopticepactnumberstitlecaseletter=uppercaseletteridstrinaryoperatorinitialpunctuationlinearbsyllabaryiscmathsymbolsbbopomofoextendedclosepunctuationfinalpunctuation1supplementyriacsupplementalephgimelsadhezayinlaphzhainadditionalcontingentbreaknumericvalue=6ornamentaldingbatsparagraphseparatorpatternwhitespaceruminumeralsymbolssegmentseparatorbamumsupplementdiacriticalssuptamilsupplementblock=kanaemojimodifierbaselchemicalsymbolsindicconjunctbreakgeminationmarkvoweldependenthanifirohingyapadalethlamedhsamekhtwentyyudhhe=closeparenthesisodifiertonelettersottomansiyaqnumbersatermarrowsawordbreak=mi_perl_charname_beanatolianhieroglyphstangutsupplementblock=latinextendedconnectorpunctuationextendedpictographicombininghalfmarksneralpunctuationvisualorderleftmodifyingletterregistershifterinscriptionalpahlavitaixuanjingsymbolscherokeesupplementmallkanaextensiondhamedhhundred0000000000000000nyiakengpuachuehmongterminalpunctuationverticalorientation=europeanterminatorfirststrongisolateattachedbelowleftchangeswhencasefoldedchangeswhencasemappedchangeswhenlowercasedchangeswhentitlecasedchangeswhenuppercasedgraphemeclusterbreak=identifiertype=notncientgreeknumbersountingrodnumeralsmeroitichieroglyphsantillationmarkinvisiblestackerreorderingkillersyllablemodifiervowelindependentinscriptionalparthianinsupplementalarrowsbnclosedalphanumsuphanguljamoextendedamongoliansupplementsundanesesupplementissupplementalarrowscaksarastartlogicalorderexceptionnoncharactercodepointsinhalaarchaicnumbersvo=transformedrotatedyijinghexagramsymbolsoverridearabicnumberbidipairedbrackettypeblock=ethiopicblock=georgiablock=myanmarmathoperatorsfontdiacriticalsforsymbolsarlydynasticcuneiformidcompatmathcontinueinsc=consonantprefixedglagoliticsupplementburushaskiyehbarreelinebreak=breakmodifiercombiningmarknumericvalue=2.5.125e-03.750e-02.250e-03bc=lefttorightembeddingpopdirectionalformatblhanguljamoextendedbhangulcompatibilityjamoobsoletecompatibilityformsradicalssupplementsubjoinedjoininggroup=africanqafsentencebreak=shorthandformatcontrolsznamennymusicalnotationhighprivateusesurrogatesstatus=allowedinclusioncompatideographssupommonindicnumberformsiscellaneoustechnicalinpc=topandbottomandleftbrahmijoiningnumberheadletterpacingmodifierletterstransportandmapsymbolshanifirohingyakinnayajoininggroup=malayalamfolds_to_multi_charmeeteimayekextensionsdevanagariextendedachangeswhennfkccasefoldeddefaultignorablecodepointfullcompositionexclusionlimitedusebyzantinemusicalsymbolsgyptianhieroglyphsextaplaceholderwithstackerometricshapesextendedsuperscriptsandsubscriptscanonicalcombiningclass=27halfwidthandfullwidthformsrecommendeduncommonuseinarabicpresentationformsbombiningmarksforsymbolsprependedconcatenationmarkis_in_multi_char_foldeuropeanseparatorblk=supplementalcanonicalcombiningclass=128nclosedcjklettersandmonthsstatus=restrictedymbolsandpictographsextanojoininggrouptehmarbutagoalopticalcharacterrecognitionbidiclass=lefttorightbidiclass=righttoleftatarprecedingrephatakanaphoneticextensionssupplementaryprivateuseareaacanonicalcombiningclass=ccc1succeedingrephalphabeticpresentationformsancientgreekmusicalnotationconditionaljapanesestarteriscellaneoussymbolsandarrowsdecompositiontype=nonhangulsyllabletype=lvtinitialpostfixedryprivateuseareabegyptianhieroglyphsextendedavariationselectorssupplementjoininggroup=manichaeanthamedhpopdirectionalisolatenclosedideographicsupplementathematicalalphanumericsymbolsgeneralcategory=otheideographicdescriptioncharactersincjkunifiedideographsextensnclosedalphanumericsupplementiscjkunifiedideographsextensuneiformnumbersandpunctuationymbolsandpictographsextendedaaboveleftiscellaneousmathematicalsymbolsablk=cjkunifiedideographsextensbelowrightideographicsymbolsandpunctuationmathematicalalphabeticsymbolsdoublebelowombiningdiacriticalmarksextendedindicpositionalcategory=topandinmiscellaneousmathematicalsymbolsbgyptianhieroglyphformatcontrolsblock=cjkunifiedideographsextensindicsyllabiccategory=consonantiscellaneoussymbolsandpictographsombiningdiacriticalmarksforsymbolsymbolsforlegacycomputingsupplement_perl_problematic_locale_foldeds_compatibilityideographssupplement=bottomandrighttransformeduprightombiningdiacriticalmarkssupplementblock=supplementalmathematicaloperatorsattachedaboverightisunifiedcanadianaboriginalsyllabicsextendeda@ A( (!0 `  0000PP(( hhhhn  ((   !  ( * % xz01WYKM.0?@\^_`kp       ) * 1 2 4 5 7 8 : < = > C G I K N Q R Y ] ^ _ f w       ) * 1 2 4 5 : < E G I K N U X \ ^ _ d f x    ) * : < E F I J N U W X [ ] ^ ` d f p w    E F I J P T d f ;?\HImqIJNPWXYZ^`[]}7@T`mnqrt y ,0<@ADnpu_`}MN8;JM FHNPXYZ[\]^_~ e f r t !!!*$@$K$`$t+v+++,,&-'-(---.-0-h-o-q--------------------^.....///@0A00011011111112 2ǤФ,@ΧЧҧӧԧէݧ-0:@xƨΨڨT_}Ωϩکީ7@NPZ\ê۪  '(/0lpnp78=>?@BCEF STghlpuv  '(;<>?NP^47$-KP{(0do{|7@V`h  679<=?VW  : ? @              6 8 ; ? I P Y `       6 9 V X s x       I      ( 0 : @ f i    `(0ZpNRv56HPwB )*1245:;EGIKNPQWX]dfmpu\]bEPZ`m,0G<   679;GPZHP   78FPmp  7:;<>?HPZ`fgij;>[#$o$p$u$$D%//0V4`4CDGFa:ah9j@j_j`jjjnjjjjjjjjkFkPkZk[kbkckxk}kk@mzm@nnoKoOoooooooop֌ #23PSUVdhpkp}.0GP')FW`yUV  :;?@EFGJQR%+"#%&+0n-0>@JNPLPZ^`q> !#$%'()3489:;<BCGHIJKLMPQSTUWXYZ[\]^_`acdegklstxy}~,0<@IPR`fw{ HPZ`T`np}:@ ^KP# >A[a{~?@  / 0 O P Z [ ] ^ e f q t  !&!'!*!,!2!3!N!O!`!!!!*$@$K$`$()t+v+++,...0.2.<.=.A.B.C.D.^.000000 0!06070H2`2222222q3{33334MN"[\jl0EGSTghl!;A[aP')gj{WryUV  :;?@EFGJQRq>,0<@I`fw{ HPZ`T`np}  ! / 0 _ ` 00) * ( ) H ! ( * / 0 _ ` 00Ф l Z j 1h," [ 8Q C l9"j r  Z '  Z  Bm' C5 eZ +}&fZ T 5= TR1 UJX*  "*C"9fEIa7*wZ ^\#+   4 f.qc7hCCfGZ +  +,u% Q9G_v  .C |A1 2P AN  wZ   A @  6 of+0i"  r ^ [)qdu fl|u )T@ ? H aukBlF | ru ZzR_ Kp>*j %i2%!  >At8   $#RN  ) ] % 3 i u MC@   L Z |OQ . h Bu+--  *  Z $6  j Z .    ) X) $  ko@uj T&  4CusRJsK.^ U] u a> B  p~fz  %Zj?F !|pwQ ?'&f(Z 6  ?Z w f.J  2CURH ^\v ~  ?f4W*! Z ;X"r K  ~ j qC ^v" *'u<>+8 u S R7  ^ ,R  c 5~[0" ~ ?J2! mlw  qJ !+N $ 2<w>CMf c *]fIZ s XfAZ R)J  }C!Bf"bf+ s] C ^   'u' P  Z l  X YyC  e "  '1] l *S  RC  Tn j  2 [ p x*4Z !  ?O, u5 %4 ^ " + ZC    # /"  1 Z  Z : +f RXt4^ \ ' +jZv Z M@R/1R  qf  Z \A ) _W " 5D v <u) BR0 w_ 1 .  '6 !f R~  ^\ f1C7  TT OFR3 ki  ^ f5{r4#'6 Fw+   /2b *8)  Nuj "*" #/H T7/  uuZ 3Z `C]rw  +lRsuMO S flX] U!02] "j  }  QMuO!["f {  Lk f R 3  j VUZp]f: U Cs. e jmRV"ff . fCZ  R  @) X3wNafsRo"Sr!C)  f> !A  Z p 8 !D{""2 z   C[+) ~  ?X"  * 8)R[!dI DR5  !/+)R/mf b+ + fmw  X$ (p, |4 e3REC 6 I7 Cy2@2Z0t[/u(R % @o   -Wh" 4 >,!   R<Z ^R. 4 Z^({Z 6i *t f   Z  V; f/ C_j l]  C =.nP"Z =J3  !O&D{ tj   f C|+pi RV   8 DRS % ^  Z |  / LAhC R ,   Z }+q7_Ad  &b5+ HuRe kRIda | C  ", { Z \  9 Z5 !fZ4 Dfb>hwcv  #.wfPI t! f_ 1> yE W* Af- ]Z C b .A#{pW o w puQ R  CR>; v $ = -   % Rw "j  @f% [ t > " )6 cq? OK  0_ * W$.t fkZ "I IywD w<( ud%8 f"}4  <R j  c*U!B_% 7/v$ RW 5   RC puQAh Cs  #% yh]  P Z z A    C [4 NtZ ]  "!ZS\? f/ pm Tf} o fhZ ww! 5 %R.r v  $  S*F:   FAlC C RP{o  _t5  m h{ `xa:5x2k$ ctR  2G     k(  u I %7;u A , WbR =RJ7{. ?f  nwP@Z AS R Ci 2?)   6>  6G/a# 8Z  ]  CF :R <u>V"Z P 3  !EH  Z 3  w)R-0[+:  "RLuEvI u   @  jRW" #'  <6- 2 !D_A$C! <4 (  % f] 3 j #Q [  f/B?Z % 3koA\ ) 5> [+ \Z  mXh u*Z-S!b ;C2 Z R\ -CV !f@ ?   M  ' AC v 6]w Z  CtCo =&   "a  >;\ A205(a yC  c f_ 1Z Z e u E  "+ *f') 9 C  WQfZkj  v$I   pA#R|  AC| Z  -  *   "   z IS:j 0 ? eR'Q Q %UZf6:fjj > e  +*uP? JfZ ! l  Z  .   w  B4      l ;  # + b  )T f:  u P  fj  mSD   2TR  d A|C/JaRdM  hF   $Ci& X!.7 >]R[u qI5iu  u BJ !'-  ~  u! A t" <#\ 't2ffNf" NZ - 2s!dww !- >J <kDI5{NRC6Z  1   *" ; AR="  ? ]  n Al (d fAC ]#{6 '(  wj   ,  9R(f Z 4  C {2 C5c]u *4 > TI   'C5;5')Q $vZ ~ j^    Rn@ B4 ? C_u D- )ff w[ p_ ?.Hjv *=j  !!(  *R * w*  " R /O _p%\ M l 1   z> ; ?fyawP 0 . u"+f2Ub4 j U* Bwg   ' .F q6 w j  =uR9j  @yT   wW-`fT 3m Yy 0 3"  8 <Z (7UX2eJ kfUA   ?x Y "'R 4) a=S fu x K!eu(  H : 8 L A; af :RG  f4 :  UZ  u I"bC  [   Rq;h syRZRJZ$f3RJaT Cqf  "fH t wZ   n #f!B fI  % n @X-=R4CV"R <," [ ,  tH !< d  &V*'Z    @ CR5fXyC l: '" "h 9w ^C.uMwOi3io_"^ @AXhJ 4 KB u?6!w jo u&AR  *G3w>u " *~f ffg45Z Y_ C v  bJ !!(QZ  @HR8j bj d!u PZ -htq  %RJj  m B(P4 1fOfko!S uf' Gw| J YR0     f " V R ]| +w SZ  pR P<nZ  @RH) W"B 8y) *] /RP _ 1'-CS#  9  uq Rno u>  R37 Iqz1"Z    Z  j  tfp+v@I v  Z  ! |;r B &wRN4 Df 0wf Z X5,JY" 7Z H"Tf- Z I AR  F ; . ( I^j eFZ D? f4LuE j  XR,"0z.   !!j ^ 7+  !Ubo w2 R7q  [Xd N Cr v N H  C N2R*  . 0fA +g )#C`   I I R;' !f 0.LT\ N{s6  o 2%Z i |* &TRuj ?})    !R   % % (*JZ * 0f-> ?x5 fViR7 ITQ _" w/ 4 K  dn   vR_A(%PA  26'R C$Z ^\ h   SG@?d$ ?pnwP% o C wZ Ydwa 8w ?- )f  [/ R}W!o.~w" 1A  <w> R M r5Z  4 6 u*% R#Q (!BR  7?AI A, NAM (^\* 8@ 2$gAC #   y^ ! ) .-w" R4 LQ %w #Z `b:Xi  uf0- QZ  Z  " I I  | w Z  C>p Z   7 d mD < ,&WAv= fRIN $ 7Cu(  5 %6 <CD+Cmm f9 @ f3  ; R T 3l / ~Rpxf %w #l!  P{ 2uk $1qaZ N C|r _tC"!RBZ \ d C   6R\"  ,A RRnt!v  2Si,hk MC.  R[. 2n1 w A.Z  C\ Ajt q Ag&gIO] Z !B"j | k Z  fV C80ZVy wR{t*!"B7u w 7!Z y  ,u+x  F j R5 2.@C!- k U.2 2Ok!Ct8A`+Rz!D)   $ PR @w^\4  f % -  j _  f7fu)^B ^F !;!$"  ;45R~S  Cj 1 FQ "4 R5!fh   /  FJ Z ],T *yM |;Rg|W:9  Gw!n 'j >  J0f v eP" =  ;Z C{WuEf$ R} nm" $ 0 1f.! Vj  fl )ej ; fRw j!f6  !B   W ,oeu LytR] eb ? Z W: [+l^6  7R!  zZ # s ff] D u<$ "z^\+  W: ` y ]H(^\Fu2," 03 _ 1"n0+C F q^GO >uCD fJ _"Bw ^u)w- J(Z  1 :Bw  _w"TI S5Ruj4J!  M R$"  M2!  (R+ q  M Q] r K !vRCp :R;GD fT &I&  (" l1  B8uf.|PHx   ZO]!  Z '  @^)!G8G wdp CI j9"!C @I1R B? wN   *C'Z H 2jw Sf. cpZ  D  L=A!J!l  &1 f" .(*n 'Y vN ,f CV 4x  ]bXn<w@A, RK !f >;y*f$vC p .) ;6<\ ;  fR   Cwf <R:C~I /  w' 19J Z ~w 6 j MZ 9R_F fV&Z _=) )7 A Puf G 6$ WD  wZ nPRLf+"  2  6jt hZ'u<R? _ *uR 'pf~u 5xZ 7Z   ..RbJRZ"wP7 i _#  =>' R}!  { LZ jm@f[F GRICV: N <!CRB?fC 6CXyd2X}Z J2 %pTC Z  6 F Aeu-u A  !7GhHC f  R( R= lL ` h u Om') [, > fk8D =$ wp AnAB_  W    u'C2 |3Ce M/C] C !D  S   X C ;[R k", HZywBf  7 Z a:A:RvXC+<a7 Zk @$" 91^ R.  " T (C[Q B V"E  ZY{ @  $C 3tC+i.uWZ {""R Yfp _   Af 5R#D Z 1"  e f_ 1 0 )4 I3b V  U 4 TEJ "f s!C} }CH4 !S +S *Q Z -067 '] R`f]  -u  ]) _R8- j *A " c5 ,"  3iq^j Iw^]rC 3* ^  iu^\'Q MuOb #Iz " ]! w% 2+ b: b # @Z  HIRZ > R D  <RR nD R I X [/Rr]  j  ?ZOuAt?) V f  <&  pT"  &e@Z !A+Z  CRZaC} R3b'/ 82R >  R qIUAITRiCz$;!IL] Aw  f  3w  =&+;h w "fNfw "#,"fuCH 5 % R ]#8~  ,Z "4 !'o f '  %(*t! ;5P9S2 [vZ ] UCnr t K 3  !A! % CY BwFR Y !uE^.qQC> R ?Bl A =&&) V% X u? "",b5^FA" | ! ) R6dau.">   r !tRu4 :" Z %! uL ){$ % 0 I2  ^\^uPB S >| !) f""Z ""j +[CC Hpt/N  &{ l9A "R4 XZ  RF"  $ Z  pe@ RSu+y  5 f9wY  n| CV j x6J5  #F|A O*^%b@RZE $IY{Z Q  t vw Z m  i $Z "fu  *TZ !)"C u /;2mhf  8ATY+4Ff-x nuP(2/N#o 9l l  v u"6 9Z p ! nuPp u B< pQY   P]""AW5 % 7\(C M W 2) C  K*9"!" Q C\+iRl{Z  _u F C Z T ERC~f&RVAg@ NQ ; S;u   Rb # '    ZP&3  @'f' q At %f'Q  _uqR; p   W e<T 7 ,R w 9<j 1" ) R M^ +w't"A  UuN*`a  $ 7 {B/C  @ .fpq _ CVsw!@C !w!!m2X~\dR "C w R' mvR[0  =  LRC  X"x  ?R+ ,CC  , R/fhf  C  e IZ _ R  >aZ Z U C;5@8!G  5 > N  C]_t(Rz B .A/f  j   Z( 5 cv  Ufb5 7 Z  ]j^)KC- e : `8 "! , I 9|  '0C7?A /  f"+.Ng [R+{uZ 9" !1R$   f4 C 4" S -fWwH"] m - R2P  #W CC>) RNf Aj Cj O S  9] oD ^ &{Cf>;tf!B !"Q  BQAz )e ]%)' q ) Z%]  @j fg f t~u X" ;84 U  R\, fkjmt! 0 HlI0sCf" |C '7[f>H4 xY Z  5CR  # Ab< w'C  8w/ `2W*Z T   YIRm" ;D+FD *  0  $CI5  2h x +Qj  R Ijx O@X ]rj `"" R,RVDv t j w"w Agj [ uRiP4 :R'6 = X fZ Z })*  D vu 3w ~ j " 93)P{ $ :  Rh  #C t Z  nR~\ fZ   f u  @# .   R fK ! f  h ' 8u  4S :C uA &  C.! M* Z  ? * 9" j Oi/  5 %  Rm /  +u w  9f{ c^ C?C^\fb5" + </9uzD2` yC% 32Z\c=yqdA *  O t CF*  w  Z K f. % 7j 1B & a) )@ eh !u EZ  C j7?*) 2f4!     u C)Jf/abJ V >;]  % 3w ]   w *CfZ u e w f QR^F.q  5  j' RI  5! 'p  Z  f8w3+;]   * p. f  ] uRhk C t G nl  4 ff|A!#C_ I YM.v   m [p h xZ y g u f   o Z m! j x K" ^ <\ N  j  R ) d>cZ i% C  pbJfUD u<  6uj R (f: Sr  ! X+. 1 9\ ZTQZ  ] _ 1  @ ?f AE w'Q" B  1 @ T $W:^ ? z! C]w ? G+R|3f;Z )S  ]*9"pt Q@ H :e R,/f v 4 [ MOj   B" R 64 _ C| - 3  X . uCC f&t= Pf?@wf/ x %4  H A 2 j 5 n     :4 j ]fn R f RZ yh R QZ \( wD "' R Rn D] C Qf]C+ wf]Z  ^\   RRU) AJ2Z , qgR> g& Z  %(  !f 0-` C"* Z f# @ ?A, |b5<R> ;w Vs]j  MC^8 a! rf  e L tf*) ^< +   < f|R/Mj "! yPO"m "!@fX+Z IhC_wCIuC$08 )Z 3  qCh /Z  Cf3b :wG8  wm C4Z  y    $ R ?N*_ 1Z % 3b2 4 f;Z ?r 8yf p w R   C- '  *PV"4 &ax  , 5 u   - R 8 f  ) R#89"R- m*: E4 $   RZW h R%(  C lAp!Z" $ZWq ]j6 >{ fc/  ecA  f.  Z Z   *fu wJ !Z Z?4j T fle L Yh<!j 4 R ]Zl   s! U$ (r  [  j  fZ NA3  !S : . fp' <hf j kAZkCl Nygr   @ A[  j l4!  (2%    )R7 t@Zf )  9G   l9rt T  K   % /fewf[%.  . !J    D <j p*mfFw  j     )??   /  uIpt! ^ ; R^\fl f   U  =4 F  AXy Ej 1f uAC C7i f/f Al & 5  w  ud Ruz  p.R# Z 5T r t -     zZ w" 5>"  * +B<  C  >    Z 7i 6 ]#: ! `  zf l: 8u'lu   IT P t" dnP S : 4 ?*BuZ tZ q   uZ Z jC  yTf[  C~!Z"uSuYuEC_fCT "% R4C 2 !' m Z ! 9|j+~CH 6X_* 3  C ,;f  fZ(% /J!RZ5iff \RzCjZ V<> .^ $j R nV&  f]*qh :8RNf RVs (f=Z  "  /vRuzm Z tZ Z Wru 5  A   fw "fF_A f +  WI )Rfn m eIWq fu7  6P" X )C @ "I-w4"" A}%?$   uS :Y  KI!d w Z  W" X&"* v  n vp0I  e+RR >! Cu r   D:j y6T# u %RNy{  Z ZCD+H" W2l?~"{+3n]  R4Y+6'  `c; @  ktn @Z "*   & .  : R@: Z T5 % x fR n g  !xRH f *Z CX" LC  ;  o l  f"C: '^fh ! X $ .uf*Z Z .h M+rf)J >RC6 e kR6!R|38 f7 x" a =f4- t " R]`bZ ;5fB? 7 t4 J l9`c[ 1   4!#) 2c4!!'GR yr t jU!fz *^%CN `c  Z 80ViA SR Amw   Z |j67( R?5I :  c~jZ _Aff Pf^" %   Z !#  IZ @RfhB<i ZkB  w]' f`cu) *#  Hc NA  F6 y -WNA0.  Z = =C2# IwyK S-H1a^ @ f\ Bu (N) ! 4 R$ 2 Z >   N_Ak)wm .   2. w mB] 4  Q R:OrXyZ Z Z MwO) R/*RbV | `c q H f Q/ C VGuufP3Af' C^\R+0wRK|m* " Z-!3<w =& $ w]`c \ $  u "  .7  Cw  W Z  D6T2f4|wf\ Z 3 . /uN!7 !Z $Z V A.C8d$$ A 5 w   ' *h Z XZ  a([! C " 6 " S8  * Z  / 88uB I* j  -=R  6j  Rp^ Z  }"  5 Ro :i3) q ) ?'2$f67  Z j C  1R)Rr{" d >-  fWf  u [LDZRm1 |w] c Z6;   @ .*#R)f [1]C + T| @ w| uR A+ s+2|!  B 6vffw #wRw :S  v t_u   ' + s Rr+ tZUN [CRNS.p  +C Z  f#{l  1 C<80  9Ck  1cm^ %4 x   'ZWru RR     C u g @t!  m =Z !RR9(o7]m Z  -  ko fE2 |Z tyj  , !8? ZI[4 UA  duf ) 7v t4 Ye  T  k    j#8 "  $  um f   !  Z (Z ef><3 2  T Rw    ~Izq  R f7.  A.R _   *f z fe  wA"}5 5:j  x' _!) R+$hmlluXbBf    _ K "b ! \ N q+$ - Ce  +zE ;Z  |*^X")Lf &R2 j ) [/u < j  K p&h A,`CGfbJf45 u f   , ewfVw =S v  Zz 3b   A eR;[ L mw*  u bda94 \_B<D t < Vq3ul   !m lw r9Rqt   WIOu ? * l 1  V Af5 w  $ (5#? ] ' Y o   4   X & j 5  !!(+r ^ [U R *lZ  u Z  ,f#{tbRj  w?i Z ]Z $   w N kR2 Gu vh Af$wj C=] R"bR@1   l   H  j "u0h 9"Z /R7  U*J  D v <  o !!(+ e @ S  3fZ  MuO  dZ    6E*, fPCC yaAx ^ b '&8 l ;J "!CzCJ0uZ f5 Z  Z Y f0n   {} t- ){ j  C) ,du  CR4  g:Q) R/*yZ   Z I  YR! A fCuZ  ff`c N f  !  5' B|u f|Z ;  Q(; , f :  =fh, u S  C   H ATp Oj 19 Wf$  8 3 f . C^)! RT.e~0st { :<u5f7 2  n ,Z  j'4!!' / | Zw Mb >fC f-=  ,fC8f/f Y8*{""     _ ew Ln] B  = At! 4 Vf%CPLh" %   4 A  PII'uj 8   6'[" kAE s 3b A"~{j k  3 !C+ !#R\ AC  6'9 d  &  QR^"!DCw _f e up0!f2lI0t[ X2!#'  Z ' % l .wNZ RIp Z V r  R^\XfZ } p ? |[ V w4 j u    G 4 `  6 <) T(  8uwK"  :5m Cj/f   Q  w~  R( 4 ! R  0]j8e Lfz_ *  '' 7 T 3 R$D, ! f +Z X  NC  m'I fP{j$ D * "   ZIWf Q. f QZ!d"fWr" s .A o Cb(#(2i_ H F{WA j {j Oj &  .C"k C^ 6D+ZTR ) L+2 I @+C B4  lw" 4  Wu uZ   uf+ iPf+^!"= ;wm =Rf68/Rw ") 1j !  Z 9"  *  )] %  'Q u  .q Re T c^ ; %t) % RCI4 7  FU"Ri?  D S   =*  6  y'  6 R  C ` O k)PVDv $hRv  euf_w #ppQG" .0uP< s r  IV   9  sjWu T' . c(fRw ^C  g\ u 0Cp ff6@R FD J !675  j%  8uBZ D+j 6Z J 2  g 7 Iw ] 0 f f > j +^=  N  !!  j '\ A )*u ! Z >  =  5  U " 0)fu qf6j |   iWM( Z A  8)fR9f"lw8t$S  (A C3 |,   ; h uRA$ cwqZ  " ? Rl CV"6Q nRl$ 73 fe  TZ0sZ   " T$CZ RC~ G8N3T 3#  $ 7 T `        f/-0R67.t_ Tp    w Q;P  ! I% f"wC C wZ T2j 4 .cD w< R>u .FX"|^ R)V"Z Z  M .]   6 ! C3 +0p! !B II u}-3 ! Z  ,/2X t C 4 7?@#q  "i R^ b 8f 3jA$ V2S O fmlC7v>'tnit~] MO k CT tC!ZXop"nraf [u !Ro h  @" {: w \Z  s#{V& ,ff#$Ws% 3  7i 3S  "f w w,   q j /2o 'C(jmb % mf/  +_v % Cg  Z  C> fR 4  hA z l  χ] )uRC kC*9 Z CRV wd : 8Z V"T2 ZvCjG7Z e  T"Ws"  4nA l_   C!f   )p}T)  4 4<!t Xn 3 A2c2  =<u>RD% C>   `_^ V@fz] A  dJ0c w/at! n_^ R df^\ / Nvu } p AuC "b!   Ri, f(3RQ7Z  !AJ   lD t < f2" R 'O ffH8)4 s  b#um g Z n  V )JX"K,wN;  C|jfg  S GB! fnR]J   C M j fJ0R: .   t!S!RP{ fX  q 4* 4 O R4 A0b  h )`2f  ! X  p.   6*u J7G8T 2! 'f  f> 3 T 3 ) 5 *A,   - j @Cf%" i &Z     :  uC^- Z "  e0C1F<u :pQZw N    vR/m $ AWj w  B ` !  4 )Ww'R7hq"n  R|Z  o   ROuA Nct#u jyCO+  ,fr@  @Z  2t0o $ c IXof> ;"XZ   *Z  C4  dK|RTX"- O  f78=; .v !#h   O] m  C   X" ,!"Z  w  R0uRC C. M '  "n8w 1 J!2Th ?qF VAZ  R M@ ?"[ : 8!- ' Am@1 ^   ) q 1 9" {""%.2%6j   L Qf+Z _ wLj  `fN>  ZqA" 3u_$ FRT 3  f 9Z  _r  [K dB?( "n  o  AC CnRp xFf/+* =fyawHfu R]j #Z  :"!   C+Z ]r:Ox 5xp Cg f[a' Vp4      ZTR)J * @u 3AC 6f#Cvvw F C  Z ' uj  $ 4 MC  8?C>.:" #C, BC;!eu L Vi+fP.C*wC  %Z !DZ [m Cjv Z qR} %fJ! fTpWZ ,$ f/ lR  2j |  ^ ?,) _j   f\ A ' Z R fgZ  kC# xX RA /pwQf6t!f5i"|u|R-  5Cu% nn!> Z ^  %+ fKZ5{ d  &  guCR+ D " L': A    e 3KX  6U   * '  e@   MwOj C 1* Z 80@  S 8 2 $4 Z   uu*4bNSg RfC U!vWT;  e  ' 4FC$z ] $ TX!LD fB6 *|^ 4 3f#8  l I,x - C"+  <Z  I :Z  $ 7 "#B X }" uAC.t kCw  Cj W[0wkWC8R 2SZ xT.w  ?daww# {2  zG ? # Z   R cftR $f@2rW wV  5+ o7Re) (D  Cj   -:) R' "  =b% 3R i, R =!  Z Greek_And_CopticgreekandcopticGreek_ExtgreekextGreek ExtendedGreek_ExtendedgreekextendedGunjala GondiGurung KhemaHalf_And_Full_FormshalfandfullformsHalfwidth and Fullwidth FormsHalfwidth_And_Fullwidth_FormshalfwidthandfullwidthformsHangul Compatibility JamoHangul_Compatibility_JamohangulcompatibilityjamoHangul JamoHangul_JamohanguljamoHangul Jamo Extended-AHangul_Jamo_Extended_AhanguljamoextendedaHangul Jamo Extended-BHangul_Jamo_Extended_BhanguljamoextendedbHangul SyllablesHangul_SyllableshangulsyllablesHanifi RohingyaHigh Private Use SurrogatesHigh_Private_Use_SurrogateshighprivateusesurrogatesHigh_PU_SurrogateshighpusurrogatesHigh SurrogatesHigh_SurrogateshighsurrogatesIDCidcIdeographic_SymbolsideographicsymbolsImperial AramaicIndic Siyaq NumbersIndic_Siyaq_NumbersindicsiyaqnumbersInscriptional PahlaviInscriptional ParthianIPA_ExtipaextIPA ExtensionsIPA_ExtensionsipaextensionsJamo_Ext_AjamoextaJamo_Ext_BjamoextbKaktovik NumeralsKaktovik_NumeralskaktoviknumeralsKana_Ext_AkanaextaKana_Ext_BkanaextbKana Extended-AKana_Extended_AkanaextendedaKana Extended-BKana_Extended_BkanaextendedbKana_SupkanasupKana SupplementKana_SupplementkanasupplementKanbunkanbunKangxikangxiKangxi RadicalsKangxi_RadicalskangxiradicalsKatakana_ExtkatakanaextKatakana Phonetic ExtensionsKatakana_Phonetic_ExtensionskatakanaphoneticextensionsKayah LiKhitan Small ScriptKhmer SymbolsKhmer_SymbolskhmersymbolsKirat RaiLatin_1latin1Latin_Ext_AlatinextaLatin_Ext_AdditionallatinextadditionalLatin_Ext_BlatinextbLatin_Ext_ClatinextcLatin_Ext_DlatinextdLatin_Ext_ElatinexteLatin Extended-ALatin_Extended_AlatinextendedaLatin Extended AdditionalLatin_Extended_AdditionallatinextendedadditionalLatin Extended-BLatin_Extended_BlatinextendedbLatin Extended-CLatin_Extended_ClatinextendedcLatin Extended-DLatin_Extended_DlatinextendeddLatin Extended-ELatin_Extended_ElatinextendedeLatin Extended-FLatin_Extended_FlatinextendedfLatin Extended-GLatin_Extended_GlatinextendedgLatin_Ext_FlatinextfLatin_Ext_GlatinextgLatin_1_Suplatin1supLatin-1 SupplementLatin_1_Supplementlatin1supplementLetterlike SymbolsLetterlike_SymbolsletterlikesymbolsLinear ALinear B IdeogramsLinear_B_IdeogramslinearbideogramsLinear B SyllabaryLinear_B_SyllabarylinearbsyllabaryLisu_SuplisusupLisu SupplementLisu_SupplementlisusupplementLow SurrogatesLow_SurrogateslowsurrogatesMahjongmahjongMahjong TilesMahjong_TilesmahjongtilesMasaram GondiMath_AlphanummathalphanumMathematical OperatorsMathematical_OperatorsmathematicaloperatorsMayan NumeralsMayan_NumeralsmayannumeralsMeetei MayekMeetei_Mayek_ExtmeeteimayekextMeetei Mayek ExtensionsMeetei_Mayek_ExtensionsmeeteimayekextensionsMende KikakuiMeroitic CursiveMeroitic HieroglyphsMisc_ArrowsmiscarrowsMiscellaneous SymbolsMiscellaneous_SymbolsmiscellaneoussymbolsmiscellaneoussymbolsandarrowsMiscellaneous TechnicalMiscellaneous_TechnicalmiscellaneoustechnicalMisc_Math_Symbols_AmiscmathsymbolsaMisc_Math_Symbols_BmiscmathsymbolsbMisc_PictographsmiscpictographsMisc_SymbolsmiscsymbolsMisc_TechnicalmisctechnicalModifier Tone LettersModifier_Tone_LettersmodifiertonelettersMongolian_SupmongoliansupMongolian SupplementMongolian_SupplementmongoliansupplementMyanmar_Ext_AmyanmarextaMyanmar_Ext_BmyanmarextbMyanmar_Ext_CmyanmarextcMyanmar Extended-AMyanmar_Extended_AmyanmarextendedaMyanmar Extended-BMyanmar_Extended_BmyanmarextendedbMyanmar Extended-CMyanmar_Extended_CmyanmarextendedcNag MundariNBNew Tai LueNKoNo_BlocknoblockNyiakeng Puachue HmongOCRocrOl ChikiOld HungarianOld ItalicOld North ArabianOld PermicOld PersianOld SogdianOld South ArabianOld TurkicOld UyghurOl OnalOptical Character RecognitionOptical_Character_RecognitionopticalcharacterrecognitionOrnamental DingbatsOrnamental_DingbatsornamentaldingbatsOttoman Siyaq NumbersOttoman_Siyaq_NumbersottomansiyaqnumbersPahawh HmongPau Cin HauPhags-paPhaistosphaistosPhaistos DiscPhaistos_DiscphaistosdiscPhonetic_ExtphoneticextphoneticextensionssupplementPhonetic_Ext_SupphoneticextsupPlaying CardsPlaying_CardsplayingcardsPrivate Use AreaPrivate_Use_AreaprivateuseareaPsalter PahlaviPUApuaRumirumiRumi Numeral SymbolsRumi_Numeral_SymbolsruminumeralsymbolsShorthand Format ControlsShorthand_Format_ControlsshorthandformatcontrolsSinhala Archaic NumbersSinhala_Archaic_NumberssinhalaarchaicnumbersSmall_FormssmallformsSmall Form VariantsSmall_Form_VariantssmallformvariantsSmall_Kana_ExtsmallkanaextSmall Kana ExtensionSmall_Kana_ExtensionsmallkanaextensionSora SompengSpacing Modifier LettersSpacing_Modifier_LettersspacingmodifierlettersSpecialsspecialsSundanese_SupsundanesesupSundanese SupplementSundanese_SupplementsundanesesupplementSup_Arrows_AsuparrowsaSup_Arrows_BsuparrowsbSup_Arrows_CsuparrowscSuper_And_SubsuperandsubSuperscripts and SubscriptsSuperscripts_And_SubscriptssuperscriptsandsubscriptsSup_Math_OperatorssupmathoperatorsSupplemental Arrows-ASupplemental_Arrows_AsupplementalarrowsaSupplemental Arrows-BSupplemental_Arrows_BsupplementalarrowsbSupplemental Arrows-CSupplemental_Arrows_CsupplementalarrowscSupplemental PunctuationSupplemental_PunctuationsupplementalpunctuationsupplementaryprivateuseareaasupplementaryprivateuseareabSup_PUA_AsuppuaaSup_PUA_BsuppuabSup_PunctuationsuppunctuationSup_Symbols_And_PictographssupsymbolsandpictographsSutton SignWritingSutton_SignWritingsuttonsignwritingSyloti NagriSymbols_And_Pictographs_Ext_AsymbolsandpictographsextaSymbols for Legacy ComputingSymbols_For_Legacy_ComputingsymbolsforlegacycomputingsymbolsforlegacycomputingsupSyriac_SupsyriacsupSyriac SupplementSyriac_SupplementsyriacsupplementTagstagsTai LeTai ThamTai VietTai_Xuan_JingtaixuanjingTai Xuan Jing SymbolsTai_Xuan_Jing_SymbolstaixuanjingsymbolsTamil_SuptamilsupTamil SupplementTamil_SupplementtamilsupplementTangut ComponentsTangut_ComponentstangutcomponentsTangut_SuptangutsupTangut SupplementTangut_SupplementtangutsupplementTransport_And_MaptransportandmapTransport and Map SymbolsTransport_And_Map_SymbolstransportandmapsymbolsTulu-TigalariUCASucasUCAS_ExtucasextUCAS_Ext_AucasextaVariation SelectorsVariation_SelectorsvariationselectorsvariationselectorssupplementVedic_ExtvedicextVedic ExtensionsVedic_ExtensionsvedicextensionsVertical FormsVertical_FormsverticalformsVSvsVS_SupvssupWarang CitiYijingyijingYijing Hexagram SymbolsYijing_Hexagram_SymbolsyijinghexagramsymbolsYi RadicalsYi_RadicalsyiradicalsYi SyllablesYi_SyllablesyisyllablesZanabazar SquareZnamenny_MusicznamennymusicZnamenny Musical NotationZnamenny_Musical_NotationznamennymusicalnotationArabic_LetterarabicletterArabic_NumberarabicnumberBNbnBoundary_NeutralboundaryneutralCommon_SeparatorcommonseparatorCSEuropean_NumbereuropeannumberEuropean_SeparatoreuropeanseparatorEuropean_TerminatoreuropeanterminatorFirst_Strong_IsolatefirststrongisolateFSIfsiLeft_To_RightlefttorightLeft_To_Right_EmbeddinglefttorightembeddingLeft_To_Right_IsolatelefttorightisolateLeft_To_Right_OverridelefttorightoverrideLRElreLRIlriLROlroNSMnsmOther_NeutralotherneutralPDFpdfPDIpdiPop_Directional_FormatpopdirectionalformatPop_Directional_IsolatepopdirectionalisolateRight_To_LeftrighttoleftRight_To_Left_EmbeddingrighttoleftembeddingRight_To_Left_IsolaterighttoleftisolateRight_To_Left_OverriderighttoleftoverrideRLErleRLIrliRLOrloSegment_SeparatorsegmentseparatorWhite_SpacewhitespaceWSFalseTrue1.13.13.24.15.26.16.26.37.08.09.010.011.012.012.113.014.015.015.116.0V10_0V11_0V12_0V12_1V13_0V14_0V15_0V15_1V16_0V1_1V2_0V2_1V3_0V3_1V3_2V4_0V4_1V5_0V5_1V5_2V6_0V6_1V6_2V6_3V7_0V8_0V9_0v100v11v110v120v121v130v140v150v151v160v20v21v30v31v32v40v41v50v51v52v60v61v62v63v70v80v90Sequence (?#... not terminatedpanic: %s: %d: negative offset: %ld trying to output message for pattern %.*sGroup name must start with a non-digit word characterpanic: no svname in reg_scan_nameReference to nonexistent named groupQuantifier in {,} bigger than %d in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Sequence (%s... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Corrupted regexp opcode %d > %dOverloaded qr did not return a REGEXPAssuming NOT a POSIX class since it doesn't start with a '[' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since no blanks are allowed in one in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/POSIX syntax [%c %c] is reserved for future extensions in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since the '^' must come after the colon in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since a semi-colon was found instead of a colon in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since there must be a starting ':' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since the name must be all lowercase letters in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since there is no terminating ':' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Assuming NOT a POSIX class since there is no terminating ']' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/POSIX class [:%s%d%lu%4p:] unknown in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Sequence %.3s... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic! %s: %d: Tried to warn when none expected at '%s'Perl folding rules are not up-to-date for 0x%02X; please use the perlbug utility to report; in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unicode property wildcard not terminatedThe Unicode property wildcards feature is experimentalpanic: Can't find '_charnames::_get_names_info -0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ()No Unicode property value wildcard matches:_charnames::_loose_regcomp_lookuppanic: Can't find '_charnames::_loose_regcomp_lookupTimeout waiting for another thread to defineInfinite recursion in user-defined propertyUse of '%.*s' in \p{} or \P{} is deprecated because: %sThe private_use feature is experimentalUnknown user-defined property nameIllegal user-defined property nameCan't find Unicode property definition (but this one isn't fully valid) (but this one isn't implemented)POSIX syntax [%c %c] belongs inside character classes%s in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Literal vertical space in [] is illegal except under /xpanic: grok_bslash_N set NEED_UTF8\N in a character class must be a named character: \N{...}Ignoring zero length \N{} in character class in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/\N{} here is restricted to one characterUsing just the first character returned by \N{} in character class in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Use of '\%c%c' is not allowed in Unicode property wildcard subpatterns in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Empty \%c in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Missing right brace on \%c{} in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Empty \%c{} in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Character following \%c must be '{' or a single-character Unicode property name in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/%d%lu%4p in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unicode string properties are not implemented in (?[...])Using just the single character results returned by \p{} in (?[...]) in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Inverting a character class which contains a multi-character sequence is illegalUnrecognized escape \%c in character class in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unrecognized escape \%c in character class passed through in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/False [] range "%d%lu%4p" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Invalid [] range "%d%lu%4p" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/False [] range "%*.*s" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Both or neither range ends should be Unicode in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Ranges of ASCII printables should be some subset of "0-9", "A-Z", or "a-z" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Ranges of digits should be from the same group of 10 in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/"%.*s" is more clearly written simply as "%s" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/In '(*VERB...)', the '(' and '*' must be adjacentIn '(*...)', the '(' and '*' must be adjacentUnterminated verb pattern argumentUnterminated '(*...' construct'(*%d%lu%4p' requires a terminating ':' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unknown verb pattern '%d%lu%4p' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unknown '(*...)' construct '%d%lu%4p' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Verb pattern '%.*s' has a mandatory argument in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/In '(?...)', the '(' and '?' must be adjacentSequence (?P<... not terminatedSequence (?P>... not terminatedSequence (%.*s...) not recognized in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Sequence (?%c... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic: reg_scan_name returned NULLpanic: paren_name hash element allocation failedSequence (?%c...) not implemented in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Sequence (?&... not terminatedSequence (%d%lu%4p...) not recognized in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic: Sequence (?{...}): no code block found Eval-group not allowed at runtime, use re 'eval'Sequence (?(%c... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic: grok_atoUV returned falseSwitch condition not recognizedpanic: regbranch returned failure, flags: %#lx in regex m/%d%lu%4p%s/(?(DEFINE)....) does not allow branchesSwitch (?(condition)... not terminatedSwitch (?(condition)... contains too many branchesUnknown switch condition (?(...))Expecting interpolated extended charclassUnexpected '(' with no preceding operatorUnexpected binary operator '%c' with no preceding operand in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Operand with no preceding operatorUnexpected ']' with no following ')' in (?[...Incomplete expression within '(?[ ])'panic: regclass returned failure to handle_sets, flags: %#lx in regex m/%d%lu%4p%s/Empty (?) without any modifiers in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Use of modifier '-m' is not allowed in Unicode property wildcard subpatternsRegexp modifier "%c" may appear a maximum of twice in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Regexp modifier "%c" may not appear twice in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Regexp modifiers "%c" and "%c" are mutually exclusive in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Regexp modifier "%c" may not appear after the "-" in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Useless (%s%c) - %suse /%c modifier in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Useless (%sc) - %suse /gc modifier in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Useless use of (?-p) in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Use of modifier '%c' is not allowed in Unicode property wildcard subpatterns in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Too many capture groups (limit is %lu) in regex m/%d%lu%4p%s/Eval-group in insecure regular expressionpanic: reg returned failure to re_op_compile, flags: %#lxpanic: hv_store() unexpectedly failedInvalid hexadecimal number in \N{U+...}panic: reg returned failure to grok_bslash_N, flags: %#lx in regex m/%d%lu%4p%s/panic: regclass returned failure to regatom, flags: %#lx in regex m/%d%lu%4p%s/panic: reg returned failure to regatom, flags: %#lx in regex m/%d%lu%4p%s/Use of '\G' is not allowed in Unicode property wildcard subpatterns\K not permitted in lookahead/lookbehind'%d%lu%4p' is an unknown bound type in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Using /u for '%.*s' instead of /%s in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unescaped left brace in regex is illegal hereSequence %.2s... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Sequence \%s... not terminated in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Reference to nonexistent groupReference to nonexistent or unclosed groupUnrecognized escape \%.1s passed through in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unescaped left brace in regex is passed through in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Unescaped literal '%c' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/panic: loc_correspondence[%d] is 0 in regex m/%d%lu%4p%s/panic: regatom returned failure, flags: %#lx in regex m/%d%lu%4p%s/Quantifier {n,m} with n > m can't match in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Useless use of greediness modifier '%c' in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/%d%lu%4p matches null string many times in regex; marked by <-- HERE in m/%d%lu%4p <-- HERE %d%lu%4p/Use of quantifier '*' is not allowed in Unicode property wildcard subpatternspanic: regpiece returned failure, flags: %#lx in regex m/%d%lu%4p%s/panic: %s: %d: Unexpected operation %dAncient Greek Musical NotationAncient_Greek_Musical_NotationArabic Mathematical Alphabetic SymbolsArabic_Mathematical_Alphabetic_SymbolsarabicmathematicalalphabeticsymbolsCJK Compatibility Ideographs SupplementCJK_Compatibility_Ideographs_SupplementcjkcompatibilityideographssupplementCJK Unified Ideographs Extension ACJK_Unified_Ideographs_Extension_AcjkunifiedideographsextensionaCJK Unified Ideographs Extension BCJK_Unified_Ideographs_Extension_BcjkunifiedideographsextensionbCJK Unified Ideographs Extension CCJK_Unified_Ideographs_Extension_CcjkunifiedideographsextensioncCJK Unified Ideographs Extension DCJK_Unified_Ideographs_Extension_DcjkunifiedideographsextensiondCJK Unified Ideographs Extension ECJK_Unified_Ideographs_Extension_EcjkunifiedideographsextensioneCJK Unified Ideographs Extension FCJK_Unified_Ideographs_Extension_FcjkunifiedideographsextensionfCJK Unified Ideographs Extension GCJK_Unified_Ideographs_Extension_GcjkunifiedideographsextensiongCJK Unified Ideographs Extension HCJK_Unified_Ideographs_Extension_HcjkunifiedideographsextensionhCJK Unified Ideographs Extension ICJK_Unified_Ideographs_Extension_IcjkunifiedideographsextensioniCombining Diacritical Marks ExtendedCombining_Diacritical_Marks_ExtendedcombiningdiacriticalmarksextendedCombining Diacritical Marks for SymbolsCombining_Diacritical_Marks_For_SymbolscombiningdiacriticalmarksforsymbolsCombining Diacritical Marks SupplementCombining_Diacritical_Marks_SupplementcombiningdiacriticalmarkssupplementCuneiform Numbers and PunctuationCuneiform_Numbers_And_PunctuationcuneiformnumbersandpunctuationEgyptian Hieroglyph Format ControlsEgyptian_Hieroglyph_Format_ControlsegyptianhieroglyphformatcontrolsEgyptian Hieroglyphs Extended-AEgyptian_Hieroglyphs_Extended_AEnclosed Alphanumeric SupplementEnclosed_Alphanumeric_SupplementenclosedalphanumericsupplementEnclosed CJK Letters and MonthsEnclosed_CJK_Letters_And_MonthsEnclosed Ideographic SupplementEnclosed_Ideographic_SupplementIdeographic Description CharactersIdeographic_Description_CharactersideographicdescriptioncharactersIdeographic Symbols and PunctuationIdeographic_Symbols_And_PunctuationideographicsymbolsandpunctuationMathematical Alphanumeric SymbolsMathematical_Alphanumeric_SymbolsmathematicalalphanumericsymbolsMiscellaneous Mathematical Symbols-AMiscellaneous_Mathematical_Symbols_AmiscellaneousmathematicalsymbolsaMiscellaneous Mathematical Symbols-BMiscellaneous_Mathematical_Symbols_BmiscellaneousmathematicalsymbolsbMiscellaneous Symbols and ArrowsMiscellaneous_Symbols_And_ArrowsMiscellaneous Symbols and PictographsMiscellaneous_Symbols_And_PictographsmiscellaneoussymbolsandpictographsPhonetic Extensions SupplementPhonetic_Extensions_SupplementSupplemental Mathematical OperatorsSupplemental_Mathematical_OperatorssupplementalmathematicaloperatorsSupplemental Symbols and PictographsSupplemental_Symbols_And_PictographssupplementalsymbolsandpictographsSupplementary Private Use Area-ASupplementary_Private_Use_Area_ASupplementary Private Use Area-BSupplementary_Private_Use_Area_BSymbols and Pictographs Extended-ASymbols_And_Pictographs_Extended_AsymbolsandpictographsextendedaSymbols_For_Legacy_Computing_SupSymbols for Legacy Computing SupplementSymbols_For_Legacy_Computing_SupplementsymbolsforlegacycomputingsupplementUnified Canadian Aboriginal SyllabicsUnified_Canadian_Aboriginal_SyllabicsunifiedcanadianaboriginalsyllabicsUnified Canadian Aboriginal Syllabics ExtendedUnified_Canadian_Aboriginal_Syllabics_ExtendedunifiedcanadianaboriginalsyllabicsextendedUnified Canadian Aboriginal Syllabics Extended-AUnified_Canadian_Aboriginal_Syllabics_Extended_AunifiedcanadianaboriginalsyllabicsextendedaVariation Selectors SupplementVariation_Selectors_SupplementSurrogates should never appear in well-formed text, and therefore shouldn't be the basis for line breakingSupplanted by Line_Break property values; see www.unicode.org/reports/tr14tõt-Kix0/000000000000000000000000000000000000000/000000//000000000000/0000/000000/00000//h//MMMMMMMMBDdY+kRd2`I'))))))))ݹݹݹݹݹݹݹݹݹݹݹݹݹݹݹ ݹݹݹݹݹݹ@ݹݹ5ݹݹ|qݹݹݹݹݹݹݹݹݹiݹ^ݹݹݹݹݹG*@ݹ<%ݹ̻˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸XM˸˸˸˸˸˸˸˸˸c~s\E˸:˸˸˸˸˸#˸˸4)?ZO8!>>`}$!QZ$ brrr rrrrrrrrrrrrbrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr r rrr rrurrirBrrvGGGGGG GGGGGGGGGGGGGUGGGGGGGGGGGGGGGGGGGGGGGG G= GG:JJJJJJJJJJJJJJJ:JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJZJJJHJJJvMJJJJJJN+/>NNNNNNNNNNNNNNN>NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNLNNNNz'NNENNNRskkkq knnkkqkkkkkkkkkkkkkkkknkkkkkkkkkkkkkkkkkkkkkkkkkkkr,tk,sn^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l^l`n 9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j9j$?\ԁ9j9jnԁ9j9j9j9j79jԁ9jԁ9j9jԁԁ҉9j9j9j9j9j9j9j9j9jԁ9j9jttnQtt t 4Et (t ttʁ t3BBBBJBBB`BBBBB!BBBBBBBBBBB·wJDDDDɺDDDTDDDDDDDDDDDDDDDD&C̶CCCCCCCC@CCƲCƲ|c6vv^QE,QQQQQQQQQQ&Q&e! @!ݸ~SbbbbjbbbbbbbbA&ٻ=!aA<,>Bbt8=C!D  eZ Z ,#+> ~ ^ ?  * <w %   $UYfl  u %CyhX+\ C3  ) Z T>  j  8 ARg [!  ! )/pwQ> ;*nf, v fGZ 6> TC;wS  *l v|$ G1xTj e !. A. ;5f5Z #  C  AwV Z  , zz $ gf> AC 6i .  uAw f S :n0w i -Z zw f $j w  f]jC!#A% C=N  Hq /^\R=4 ZfJ eoN 4u R ZA   *  <*H j OZ[   3/NuN  ARcR>   ^ %!  f7 2] nw RC 6 e@ fimC} WfxZ Z IWr  sCwuP  )CK e) [8}-tqR-ff   . Wf4 _Ahf , R]rj u  ~"iT, ] %C! `n  Rf80I u UYZ 9"!C .   +:Cu  S #8R3:X ) 8 K;Znyenfn 0f^\R_ Kf _ ,|;  $ fAz.  Djt -! uf>A :' ?Z vwZ  n0 I Z|;f P$vf t  GZEZ >e \ A) T( g;! I5 ICt MO   ;   M/1f,fr|r.C  @*R .fC w f#w C 3 w  ]! S1cmIv u'!Z , ?!$MuOR  w ] ' !C6Z  t $o MZ } Cf Z 4!!'    9  `- Z"Z u    <* C 6f-Z 2Z m_ d  &3ReC3puQIl, sR f6  >ftn\ ZWuf ZW wj   $ ) &((@C?Target of goto is too deeply nestedCan't "goto" into a "defer" block%-p did not return a true value%-pCompilation failed in requireSmart matching a non-overloaded object breaks encapsulationPerls since %-p too modern--this is %-p, stoppedPerl %-p required--this is only %-p, stoppedPerl %-p required (did you mean %-p?)--this is only %-p, stoppedMissing or undefined argument to %sMissing or undefined argument to %s via %%{^HOOK}{require__before}Attempt to reload %s aborted. Compilation failed in requireBareword in require maps to disallowed filename "%-p"Bareword in require contains "\0"Bareword in require contains "/."Can't locate object method "INC", nor "INCDIR" nor string overload via package %10p %s in @INC%s %s hook died--halting @INC search (you may need to install the (change .h to .ph maybe?) (did you run h2ph?)Can't locate %s in @INC%-p (@INC entries checked:%-p)do "%s" failed, '.' is no longer in @INC; did you mean do "./%s"?Infinite recursion via empty patternRepeated format line will never terminate (~~ and @#)Range iterator outside integer rangeCan't "%s" outside a loop blockCan't "%s" out of a "%s" blockCan't return %s from lvalue subroutineGoto undefined subroutine &%-pCan't goto subroutine outside a subroutineCan't goto subroutine from an eval-stringCan't goto subroutine from an eval-blockCan't goto subroutine from a sort sub (or similar callback)Can't "goto" out of a pseudo blockCan't "goto" into a binary or list expressionCan't "goto" into the middle of a foreach loopCan't "goto" into a "given" blockUse of "goto" to jump into a construct is deprecated, and will become fatal in Perl 5.42Can't return outside a subroutineCan't "%s" outside a topicalizerCan't "continue" outside a when blockCan't "break" outside a given blockCan't "break" in a loop topicalizerUnknown error feature_apos_as_name_sepCompilation errorUnit check errorin object hookin object in ARRAY hookINCDIRv%d.%d.0Can't locate %s: %s/loader/0x%lx/%s@INC entryCan't locate %s: %s: %s module).ph (did you run h2ph?)Can't locate %sSubstitution loop%0*.*f%*.*f%#*.*f%#0*.*fNull picture in formlineNot enough format argumentsE0panic: bad gimme: %d finallyExiting %s via %sLabel not found for "%s %-p" (in cleanup) %-p%-p%s has too many errors. (eval)No DB::DB routine defineda temporarya readonly valueGoto undefined subroutineDB::gotogoto must have labelpanic: goto, type=%u, ix=%ldCan't find label %d%lu%4p_<(eval %lu)[%s:%u]_<(eval %lu)panic: return, type=%udefaultpseudo-blocksubstitutiondefer blockfeature_bareword_filehandlesfeature_bitwisefeature_classfeature___SUB__feature_myreffeature_deferfeature_evalbytesfeature_more_delimsfeature_fcfeature_indirectfeature_isafeature_keyword_allfeature_keyword_anyfeature_module_truefeature_multidimensionalfeature_postderef_qqfeature_refaliasingfeature_sayfeature_signaturesfeature_smartmatchfeature_statefeature_switchfeature_tryfeature_unievalfeature_unicodem`@SHYX8XW@[xYH\xX0TS0RxW0WPXVXU(Rȅ0(111؋ P1@ A( (!0 `  0000PP(( hhhhn  (($@E_DEBUG_FLAGSUndefined subroutine calledPRINTNot %s referencepanic: pp_match?? already matched once, core dumpedREADLINE$&*(){}[]'";\|?<>~`panic: pp_iter, type=%ua subroutineNot a CODE referenceClosure prototype calledDB::lsubNo DB::sub routine definedNot an ARRAY referenceUndefined subroutine &%-p calledUndefined subroutine &%-p called, close to label '%s'Can't call method "%-p" without a package or object referenceCan't call method "%-p" on an undefined valueCan't call method "%-p" on unblessed referenceUseless assignment to a temporaryCan't return array to lvalue scalar contextCan't return hash to lvalue scalar contextCan't return %s to lvalue scalar contextReference found where even-sized list expectedOdd number of elements in hash assignmentpanic: attempt to copy freed scalar %pAssigned value is not a SCALAR referenceString shorter than min possible regex match (%zd < %zd) panic: pp_match start/end pointers, paren=%d, start=%zd, end=%zd, s=%p, strend=%p, len=%zdglob failed (child exited with status %d%s)utf8 "\x%02X" does not map to UnicodeUse of freed value in iterationpanic: pp_subst, pm=%p, orig=%pDeep recursion on anonymous subroutineDeep recursion on subroutine "%-p"Can't use string ("%-32p"%s) as a subroutine ref while "strict refs" in useCan't modify non-lvalue subroutine call of &%-pUse of reference "%-p" as array index@б@[`0.3P a HASHan ARRAY@ A( (!0 `  0000PP(( hhhhn  ((Mismatched brackets in templateNo group ending character '%c' found in templatepanic: marks beyond string end, m=%p, marks=%p, level=%d()-group starts with a count in %sToo deeply nested ()-groups in %s'%c' allowed only after types %s in %sCan't use both '<' and '>' after type '%c' in %sCan't use '%c' in a group with different byte-order in %sDuplicate modifier '%c' after '%c' in %spack/unpack repeat count overflow'/' does not take a repeat count in %sWithin []-length '*' not allowed in %sWithin []-length '%c' not allowed in %sMalformed UTF-8 string in '%c' format in unpackCharacter in '%c' format wrapped in unpackCharacter(s) in '%c' format wrapped in %s'@' outside of string in unpackMalformed UTF-8 string in unpack'X' outside of string in unpack'x' outside of string in unpack'/' must follow a numeric type in unpackUnterminated compressed integer in unpack'P' must have an explicit size in unpackCount after length/code in unpacklength/code after end of string in unpackCode missing after '/' in unpackCode missing after '/' in packMalformed UTF-8 string in pack'%c' outside of string in packpanic: predicted utf8 length not available, for '%c', aptr=%p end=%p cur=%p, fromlen=%zuCharacter in 'c' format wrapped in packCharacter in 'C' format wrapped in packCharacter in 'W' format wrapped in packCannot compress negative numbers in packCannot compress integer in packCan only compress unsigned integers in packAttempt to pack pointer to temporary valueField too wide in 'u' format in packpanic: string is shorter than advertised, aptr=%p, aend=%p, buffer=%p, todo=%zdCannot compress %g in packCannot pack %g with '%c'sSiIlLqQjJfFdDpP(sSiIlLxXnNvV@.Invalid type ',' in %sMalformed integer in [] in %sInvalid type '%c' in %s'X' outside of string in %sInvalid type '%c' in unpackU0 mode on a byte string%.*lufFdDcCsSiIlLnNUWvVqQjJNegative '/' count in unpack@XxuOut of memory during pack()aAZInvalid type '%c' in pack'%%' may not be used in packxrrr0}rl0rr*@@@@@@@fS@@@@@@@@@@@@@@@@H@m@e#@@@S@*@qs@@@@@@@H@O@e@)@*@@^@*`@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@f@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@*@@@@@@@@@@@@@@@@@@@@@$@@@@@^@@@MLLLLLLLLLLLLLLLLLLLLLLLL LKLq(L'LLK)BLL!&"!L LLLLLL $ $LL_'L&L_L% LL>+,=LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLqLL+LLLLLLLL*LLLLLLLLLLLLLLLLLLX*L_LLLLLL>L)AA@G?`@Undefined subroutine in sortUndefined sort subroutine "%-p" called%s() attempted on handle %2p opened with open()%s() attempted on invalid dirhandle %2pCannot open %2p as a filehandle: it is already open as a dirhandleCan't locate object method %1p via package %5pCan't locate object method %1p via package %5p (perhaps you forgot to load %5p?)Can't locate object method %1p via package %7pSelf-ties of arrays and hashes are not supporteduntie attempted while %lu inner references still existUndefined top format "%-p" called%s() isn't allowed on :utf8 handlesPossible memory corruption: %s overflowed 3rd argumentThe stat preceding lstat() wasn't an lstat-T and -B not implemented on filehandleschdir() on unopened filehandle %-pCannot open %2p as a dirhandle: it is already open as a filehandlepanic: kid popen errno read, n=%ualarm() with negative argumentsleep() with negative argument`` ...caughtWarning: something's wrongPROPAGATE ...propagatedDiedFILENOBINMODETIEHASHTIEARRAYTIEHANDLETIESCALARCannot tie unreifiable arrayUNTIEAnyDBM_FileNo dbm on this machineAnyDBM_File.pmNon-string passed as bitmaskGETCUndefined format "%-p" called%2p_TOPtoppage overflowPRINTFREADNegative lengthWRITETELLSEEKlstat() on filehandle%s%-pHOMELOGDIR%s(%.0f) too large%s(%.0f) too small%s(%.0f) failed%s %s %2d %02d:%02d:%02d %ldToo many args to syscallToo few args to syscallSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec<\||FF GGFFF,G)]>_charnames::_get_names_info ABCDEGHIJKLMNOPRSTUWYGGDDBBJJYAYAEYEOYEWAWAEOEYOWEOWEWIYUEUYINJNHLGLMLBLPLHBShighlegal%s-0000%s-%Xnumericvaluecanonicalcombiningclasscccpresentin; Error " in expansion of %.*s%.0f%.*s%.*e%.*s%s%lu/%luprivate_use%d=Insecure private-use override#%d Unmatched [foo\p{Alnum}utf8.pmNeed exactly 3 octal digits-[]\^?:don't ?-E_COMPILE_RECURSION_LIMITToo many nested open parensUnmatched (Unterminated '(*...' argumentUnterminated verb patternasratomic_script_runatomicplbpositive_lookbehindplapositive_lookaheadnlbnegative_lookbehindnlanegative_lookahead?NCODINGUUUUUUUUUUUUUUUUUUUUsetenv key (encoding to utf8)setenvrequire__beforerequire__afterFETCHSTOREDELETEFETCHSIZECLEARNEXTKEYFIRSTKEYEXISTSsubstr outside of stringa negative integerassigning to $^O$0Can't set $0 with prctl(): %sIGNORE__DIE__No such hook: %sNo such signal: SIG%sDEFAULTsignoerrnostatusband@lp(PlllУl`ll ltι^<l^Ѵ(vG[Ķm=o2p Hhe/@. a@z3Attempt to set unknown hook '%s' in %%{^HOOK}${^HOOK}{%.*s} may only be a CODE reference or undefFETCHSIZE returned a negative valuepanic: magic_setdbline len=%ld, ptr='%s'Attempt to set length of freed arrayAttempt to use reference as lvalue in substrAssigned value is not a referenceAssigned value is not a%s reference${^ENCODING} is no longer supportedSetting $/ to a reference to %s is forbiddenSetting $/ to a%s %s reference is forbiddenAssigning non-zero to $[ is no longer possibleSignal SIG%s received, but no signal handler set. SIG%s handler "%2p" not defined. SIG%s handler "__ANON__" not defined. Maximal count of pending signals (%lu) exceededpanic: hv_store() failed in set_mro_private_data() for '%.*s' %dpanic: hv_store() failed in mro_register() for '%.*s' %dCan't linearize anonymous symbol tableRecursive inheritance detected in package '%2p'Can't call mro_isa_changed_in() on anonymous symbol tableCan't call mro_method_changed_in() on anonymous symbol tablepanic: invalid MRO!No such class: '%-p'!Invalid mro name: '%-p'mro::method_changed_indfsmro_core.cnumeric.chexadecimalOctal number > 037777777777Integer overflow in %s numberIllegal %s digit '%c' ignored0 but trueinqs#silence compiler warningBinary number > 0b11111111111111111111111111111111Hexadecimal number > 0xffffffffIllegal octal digit '%c' ignoreddORNNO$ODOKZZZtZQZ.Z ZYAAC%d%lu%4p never introducedpanic: pad_free po%2d. 0x%lx<%lu> SubroutineVariablepanic: no pad in cv_clonepanic: pad_alloc, %p!=%pCan't undef active subroutinepanic: pad_swipe curpad, %p!=%ppanic: pad_swipe po=%ld, fill=%ldpanic: pad_free curpad, %p!=%pPADNAME = 0x%lx(0x%lx) PAD = 0x%lx(0x%lx) %2d. 0x%lx<%lu> FAKE "%s" flags=0x%lx index=%lu %2d. 0x%lx<%lu> (%lu,%lu) "%s" %s "%d%lu%4p" is not availableConstants from lexical variables potentially modified elsewhere are no longer permittedpanic: pad_add_name_pvn illegal flag bits 0x%lx"%s" %s %d%lu%4p masks earlier declaration in same %s"our" variable %d%lu%4p redeclared (Did you mean "local" instead of "our"?) panic: pad_findlex illegal flag bits 0x%lxField %-p is not accessible outside a method%s "%d%lu%4p" will not stay sharedField %-p of %10p is not accessible in a method of %10ppanic: pad_findmy_pvn illegal flag bits 0x%lx## ֓˓~sh]RG<1&VK@5*@ A( (!0 `  0000PP(( hhhhn  ((Statement unlikely to be reached (Maybe you meant system() when you said exec()?) %-p() called too early to check prototypeImplicit use of @_ in %s with signatured subroutine is experimentalUse of @_ in %s with signatured subroutine is experimentalnllllllntntnĿ̿| Ŀ |ĿٿĿĿĿrBBcJJ... .....i............................Ihhhhhhhhhhhhhhhhhhhhhhhh hhh@khhhhhhhhhhhhhhhhhhhhhhhhhhVhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh(hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh((h(hhhhhhhhhU@hhhxhxl|\Offset outside stringPerlIOPerlIO::Layer::NoWarningsPerlIO::LayerUnknown PerlIO layer "%.*s"PERLIOperlio.cPerlIO::Layer::findperlio:more_refcounted_fdsrefcnt_inc: fd %d: %d <= 0 refcnt_inc: fd %d < 0 refcnt_dec: fd %d: %d <= 0 refcnt_dec: fd %d < 0 refcnt: fd %d: %d <= 0 refcnt: fd %d < 0 r+IrIwArrayHashCodeTMPDIRcrlfpendingperliostdiounixrawRecursive call to Perl_load_module in PerlIO_find_layerUsage class->find(name[,load])Invalid separator character %c%c%c in PerlIO layer specification %sArgument list not closed for PerlIO layer "%.*s"panic: PerlIO layer array corruptPerlIO layer function table size (%lu) does not match size expected by this perl (%lu)PerlIO layer instance size (%lu) smaller than size expected by this perl (%lu)refcnt_dec: fd %d >= refcnt_size %d refcnt: fd %d >= refcnt_size %d Don't know how to get file nameMore than one argument to open(,':%s')Strings with code points over 0xFF may not be mapped into in-memory file handles /tmp/PerlIO_XXXXADJUSTcatch block requires a (VAR)Unimplementedsyntax errorA slurpy parameter may not have a default valueExperimental subroutine signatures not enabledppt/ut&t}t/ut/uZ>ސtw%pɏpۏpR?@ABCFIJKLMNRSTavwy{|  #$%&()*+.1236DHZEƗ8=yڎڵ ڵڃX88=ڂ]^_` opomnmGOPQ\bcdfghijklmnopqrstuz}~ 88y샃 ' #$%&)U;UX̂ ̂ 9R̗888Uߑy,̨̨=̻;;ςY ẽ  ;ḇ샏葰̱8ȝbbȃĂ ڃ ႂ샑 8 Y ڒ⺗ʂ˂W!"샂 - ; VW 1 62F   ng ,iX"#o 4 14 0123]^_`   4 <]] "#   13"#e pU8U13=|*;]^_`  UuU]`y8y=Uoop.mn8 =Vm]^_`]^_`]^_` 8  =88 %&_`9 #$%&!") 5]^_`6MR j ' 4.]^_`4"gU;]^_`U]^_`4X { >]^_`CK  8U]^_`]^_`8ym}~mno8kl]^_`s}~,]^_`OP;]^_`Om]^_`=O;]^_`43Ytu  z }~u z}~z}~ ! ]^_`'-. ;#$%&b)]^_`8bb NOP T3 a ]^_`hi]^_`]^_`58 34 Y%& B]^_`EFK-W\`^LM]^_`]^_`mno GgV }~LuS${V),0789:; V #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZaGOPQvwy{|\bcdefghijklmnopqrstuz}~  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTWZavwy{|  #$%&()*+./0123456789:;<>?@ABCDEFHIJKLMNRSTZavwy{|  #$%&()*+./0123456789:;<>?@ABCDFHIJKLMNRSTZ a vwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<=>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRST avwy{|/045789:;<>?@ABCFIJKLMNRSTaGOPQvwy\{|bcdfghijklmnopqrstuzG}~OPQ\bcdfghijklmnopqrstuzG}~OPQbcdfghijklmnopqrstuzG}~OPQdfghijklmnopqrstuzG}~OPQfghijklmnopqrstuOPQz}~OPQijklmnopqrstuz}~klmnopqrstuOPQz}~OPQlmnopqrstuOPQz}~mnopqrstuOPQz}~opqrstuOPQz}~qrstuOPQz}~qrstuOPQz}~rstuz}~stuz}~=}W=2e3>qP>CB=V>VD  ~&'?@V-00<=)==86;>>~%*EFGHJKMjklmnop>IJwxyz{|}~q abuZlr=  0!=|* ,4/>57As9jC60VU =EFK>QR 1-0mno>q= !(%$'z;+}~,>-W0350.:<?_Acc@GH XN&M[^]ughiyr{v   fv  kCp 4 9s $cXVYZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345#n6789:;<INOPQRSTUVWXYZ[\]^_`abcdefghXiVYZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6789:;<X78V/YZ[\]^_`abDcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;Vt<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;Vx<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+lu,m-./012345n6X789:;V<YZ[\]^_`abcdefghijk !"#$%&'()*+l,m-./012345Xn6789:;< !"#$%&'()*+,-./012X3456789:;< !"#$%&'()*+,-./012345V6789:;< "#$%&'()*+,-./012345V6789:;< !"#$%&'()*+,-./0123456789:;< !"#$%&'()*+,-./0123456789:;< !"#$%&'()*+,-./0123456789:;(< !"#$%&'()*+,-./0123456789:;:< !"#$%&'()*+,-./0123456789:;L< !"#$%&'()*+,-./0123456789:;v< !"#$%&'()*+,-./0123456789:;< !"#$%&'()*+,-./0123456789:;< !"#$%&'()*+,-./0123456789:;< !"#$%&'()*+,-./0123456789:;" opy2SzwwxL)TB`rd O.1+ {|Y\s?@tABCDEFGHIJKtL "#MNOPQRSTU\e s)ItXe6 qv(= kklk! 67 QLmj$j R ! SVUTFGIHL#(*) 45Jno+-,4J.jK*j\CIH#"wzyw%'v"qptrPNRhi/01DEBC?@Ac&(]SPTWVeUXx~{$&us   K%,.2f:abgR=d+|8D->=7``A}9F3;c23)Y01<@^/'EZ8<65BG:?`_NM>;O[9cB !t t t tt  tt?  t W * 0,:Gh C4CXyz  WW  !QNN z   h J  - NNNG j /; U ]]s N+.EPc YvR%   ] 8 NE8 _ _ _ v v 8ENNl 4Z :a&09> !k xtK   zF p i !  %$  0    ,h h h     ;Q   A;9   ]  :   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Not a GLOB referencea symbolNot a SCALAR referenceCORE::FILEHANDLEPACKAGE(anonymous)Illegal division by zeroIllegal modulus zeropp.cCan't take %s of %gInteger overflow in srandCannot chr %gNot a HASH referenceSPLICESplit loop[out of range]Too manyNot enoughscalar referencereference to one of [$@%*]reference to one of [$@%&*]%s arguments for %spanic: unknown OA_*: %xfewat least at most Can't find an opnumber for "%d%lu%4p"Attempt to bless into a freed packageAttempt to bless into a referenceExplicit blessing to '' (assuming package main)Constant subroutine %-p undefinedNegative repeat count does nothingNon-finite repeat count does nothingOut of memory during list extendOut of memory during string extendInvalid negative number (%-p) in chrCan't modify index/value array slice in list assignmentCan't modify keys on array in list assignmentpanic: avhv_delete no longer supportedCan't modify key/value hash slice in %s assignmentOdd number of elements in anonymous hashsplice() offset past end of arraypanic: Start of forward hop (0x%p) is %zd bytes beyond legal end position (0x%p)panic: unimplemented op %s (#%d) calledType of arg %d to &CORE::%s must be array referenceType of arg %d to &CORE::%s must be hash%s referenceType of arg %d to &CORE::%s must be %sToo %s arguments for subroutine '%-p' (got %lu; expected %s%lu)Odd name/value argument for subroutine '%-p'8popoop0qPqxqooooqoqoooxxxxxxxxxyxytyDxxH0(2..........2........2/b2...........<21..1B3+3/.|3/./.p3V38@pЩ8X@ A( (!0 `  0000PP(( hhhhn  SUBSTRS = 0x%lx PPRIVATE = 0x%lx OFFS = 0x%lx [ %ld:%ld%s QR_ANONCV = 0x%lx SAVED_COPY = 0x%lx MOTHER_RE = 0x%lx MAXFIELD = %ld FIELDS = 0x%lx Field No. %ld (%s) sv(\0) MAGIC = 0x%lx MG_VIRTUAL = &PL_vtbl_%s MG_VIRTUAL = 0x%lx MG_VIRTUAL = 0 MG_PRIVATE = %d MG_FLAGS = 0x%02X TAINTEDDIR MINMATCH REFCOUNTED GSKIP COPY DUP LOCAL BYTES MG_OBJ = 0x%lx PAT = %s MG_LEN = %ld MG_PTR = 0x%lx => HEf_SVKEY %2ld: %lu -> %lu MG_TYPE = PERL_MAGIC_%s MG_TYPE = UNKNOWN(\%o) %5lu %s SKIP,IMPLICIT,NAUGHTY,VERBARG_SEEN,CUTGROUP_SEEN,USE_RE_EVAL,NOSCAN,GPOS_SEEN,GPOS_FLOAT,ANCH_MBOL,ANCH_SBOL,ANCH_GPOS,PMf_MULTILINE,PMf_SINGLELINE,PMf_FOLD,PMf_EXTENDED,PMf_EXTENDED_MORE,PMf_KEEPCOPY,PMf_NOCAPURE,IS_ANCHORED,NO_INPLACE_SUBST,EVAL_SEEN,CHECK_ALL,MATCH_UTF8,USE_INTUIT_NOML,USE_INTUIT_ML,INTUIT_TAIL,SPLIT,COPY_DONE,TAINTED_SEEN,TAINTED,START_ONLY,SKIPWHITE,NULL, SV AV HV CVINTRO,MULTI,ASSUMECV,SHAREKEYS,LAZYDEL,HASKFLAGS,OVERLOAD,CLONEABLE,ANON,UNIQUE,CLONE,CLONED,NODEBUG,LVALUE,NOWARN_AMBIGUOUS,WEAKOUTSIDE,CVGV_RC,DYNFILE,AUTOLOAD,HASEVAL,SLABBED,NAMED,LEXICAL,ISXSUB,ANONCONST,SIGNATURE,REFCOUNTED_ANYSV,IsMETHOD,XS_RCSTACK,EVAL_COMPILED,OOK,FAKE,READONLY,PROTECT,BREAK,pIOK,pNOK,pPOK,TEMP,OBJECT,GMG,SMG,RMG,arylen(#)rhash(%)debugvar(*)pos(.)symtab(:)backref(<)arylen_p(@)bm(B)overload_table(c)regdata(D)regdatum(d)env(E)envelem(e)fm(f)regex_global(g)hints(H)hintselem(h)isa(I)isaelem(i)nkeys(k)dbfile(L)dbline(l)shared(N)shared_scalar(n)collxfrm(o)tied(P)tiedelem(p)tiedscalar(q)qr(r)sig(S)sigelem(s)taint(t)uvar(U)uvar_elem(u)vstring(V)vec(v)utf8(w)destruct(X)substr(x)nonelem(Y)defelem(y)hook(Z)hookelem(z)lvref(\)checkcall(])extvalue(^)ext(~)UNOPBINOPLOGOPLISTOPPMOPSVOPPADOPPVOPLOOPCOPMETHOPUNOP_AUX,KIDS,PARENS,REF,MOD,STACKED,SPECIAL,CONST,KEEP,GLOBAL,CONTINUE,RETAINT,EVAL,NONDESTRUCT,HAS_CV,CODELIST_PRIVATE,IS_QRPVINVLSTPVIVPVNVPVMGREGEXPPVLVINVLISTPVGVPVAVPVHVPVCVPVFMPVIOPVOBJ&4~tppppppppppppppppppppYppl\,\ |t dTdddd<T T dddddddddddddddddddddd"""}}ddddddddddddddddddddddddddddddd ~PPPPPPPPPPHHHHHPP((((PPPPPPPPPPPPPPPPPPPPXAE>>EB|9:4AE>>EBX99b4AWARNING: %lx changed from %lx to %lx Can't determine class of operator %s, assuming BASEOP [%zd] PADIX = %lu FIELDIX = % lu (0x%lx) at 0x%lx %*s REFCNT = %ld %*s FLAGS = ( PARNO_TO_LOGICAL_NEXT = 0x%lx ???? - dump.c does not know how to handle this MG_LENWATCHING, %lx is currently %lx %123456789ABCDFY@3 !"#$%&o'(>?@ABCDIJKLMNOPQRTWX     ####'())))))))))))))788 88 <<>?@@@@DEFGHIIIIIIIIIISTTTTTYZ[\T^_`abbbeeeeeek<no88ZZZZCCDDDDDDDDDD((BBBBUU@@@@iigghhjjkkII  9.4& )2$ 8-# ,    _ $"  d  1 )CS1   A !AAAA AA 1=<??EHNNPUXXXXXXXZXXXX\_egg iiigggiiiNNigN eNNeeNNNNNNNjmprtt88NNex,,,888 888ee 88888888888888888888888888e888888888888eNeeeeeeeN88eeeeeeee8e88888888888888888 5   *G*'D'DT$MOD+1-AMPERANONHASHAPPENDASSIGNAVBAREBKWARDBOOLBOOL?BYTESCAN_FORCE_UTF8COMPLCOM_AGGCOM_RC1COM_SCALARCONSTCOPHHCVCV2GVDBGDEFDELDELETEDEREF1DEREF2DESCDOLISTDREFAVDREFHVDREFSVEARLYCVELEMENTEREDEVALSVEXISTSFAKEFILEFINALLYFTACCESSFTAFTERtFTSTACKEDFTSTACKINGGROWSGUESSEDHAS_HHHUSHHVIDENTIF_FALSEIF_UNDEFIMPLIMINARGSINBININCRINDEXEDINITFIELDSINITFIELD_AVINITFIELD_HVINPLACEINTITERKEEP_PVKEYSKVSLICELEXLINELINENUMLVLVDEFERLVINTROLVSUBMARKNEGNESTEDNO()NOINITNOVERNO_BAREWORD_IONUMONLY_UTF8_INVARIANTSOURINTROUTBINOUTCRPACKAGEREFCREPARSEREPL1STREVREVERSEDSHORTSLICESLICEWARNSQUASHSTATESTRICTSTRINGIFYSUBSVTARGTARGMYTOKENTRANSUNIUSEINTUSE_SVOPUTFkeyoffsetrangeDDDD@@@DD@! " ++dDdD, , >>> ">>&&&&&&.>   HD6@0@1244@;H;;@KHKKHBDDD $B"$$444 $TTTTA! $ $  @ @ $   D  @@@@@@@ d)d k d Et!{D{DK d d d d d  d d dd d dddddd d dddkklllllllllllllllllllllllllll$$$$ dk kdkk $            ě@@ {@@@@D@ @@ D HAS_TIMES PERLIO_LAYERS PERL_HASH_FUNC_SIPHASH13 PERL_HASH_USE_SBOX32 USE_64_BIT_ALL USE_64_BIT_INT USE_LARGE_FILES USE_LOCALE_COLLATE USE_LOCALE_NUMERIC USE_LOCALE_TIME USE_PERLIO  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@  !"#$%&'()*+,-./0123456789:;<=>?isa`!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_*/bin/sh0123456789abcdef0123456789ABCDEF01Code point 0x%lX is not Unicode, requires a Perl extension, and so is not portablepanic: memory wrapCan't localize through a reference"%s" %s %s can't be in a packageThe %s function is unimplementedUnsupported directory function "%s" calledUnsupported socket function "%s" calledInsecure dependency in %s%sModification of a read-only value attemptedModification of non-creatable hash value attempted, subscript "%-p"Modification of non-creatable array value attempted, subscript %dCan't use an undefined value as %s referenceCan't use string ("%-32p"%s) as %s ref while "strict refs" in useCan't use string ("%.32s") as %s ref while "strict refs" in useCan't use %s ref as %s refUnsuccessful %s on filename containing newlineUnquoted string "%s" may clash with future reserved wordSemicolon seems to be missingUse of uninitialized value%-p%s%sUse of uninitialized value%s%s%s `````````l``````````````````@L`A`A`A`A`A`A`A`A`A`A`A`A`A`A`AQQQQQQQQQQ`A`A`A`A`A`A`ASgSCSCSCSCSgCCCgCgCgCOCGCCCGCCCCCCCCCoCgCCCCCgCCCgCC`A`A`A`AaA`ASgSCSCSCSCSgCCCgCgCgCOCGCCCGCCCCCCCCCoCgCCCCCgCCCgCC`A`A`A`A`                               @ `@@@@@`@@`@@@@@@@@@O``@@`@@@`CCCCCOCCCCCCCCCCCCCCCCC@CCCCCCCOCCCCCOCCCCCCCCCCCCCCCCC@CCCCCCCOSKIPIMPLICITNAUGHTYVERBARG_SEENCUTGROUP_SEENUSE_RE_EVALNOSCANGPOS_SEENGPOS_FLOATANCH_MBOLANCH_SBOLANCH_GPOSRECURSE_SEENPESSIMIZE_SEENMULTILINESINGLELINEFOLDEXTENDEDEXTENDED_MORENOCAPTUREKEEPCOPYCHARSET0CHARSET1CHARSET2STRICTSPLITUNUSED_BIT_12UNUSED_BIT_13UNUSED_BIT_14UNUSED_BIT_15NO_INPLACE_SUBSTEVAL_SEENUNBOUNDED_QUANTIFIER_SEENCHECK_ALLMATCH_UTF8USE_INTUIT_NOMLUSE_INTUIT_MLINTUIT_TAILIS_ANCHOREDCOPY_DONETAINTED_SEENSUCCEEDSEOLMEOLEOSNBOUNDNBOUNDLNBOUNDUNBOUNDAREG_ANYSANYANYOFANYOFDANYOFLANYOFPOSIXLANYOFHANYOFHbANYOFHrANYOFHsANYOFRANYOFRbANYOFHbbmNANYOFMNPOSIXDNPOSIXLNPOSIXUNPOSIXACLUMPBRANCHLEXACTEXACTLEXACTFEXACTFLEXACTFUEXACTFAAEXACTFAA_NO_TRIEEXACTFUPEXACTFLU8LEXACT_REQ8EXACTFU_REQ8EXACTFU_S_EDGELNBREAKTRIECAHOCORASICKAHOCORASICKCNOTHINGSTARPLUSCURLYCURLYNCURLYMCURLYXWHILEMSROPENSRCLOSEREFFREFFLREFFUREFFAREFNREFFNREFFLNREFFUNREFFANLONGJMPBRANCHJIFMATCHUNLESSMSUSPENDIFTHENGROUPPMINMODLOGICALRENUMGOSUBGROUPPNINSUBPDEFINEPENDLIKEOPFAILACCEPTVERBPRUNEMARKPOINTCOMMITCUTGROUPKEEPSLOOKBEHIND_ENDOPTIMIZEDPSEUDOREGEX_SETTRIE_nextTRIE_next_failEVAL_BEVAL_B_failEVAL_postponed_ABEVAL_postponed_AB_failCURLYX_endCURLYX_end_failWHILEM_A_preWHILEM_A_pre_failWHILEM_A_minWHILEM_A_min_failWHILEM_A_maxWHILEM_A_max_failWHILEM_B_minWHILEM_B_min_failWHILEM_B_maxWHILEM_B_max_failBRANCH_nextBRANCH_next_failCURLYM_ACURLYM_A_failCURLYM_BCURLYM_B_failIFMATCH_AIFMATCH_A_failCURLY_B_minCURLY_B_min_failCURLY_B_maxCURLY_B_max_failCOMMIT_nextCOMMIT_next_failMARKPOINT_nextMARKPOINT_next_failSKIP_nextSKIP_next_failCUTGROUP_nextCUTGROUP_next_failKEEPS_nextKEEPS_next_failREF_nextREF_next_failarylen_pbackrefcheckcallcollxfrmdebugvardestructenvelemhintselemhookelemisaelemlvrefmglobnkeysnonelemovrldpackelemposregdataregdatumsigsigelemsubstrtaintuvarnull operationstubpushmarkwantarrayconstant itemscalar variableglob valueglob elemprivate variablepadsv scalar assignmentprivate arrayprivate hashprivate valueref-to-glob castscalar dereferencearray lengthsubroutine dereferenceanonymous subroutinesubroutine prototypereference constructorsingle ref constructorreference-type operatorblessquoted execution (``, qx)append I/O operatorregexp internal guardregexp internal resetregexp compilationpattern match (m//)pattern quote (qr//)substitution (s///)substitution iteratortransliteration (tr///)list assignmentscalar chopscalar chompdefined operatorundef operatorstudymatch positioninteger preincrement (++)integer predecrement (--)integer postincrement (++)integer postdecrement (--)exponentiation (**)integer multiplication (*)integer division (/)integer modulus (%)repeat (x)integer addition (+)integer subtraction (-)concatenation (.) or stringleft bitshift (<<)right bitshift (>>)numeric lt (<)integer lt (<)numeric gt (>)integer gt (>)numeric le (<=)integer le (<=)numeric ge (>=)integer ge (>=)numeric eq (==)integer eq (==)numeric ne (!=)integer ne (!=)numeric comparison (<=>)integer comparison (<=>)string ltstring gtstring lestring gestring eqstring nestring comparison (cmp)numeric bitwise and (&)numeric bitwise xor (^)numeric bitwise or (|)string bitwise and (&.)string bitwise xor (^.)string bitwise or (|.)integer negation (-)notnumeric 1's complement (~)string 1's complement (~)smart matchoctsubstr leftrindexsprintfcryptucfirstlcfirstlcquotemetaarray dereferenceconstant array elementindex/value array sliceeach on arrayvalues on arraykeys on arraydeleteexistshash dereferencehash elementkey/value hash slicearray or hash lookupsplitjoin or stringlist sliceempty anon hash/arraysplicepushpopunshiftreversegrepgrep iteratorany/all iteratormap iteratorflipfloprange (or flip)range (or flop)logical and (&&)logical or (||)logical xordefined or (//)conditional expressionlogical and assignment (&&=)logical or assignment (||=)defined or assignment (//=)subroutine entrysubroutine exitlvalue subroutine returncheck subroutine argumentssubroutine argumentcallerwarndiesymbol resetline sequencedebug next statementiteration finalizerblock entryblock exitforeach loop entryforeach loop iteratorloop exitredodumpmethod lookupmethod with known namesuper with known namegiven()leave given blockwhen()leave when blockfilenoumaskbinmodeuntietieddbmopendbmcloseselect system callgetcwrite exitsysseeksysreadsyswriteeoftelltruncatefcntlioctlflocksendrecvsocketsocketpairbindconnectlistenacceptshutdowngetsockoptsetsockoptgetsocknamegetpeername-R-W-r-w-x-e-s-M-O-o-z-S-b-f-d-u-g-k-l-t-Tchdirchrootrenamesymlinkreadlinkmkdirrmdiropendirreaddirtelldirseekdirrewinddirclosedirforkwaitwaitpidsystemkillgetppidgetpgrpsetpgrpgetprioritysetprioritytimeslocaltimegmtimealarmsleepshmgetshmctlshmreadshmwritemsggetmsgctlmsgrcvsemopsemgetsemctldo "file"eval hintseval "string"eval "string" exiteval {block}eval {block} exitgethostbynamegethostbyaddrgethostentgetnetbynamegetnetbyaddrgetnetentgetprotobynamegetprotobynumbergetprotoentgetservbynamegetservbyportgetserventsethostentsetnetentsetprotoentsetserventendhostentendnetentendprotoentendserventgetpwnamgetpwuidgetpwentsetpwentendpwentgetgrnamgetgrgidgetgrentsetgrentendgrentgetloginunknown custom operatorCORE:: subroutineArray/hash switchprivate subroutinelist of private variableslvalue ref assignmentlvalue array referenceanonymous constantderived class testcomparison chainingcomparand shufflingtry {block}try {block} exitpop trycatch {} blockpush defer {} blockboolean type testweakref type testreference weakenreference unweakenhash element exists ormethod startinitialise fieldclass namefreed opgvsvpadsvpadsv_storepadavpadhvpadanyrv2gvrv2svav2arylenrv2cvanoncodesrefgenreadlinercatlineregcmayberegcresetregcompsubstsubstconttranstransrsassignaassignschopschompi_preinci_predeci_postinci_postdecpowi_multiplyi_dividei_modulorepeati_addi_subtractmulticoncatleft_shiftright_shifti_lti_gti_lei_gei_eqi_nei_ncmpsltsgtslesnescmpnbit_andnbit_xornbit_orsbit_andsbit_xorsbit_ori_negatencomplementscomplementsubstr_leftrv2avaelemfastaelemfast_lexaelemfastlex_storekvasliceaeachavaluesakeysrv2hvhelemkvhslicemultiderefjoinlsliceanonlistanonhashemptyavhvgrepstartgrepwhileanystartallstartanywhilemapstartmapwhileflipdorcond_exprandassigndorassignentersubleavesubleavesublvargcheckargelemargdefelemlineseqnextstatedbstateunstackenterleavescopeenteriterenterloopleaveloopmethod_namedmethod_supermethod_redirmethod_redir_superentergivenleavegivenenterwhenleavewhenpipe_opsselectenterwriteleavewriteprtfsockpairgsockoptssockoptftrreadftrwriteftrexecftereadftewritefteexecftisftsizeftmtimeftatimeftctimeftrownedfteownedftzeroftsockftchrftblkftfileftdirftpipeftsuidftsgidftsvtxftlinkftttyfttextftbinaryopen_dirtmsdofilehintsevalleaveevalentertryleavetryghbynameghbyaddrghostentgnbynamegnbyaddrgnetentgpbynamegpbynumbergprotoentgsbynamegsbyportgserventshostentsnetentsprotoentsserventehostentenetenteprotoenteserventgpwnamgpwuidgpwentspwentepwentggrnamggrgidggrentsgrentegrentcustomcoreargsavhvswitchruncvpadcvintrocvclonecvpadrangerefassignlvrefslicelvavrefanonconstcmpchain_andcmpchain_dupentertrycatchleavetrycatchpoptrypushdeferhelemexistsormethstartinitfieldclassnamefreedCONSTRUCTSTARTWHENBLOCKGIVENLOOP_ARYLOOP_LAZYSVLOOP_LAZYIVLOOP_LISTLOOP_PLAINFORMATDEFERHUPQUITTRAPABRTBUSFPEKILLUSR1SEGVUSR2PIPETERMSTKFLTCHLDCONTTSTPTTINTTOUURGXCPUXFSZVTALRMPROFWINCHPWRSYSNUM32NUM33RTMINNUM35NUM36NUM37NUM38NUM39NUM40NUM41NUM42NUM43NUM44NUM45NUM46NUM47NUM48NUM49NUM50NUM51NUM52NUM53NUM54NUM55NUM56NUM57NUM58NUM59NUM60NUM61NUM62NUM63RTMAXIOTCLDPOLLconstant lexical array elementconst lexical array element storesubroutine argument default valueredirect method with known nameredirect super method with known name|pdXL@puj_TI>3(x3,>3333333333333333333333333<<<<<<<<<3333333<333=333+=333333333>33>1=1====1B=11B1===11W?=1DB=111111111A1A==v;C==AGA1GA===;A;A;A;A;A;A;A;A;ACC====111111111111111111111111111==5C=1BBB1111111111111111111111111=1=2\(\(\(\(\(\(\(\(\2\(\p\X\2\2\8\}hÀՀ@ T$T$XDDDDDїɖHK4ޔ]]XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX]]gv.cAUTOLOAD @ A( (!0 `  0000PP(( hhhhn  ((overloadingpanic: gv name too long (%lu)CORE::ErrnoTie::Hash::NamedCaptureEXPORTEXPORT_OKEXPORT_FAILEXPORT_TAGSSIGHILD_ERROR_NATIVEAPTURELOBAL_PHASE AST_FH AST_SUCCESSFUL_PATTERN ATCHOSTMATCHAFE_LOCALESAINTNICODETF8LOCALETF8CACHEARNING_BITSIO::File::dirhandleBad symbol for %s_tie_it::SUPERIO/File.pm(${}Stub found while resolvingCan't resolve((nilin overloaded package has no overloaded magic left %d%lu%4p::_GEN_%ld(@{}(%{}(*{}(&{}(++(--(!(=(neg(<>(int(<(<=(>(>=(==(!=(lt(le(gt(ge(eq(ne(%(%=(**(**=(<<(<<=(>>(>>=(&(&=(&.(&.=(|(|=(|.(|.=(^(^=(^.(^.=(~(~.(atan2(cos(sin(exp(log(sqrt(x(x=(.(.=(~~(-X(qrAttempt to free unreferenced glob pointerspanic: gp_free failed to free glob pointer - something is repeatedly re-creating entriesCannot convert a reference to %s to typeglob&CORE::%s cannot be called directlyVariable "%c%d%lu%4p" is not imported (Did you mean &%d%lu%4p instead?) Global symbol "%s%d%lu%4p" requires explicit package name (did you forget to declare "my %s%d%lu%4p"?)$%c is no longer supported as of Perl 5.30Had to create %d%lu%4p unexpectedlypanic: sv_upgrade to unknown type %luName "%2p::%2p" used only once: possible typopanic: Can't use %c%c because %s is not availablepanic: Can't use %c%c because %s does not define _tie_itCan't use anonymous symbol table for method lookupCan't locate package %-p for @%2p::ISAWhile trying to resolve method call %.*s->%.*s() can not locate package %5p yet it is mentioned in @%.*s::ISA (perhaps you forgot to load %5p?)Use of inherited AUTOLOAD for non-method %-p::%d%lu%4p() is no longer allowedCan't locate object method %d%lu%9p via package %7pCan't locate object method %d%lu%9p via package %5p (perhaps you forgot to load %5p?)%s method "%-256p" overloading "%s" in package "%3p", right argument in overloaded package , right argument has no overloaded magicOperation "%s": no method found,%sargument %s%-p%s%-pCopy method did not return a referenceOverloaded dereference did not return a referenceAttempt to free nonexistent shared string '%s'%sUse of each() on hash after insertion without resetting hash iterator results in undefined behaviorAttempt to delete readonly key '%-p' from a restricted hashAttempt to delete disallowed key '%-p' from a restricted hashAttempt to access disallowed key '%-p' in a restricted hashpanic: refcounted_he_value bad flags %lxpanic: refcounted_he_chain_2hv bad flags %lxpanic: refcounted_he_fetch_pvn bad flags %lxpanic: refcounted_he_fetch_sv bad flags %lxpanic: refcounted_he_new_sv bad flags %lxpanic: cop_store_label illegal flag bits 0x%lx (utf8)panic: hv name too long (%lu)panic: hv_placeholders_p%ld/%ldpanic: hv_placeholders_setfetchxl`ti^SH=2'ڣϣģCannot modify shared string table in hv_%selseif should be elsif0X PP7\\\\d\\>! !! j K , |!]! sT1` 7 1 u:T {Hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh?hh``````````````````````````````` `H  ````` ``h` ` 88@8x 88888888888888888888888888888 888 ( 8888888888`@(xX8  d 1    O   &   x  y POSIXint_curr_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signcurrency_symbolint_frac_digitsint_p_cs_precedesint_p_sep_by_spaceint_n_cs_precedesint_n_sep_by_spaceint_p_sign_posnint_n_sign_posnlocale.c Called by %s: %u ; errno=%d%s: %u: panic: %s%s%s %s Called via %s: %uUnknown locale category %dis an unknown category'%.*s' %s 1.51,5123456789UTFutf; can't set it to ; codeset=%sunsetLC_CTYPEa fallback localethe standard localelocale name not determinableLANGUAGEPERL_BADLANGLC_ALLUnexpectedly got 'dummy_trialPERL_SKIP_LOCALE_INIT LANGUAGE = %c%s%c, LC_ALL = %c%s%c, %s = %c%s%c, LANG = %c%s%c any of: %s ("%s") PERL_UNICODELC_NUMERICLC_COLLATELC_TIMELC_MESSAGESLC_MONETARYLC_ADDRESSLC_IDENTIFICATIONLC_MEASUREMENTLC_PAPERLC_TELEPHONELC_NAMEInternal length calculation wrong. "%s" was not entirely added to "%.*s"; needed=%zu, had=%zuCan't change locale for %s (%d) from '%s' to '%s' %sCould not find current %s localedoesn't list every locale categoryneeds an '=' to split name=valuehas LC_ALL, which is illegal hereUnexpected return from parse_LC_ALL_stringnl_langinfo returned empty for %ld in supposed locale '%s'; which really is '%s' codeset is '%s'; radix='%s'; January='%s'; strtod(1,5)=%g, strtod(1.5)=%g !"#$%&'()*+,-./:<=>?@[\]^_`{|}~Can't find separator in ALT_DIGITS representation '%s' for locale '%s'Unknown locale category %d%s%sLocale '%s' is unsupported, and may hang or crash the interpreterLocale '%s' contains (at least) the following characters which have unexpected meanings: %s The Perl program will use the expected meanings The following characters (and maybe others) may not have the same meaning as the Perl program expects: %s perl: warning: Setting lHxHt1HMKu)1IHD$dH+%(u+HHc[]#@H$H=wfBH!EHHOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO[[[[x[l[`[T[\]~]s]h]]]R]G]<]1]&]]]]\\\\\\\\\\\]_P`0`___________ccbbbbbbb`d7dcccb@b7`77777777777p|du@HHɩɩ4|a|||||,,LLDܨ  77tt77t7ttttt777777777777M7777t7777777\Ek7777777L7777777777777777777777777777777777777777777t777777777tt7tKd?KKKKKKKKKKKKK((KKKKKKKKKKKKqhhKhqq]]Tֵ+++TT88Rk|ĵ|ĵĵĵĵĵĵ~ĵddĵ%tc!ԻԻԻԻԻþþԻh9Ի*Ի7ԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻ`ԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻ_ԻKͽԻԻͽԻԻAԻԻ_KͽԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻԻdA߿SG~L~L D T  d D   h D  gUVVPT0UTxUS ^]^*^*^*^*^*^*^*^*^*^]]^t:rttt:r:rt:rsInitialization of state variables in list currently forbiddenArray passed to stat will be coerced to a scalar@ A( (!0 `  0000PP(( hhhhn  ((op:link_freed_opCan't "%s" out of %sSTDERRSTDOUTSTDINARGVARGVOUTDATA"my"subroutine signature"state" Can't use global %.*s in %sundefFIELDS(empty) %*s[%d]%*s%lX%*s0x%02lX%*s .. INFINITYTR_UNLISTED TR_SPECIAL_HANDLING 0x%02lX Prototype mismatch: sub %-p (%d%lu%4p): none vs a SCALARan ARRAYa HASHmyourdo blockCan't declare %s in "%s"backtickentereval_;\[%@];\[$*]?$@@%&*$Subroutine %-p redefinedMethod %-p redefinedautouseop:rcpv_newnegative pattern binding (!~)a variableanonymous hash ({})anonymous array ([])a constant (undef)a constant (%s)a constant (%-p)oops: oopsAVoops: oopsHVlocalCan't modify %s in %sUseless localization of %sreflagsreflags_charsetDB::postponeda "finally" blocka "defer" blockblock or sub {}Too many arguments for %-p;@%one of %.*sscalarNot enough arguments for %-p construct() operatorBareword found in conditionalprototype(Format %-p redefinedFormat STDOUT redefinedCORE/prevailing_version%s (did you want stat %-p?)__ANONIO__Too many arguments for %s%s%c...%cNot enough arguments for %spanic: ck_grep, type=%uhash or arraykeys readpiperequire::SUPER::BEGIN AX_NESTED_EVAL_BEGIN_BLOCKSUNITCHECKToo late to run CHECK blockModule::Install::DSLToo late to run INIT block__ANON__::__ANON__%s[%s:%u]%s:%u-%u@array%hashModule name must be constantattributesFile::Globattributes.pm, @$%__ANON__::Slurpy parameter not lastAssignment to both a list and a scalarpanic: unexpected setjmp() result Magical list constants are not supportedBareword "%-p" not allowed while "strict subs" in useBareword filehandle "%s" not allowed under 'no feature "bareword_filehandles"'panic: allocmy illegal flag bits 0x%lxCan't use global %c^%c%.*s in %sScalar value @%-p%c%s%c better written as $%-p%c%s%c%%%-p%c%s%c in scalar context better written as $%-p%c%s%cScalar value @%-p%c%-p%c better written as $%-p%c%-p%c%%%-p%c%-p%c in scalar context better written as $%-p%c%-p%cSorry, hash keys must be smaller than 2**31 bytesNo such class field "%-p" in variable %d%lu%4p of type %2pPossible precedence problem on bitwise %s operatorCan't use bareword ("%-p") as %s ref while "strict refs" in usepanic: rv2cv_op_cv bad flags %xpanic: can't register custom OP %spanic: custom_op_get_field(): invalid field %d panic: op_sibling_splice(): NULL parentPossible precedence issue with control flow operator (%s)Possible precedence problem between ! and %sType of arg %d to %s must be %s (not %s)Type of arg %d to %-p must be %s (not %s)Constant subroutine %-p redefinedlvalue attribute ignored after the subroutine has been definednon-destructive substitution (s///r)non-destructive transliteration (tr///r)Useless use of %-p in void contextUseless use of %s in void contextUseless use of %s in scalar contextFound = in conditional, should be ==panic: unexpected lvalue entersub args: type/targ %ld:%lupanic: unexpected constant lvalue entersub entry via type/targ %ld:%luCan't modify non-lvalue subroutine call of &%-p in %sCan't localize lexical variable %d%lu%4pThe experimental declared_refs feature is not enabledDeclaring references is experimentalCan't modify reference to localized parenthesized array in list assignmentCan't modify reference to parenthesized hash in list assignmentCan't modify reference to %s in %sExperimental aliasing via reference not enabledAliasing via reference is experimentalMissing comma after first argument to return'%s' trapped by operation maskpanic: gen_constant_list JMPENV_PUSH returned %dpanic: op_contextualize bad context %ldpanic: fold_constants JMPENV_PUSH returned %dCan't use an array as a referenceCan't use a hash as a referenceMultidimensional hash lookup is disabledpanic: ck_entersub_args_proto CV with no proto, flags=%lxMalformed prototype for %-p: %-pThis use of my() in false conditional is no longer allowedValue of %s%s can be "0"; test with defined()panic: newFORLOOP, found %s, expecting pushmarkpanic: newFORLOOP, found %s, expecting padsvpanic: newFORLOOP, found %s at %zd, expecting padsvpanic: newFORLOOP, padsv at %zd targ is %zd, not %zdCan't use %s for loop variableAttribute prototype(%d%lu%4p) discards earlier prototype attribute in same subPrototype '%d%lu%4p' overridden by attribute 'prototype(%d%lu%4p)' in %-p$[ used in %s (did you mean $] ?)Missing comma after first argument to %s functionUseless use of %s with no valuesExperimental %s on scalar is now forbiddendelete argument is not a HASH or ARRAY element or sliceexists argument is not a subroutine nameexists argument is not a HASH or ARRAY element or a subroutineOP_HELEMEXISTSOR argument is not a HASH elementCan't use 'defined(@array)' (Maybe you should just omit the defined()?)Can't use 'defined(%%hash)' (Maybe you should just omit the defined()?)each on anonymous hash will always start from the beginningeach on anonymous array will always start from the beginninglength() used on %-p (did you mean "scalar(%s%-p)"?)length() used on %%hash (did you mean "scalar(keys %%hash)"?)length() used on @array (did you mean "scalar(@array)"?)Can't modify reference to %s in scalar assignmentBareword in require must not start with a double-colon: "%s" Bareword in require maps to empty filename"%s %s" used in sort comparison/%-p/ should probably be written as "%-p"Too many nested BEGIN blocks, maximum of %ld allowedTreating %s::INIT block as BEGIN block as workaroundPrototype on BEGIN block ignoredAttribute on BEGIN block ignoredBEGIN not safe after errors--compilation abortedUseless use of /d modifier in transliteration operatorReplacement list is longer than search listApplying %s to %-p will act on scalar(%-p)Applying %s to %s will act on scalar(%s)Using !~ with s///r doesn't make senseUsing !~ with tr///r doesn't make senseUse of /g modifier is meaningless in splitVersion number must be a constant numberuse VERSION of 5.39 or above is not permitted while another use VERSION is in scopeuse VERSION is not permitted while another use VERSION of 5.39 or above is in scopeDowngrading a use VERSION declaration to below v5.11 is not permittedChanging use VERSION while another use VERSION is in scope is deprecated, and will become fatal in Perl 5.44Parentheses missing around "%s" listOptional parameter lacks default expressionMandatory parameter follows optional parameterMultiple slurpy parameters not allowed?@*@-'@S%@p= #@S@d;O@(\@%C @~R8 @Dl)@use no Can't use '%c' after -mname ()..//5.42.0/x86_64-linux/5.42.0%s/%seval_sv()require q%c%s%cCannot set tied @DB::argsDB::DBDB::dblineDB::subDB::singleDB::traceDB::signalpagesize unknown -PERL_RAND_SEEDPERL_INTERNAL_RAND_SEEDv5.42.0panic: sysconf: %spanic: bad pagesize %ldmain::F%s failed--call queue abortedpanic: top_env, v=%d PERL_DESTRUCT_LEVELUnable to flush stdout: %s main::Scalars leaked: %ld Unexpected exit %luPERL5DB_THREADEDno Devel::use Devel:: split(/,/,q{%s}); Missing argument to -%cNo directory specified for -IPERL5DB/dev/nullmain%240sDB::CORE::GLOBAL::No code specified for -%cuse Config; Config::_V()helpPERL5OPTCDIMUdmtwWPERL5LIBPERLLIBPERL_USE_UNSAFE_INC/dev/fd/program input from stdinCan't open /dev/null: %s Illegal suidscriptperlPERLCan't chdir to %sperl.cInternals::VIO::Seekable::IO::Handle::IO::File::ISAExporter::stdoutstderr:utf8PENPERL_SIGNALSunsafePERL_SIGNALS illegal: "%s"panic: top_env %s syntax OK panic: restartop in perl_run Unexpected exit failure %ldModule name required with -%c optionInvalid module name %.*s with -%c option: contains single ':'Compiled at Feb 16 2026 02:30:38-i used with no filenames on the command line, reading from STDINBEGIN failed--compilation abortedpanic: restartop in call_list Unbalanced scopes: %ld more ENTERs than LEAVEs Unbalanced saves: %ld more saves than restores Unbalanced tmps: %ld more allocs than frees Unbalanced context: %ld more PUSHes than POPs Unbalanced string table refcount: (%ld) for "%s" This is perl 5, version 42, subversion 0 (%-p) built for x86_64-linux Copyright 1987-2025, Larry Wall Perl may be copied only under the terms of either the Artistic License or the GNU General Public License, which may be found in the Perl 5 source kit. Complete documentation for Perl, including FAQ lists, should be found on this system using "man perl" or "perldoc perl". If you have access to the Internet, point your browser at https://www.perl.org/, the Perl Home Page. -0[octal/hexadecimal] specify record separator (\0, if no argument) -a autosplit mode with -n or -p (splits $_ into @F) -C[number/list] enables the listed Unicode features -c check syntax only (runs BEGIN and CHECK blocks) -d[t][:MOD] run program under debugger or module Devel::MOD -D[number/letters] set debugging flags (argument is a bit mask or alphabets) Usage: %s [switches] [--] [programfile] [arguments] Recompile perl with -DDEBUGGING to use -D switch (did you mean -d ?) "-%c" is on the #! line, it must also be used on the command line%sCan't emulate -%.1s on #! lineUnrecognized switch: -%.1s (-h will show valid options)use Config; Config::config_vars(qw%c%s%c)Unrecognized switch: -%s (-h will show valid options)Illegal switch in PERL5OPT: -%c/opt/hostedtoolcache/perl/5.42.0/x64/lib/site_perl/5.42.0/x86_64-linux/opt/hostedtoolcache/perl/5.42.0/x64/lib/site_perl/5.42.0/opt/hostedtoolcache/perl/5.42.0/x64/lib/5.42.0/x86_64-linux/opt/hostedtoolcache/perl/5.42.0/x64/lib/5.42.0Wrong syntax (suid) fd script name "%s" Missing (suid) fd script name No %s allowed with (suid) fdscriptCan't open perl script "%s": %s YOU HAVEN'T DISABLED SET-ID SCRIPTS IN THE KERNEL YET! FIX YOUR KERNEL, PUT A C WRAPPER AROUND THIS SCRIPT, OR USE -u AND UNDUMP! Can't ignore signal CHLD, forcing to defaultNo Perl script found in input -e commandline one line of program (several -e's allowed, omit programfile) -E commandline like -e, but enables all optional features -f don't do $sitelib/sitecustomize.pl at startup -F/pattern/ split() pattern for -a switch (//'s are optional) -g read all input in one go (slurp), rather than line-by-line (alias for -0777) -i[extension] edit <> files in place (makes backup if extension supplied) -Idirectory specify @INC/#include directory (several -I's allowed) -l[octnum] enable line ending processing, specifies line terminator -[mM][-]module execute "use/no module..." before executing program -n assume "while (<>) { ... }" loop around program -p assume loop like -n but print line also, like sed -s enable rudimentary parsing for switches after programfile -S look for programfile using PATH environment variable -t enable tainting warnings -T enable tainting checks -u dump core after parsing program -U allow unsafe operations -v print version, patchlevel and license -V[:configvar] print configuration summary (or a single Config.pm variable) -w enable many useful warnings -W enable all warnings -x[directory] ignore text before #!perl line (optionally cd to directory) -X disable all warnings Run 'perldoc perl' for more help with Perl. split(/,/,q)J H H HLZLAJN H HM H H HI H H H H HAJ\JNAJENN H H H H H H H H=L H*LNAJAJKJ[K H HJIJ HJ H HJ\JJOLAJ:utf8:utf8:utf8:utf8 HAS_LONG_DOUBLE HAS_STRTOLD PERL_COPY_ON_WRITE PERL_DONT_CREATE_GVSV PERL_MALLOC_WRAP PERL_OP_PARENT PERL_PRESERVE_IVUV PERL_USE_SAFE_PUTENV USE_LOCALE USE_LOCALE_CTYPE USE_PERL_ATOF@ A( (!0 `  0000PP(( hhhhn  ((UNIVERSAL_charnamesv%sUsage: invocant->DOES(kind)Usage: %2p::%2p(%s)Usage: %2p(%s)Usage: CODE(0x%lx)(%s)reference, kindobject-ref, methodsv, failok=0SCALAR[, ON]SCALAR[, REFCOUNT]filehandle[,args]inputoutputdetails%-p(%-p)name[, all ][all]msixxnpAPTURE_ALLpackage, ...$key$key, $value$lastkeylobj, ...lobjlobj is not of type versionlobj, robj, ...verver is not of type versionUNIVERSAL::isautf8::unicode_to_nativeutf8::native_to_unicodeRegexp::DESTROYUNIVERSAL::canUNIVERSAL::DOESUNIVERSAL::importUNIVERSAL::unimportUNIVERSAL::VERSIONversion::_VERSIONversion::()version::newversion::parseversion::(""version::stringifyversion::(0+version::numifyversion::normalversion::to_decimalversion::to_dotted_decimalversion::(cmpversion::(<=>version::vcmpversion::(boolversion::booleanversion::(+version::(-version::(*version::(/version::(+=version::(-=version::(*=version::(/=version::(absversion::(nomethodversion::noopversion::is_alphaversion::qvversion::declareversion::is_qvversion::tupleversion::from_tupleutf8::is_utf8utf8::validutf8::encodeutf8::decodeutf8::upgradeutf8::downgradeInternals::SvREADONLY\[$%@];$Internals::SvREFCNT\%Internals::stack_refcountedconstant::_make_const\[$@]PerlIO::get_layers*;@re::is_regexpre::regname;$$re::regnamesre::regnames_countre::regexp_patternInvalid version format (version required)UNIVERSAL does not export anythingAttempt to call undefined %s method with arguments (%5p%s) via package %5p (Perhaps you forgot to load the package?)Usage: version::new(class, version)Usage: UNIVERSAL::VERSION(sv, ...)Cannot find version of an unblessed reference%2p does not define $%2p::VERSION--version check failed%2p version %-p required--this is only version %-p%-p defines neither package nor VERSION--version check failedget_layers: unknown argument '%s'NULL array element in re::regnames()Value %ld in version is negativeoperation not supported with version objectInternals::hv_clear_placeholdersTie::Hash::NamedCapture::_tie_itTie::Hash::NamedCapture::TIEHASHTie::Hash::NamedCapture::FETCHTie::Hash::NamedCapture::STORETie::Hash::NamedCapture::DELETETie::Hash::NamedCapture::CLEARTie::Hash::NamedCapture::EXISTSTie::Hash::NamedCapture::SCALARTie::Hash::NamedCapture::FIRSTKEYTie::Hash::NamedCapture::NEXTKEYTie::Hash::NamedCapture::flagsuniversal.cNEGATIVE_INDICESEXTENDPUSHPOPUNSHIFTSTORESIZEpanic: av_extend_guts() negative count (%ld)Out of memory during array extendargbuiltin::indexeddefined string&%-pbuiltin::%-pa CODEexport_lexically&%sbuiltin.cInvalid version bundle %5pbuiltin::builtin::importfalsenanis_boolis_weakblessedrefaddrreftypeceilflooris_taintedtrimcreated_as_stringcreated_as_numberload_modulepanic: unhandled opcode %ld for xs_builtin_func1_void()Built-in function 'builtin::%s' is experimentalpanic: unrecognised builtin_const value %ldexport_lexically can only be called at compile timeOdd number of elements in export_lexicallyExpected a reference in export_lexicallyExpected %s reference in export_lexicallypanic: unhandled opcode %ld for xs_builtin_func1_scalar()builtin::import can only be called at compile timeBuiltin version bundle "%s" is not supported by Perl 5.42.0ppppppppp```````````````````````````pp`````p @ P ` p '%-p' is not recognised as a builtin function0C/proc/self/exeMalformed attribute stringparam$selfset_0123456789._%2p::ISA, %-p%s::newclass.c$(self)%(params)field initialiser expressionreaderwriterClass attribute %-p requires a valueUnrecognized class attribute %-pField attribute %-p requires a valueUnrecognized field attribute %-p%5p is not a valid name for a generated methodCannot apply a :writer attribute to a non-scalar fieldOnly scalar fields can take a :param attributeField already has a parameter name, cannot add anotherCannot assign :param(%-p) to field %-p because that name is already in useUnexpected characters while parsing class :isa attribute: %sClass already has a superclass, cannot add anotherClass :isa attribute requires a class but %10p is not oneCannot '%s' outside of a 'class'Odd number of arguments passed to %10p constructorCannot create an object of incomplete class %10pUnrecognised parameters for %10p constructor: %-pOdd number of elements in hash field initializationCannot invoke method %7p on a non-instanceCannot invoke method on a non-instanceCannot invoke a method of %10p on an instance of %10pCannot reopen existing class %10pCannot create class %2p as it already has a non-empty @ISARequired parameter '%-p' is missing for %10p constructorCannot use __CLASS__ outside of a method or field initializer expression => Warning: unable to close filehandle %2p properly. Cannot complete in-place edit of %s: %sFilehandle STD%s reopened as %2p only for inputFilehandle STDIN reopened as %2p only for outputInvalid \0 character in %s for %s: %s\0%sMore than one argument to '%c&' openMore than one argument to '>%c' openMore than one argument to '<%c' openpanic: sysopen with multiple args, num_svs=%ldWarning: unable to close filehandle %2p properly: %-pWarning: unable to close filehandle properly: %-pCan't rename %s to %s: %s, skipping fileCannot complete in-place edit of %s: failed to rename work file '%s' to '%s': %sFailed to close in-place work file %s: %sForked open '%s' not meaningful in <>Can't do inplace edit: %s is not a regular fileCan't do inplace edit on %s: Cannot make temp name: %sThe stat preceding -l _ wasn't an lstatUnrecognized signal name "%-p"Can't kill a non-numeric process IDBad arg length for %s, is %lu, should be %ldglob failed (can't start child: %s)Can't exec "%s": %sCurrent directory has changedsysopenpathnameUnknown open() mode '%.*s'Missing command in piped openCan't open bidirectional pipeinplace openXXXXXXXXw++>&Can't open %s: %sprintWide character in %sUse of -l on filehandle %2pUse of -l on filehandlelstat$&*(){}[]'";\|?<>~` -cchmodchownunlinkutimeArg too short for msgsndecho |tr -s ' ' '\n\n\n\n'|LS_COLORSHhHHHHHHHHHHHHHHHHHx(unknown)Illegal number of bits in vecUse of strings with code points over 0xFF as arguments to vec is forbiddenBit vector size > 32 non-portableNegative offset to vec in lvalue contextOut of memory during vec in lvalue contextUse of strings with code points over 0xFF as arguments to %s operator is not allowedCan't modify keys in list assignment (08@HCCharacter following "\c" must be printable ASCII terminates \%c early. Resolved as "\%c is not allowed; the permissible max is %sUse \x{...} for more than two hex charactersUse "%c" instead of "\c{"\x{%02x}Non-octalhex character %lo0xUse of code point %sMissing braces on \o{}Empty \o{}Non-octal characterMissing right brace on \o{}Empty \xNon-hex characterEmpty \x{}Missing right brace on \x{}"\c%c" is more clearly written s[%lu][%d%lu%4p$%-p ===> [SELF] %lu [%s 0x%lx] [0x0] | %-4lu ???? +--%cx%02lx%cx{%02lx}%cx%02lX%c%03o%c%o%s...%scv ref: %s(NULL)\0WILDSV_UNDEFSV_NOSV_YESSV_ZEROSV_PLACEHOLDERCV(%s)FREED[%s] [UTF8 "%s"](%g)dump.c(%ld) [tainted]{} { GV_NAME = %s-> %s%s = 0x%lx "%s" "%s" :: "->UNKNOWN(%d)UTF8 ,%ldNULL OP IN RUN (ex-%s) %s(0x%lx)PARENT*** WILD PARENT 0x%p TARG = %ld ,VOID,SCALAR,LIST,UNKNOWN,SLABBED,SAVEFREE,STATIC,FOLDED,MORESIBPRIVATE = (%s) PRIVATE = (0x%lx) GV = %-p (0x%lx) ARGS = %lu => 0x%lx NARGS = %ld CONSTS = (%-p) SV = %s PACKAGE = "%s" LABEL = "%s" HINTS = %08x FEATS = 0x%xSEQ = %u REDONEXTLASTOTHERREFCNT = %lu PV = "%-p" (0x%lx) INVMAP = 0x%lx TABLE = 0x%lx SIZE: 0x%lx %4lx: %2ld %02lxARGIX = %ld ARGS = %lu .. %lu SLURPY = '%c' MAX_FIELDIX = %lu FIELDS: (%lu) REGEX = 0x%lx PMf_PRE %c%.*s%c PMf_PRE (RUNTIME) ,ONCE:USED,TAINTED,SCANFIRST,ALL,START_ONLY,SKIPWHITE,WHITE,NULLPMFLAGS = (%s) TARGOFF/GV = 0x%lx PMf_REPL = CODE_LIST = CODE_LIST = 0x%lx SUB %s = SUB = (xsub 0x%lx %d) FORMAT %s = PL_YesPL_NoANONMAINUNIQUEUNDEFINEDSTANDARDPLUG-IN ] SV = 0 PADSTALE,PADTMP,ROK,WEAKREF,IsCOW,PCS_IMPORTED,SCREAM,IMPORT ),IsUV,SV = UNKNOWN(0x%lx) %s UV = %lu IV = %ld NV = %.*g RV = 0x%lx OFFSET = %lu PV = 0x%lx ( %s . ) CUR = %ld [BOOL %s] REGEXP = 0x%lx LEN = %ld COW_REFCNT = %d PV = 0 STASH USEFUL = %ld ARRAY = 0x%lx (offset=%ld) ALLOC = 0x%lx FILL = %ld MAX = %ld ,REAL,REIFY FLAGS = (%s) Elt No. %ld AUX_FLAGS = %lu (%d%s:%d hash quality = %.1f%% KEYS = %ld FILL = %lu RITER = %ld EITER = 0x%lx RAND = 0x%lx (LAST = 0x%lx) NAME = "%s" NAMECOUNT = %ld , "%s", (null) ENAME = %s ENAME = "%s" BACKREFS = 0x%lx MRO_WHICH = "%s" (0x%lx) CACHE_GEN = 0x%lx PKG_GEN = 0x%lx MRO_LINEAR_ALL = 0x%lx MRO_LINEAR_CURRENT = 0x%lx MRO_NEXTMETHOD = 0x%lx ISA = 0x%lx Elt %s [UTF8 "%s"] [CURRENT] HASH = 0x%lx REFCNT = 0x%lx AUTOLOAD = "%s" PROTOTYPE = "%s" COMP_STASH SLAB = 0x%lx START = 0x%lx ===> %ld ROOT = 0x%lx XSUB = 0x%lx XSUBANY = 0x%lx (CONST SV) XSUBANY = %ld GVGV::GV DEPTH = %ld FLAGS = 0x%lx OUTSIDE_SEQ = %lu PADLIST = 0x%lx HSCXT = 0x%p OUTSIDE = 0x%lx (%s) TYPE = %c TARGOFF = %ld TARGLEN = %ld TARG = 0x%lx FLAGS = %ld NAMELEN = %ld GvSTASH GP = 0x%lx SV = 0x%lx REFCNT = %ld IO = 0x%lx FORM = 0x%lx AV = 0x%lx HV = 0x%lx CV = 0x%lx CVGEN = 0x%lx GPFLAGS = 0x%lx (%s) LINE = %u FILE = "%s" EGV IFP = 0x%lx OFP = 0x%lx DIRP = 0x%lx LINES = %ld PAGE = %ld PAGE_LEN = %ld LINES_LEFT = %ld TOP_NAME = "%s" TOP_GV TOP_GV = 0x%lx FMT_NAME = "%s" FMT_GV FMT_GV = 0x%lx BOTTOM_NAME = "%s" BOTTOM_GV BOTTOM_GV = 0x%lx TYPE = '%c' TYPE = '\%o' COMPFLAGS = 0x%lx (%s) EXTFLAGS = 0x%lx (%s) ENGINE = 0x%lx (%s) INTFLAGS = 0x%lx (%s) INTFLAGS = 0x%lx(Plug in) NPARENS = %lu LOGICAL_NPARENS = %lu LOGICAL_TO_PARNO = 0x%lx { } %-p PARNO_TO_LOGICAL = 0x%lx LASTPAREN = %lu LASTCLOSEPAREN = %lu MINLEN = %ld MINLENRET = %ld GOFS = %lu PRE_PREFIX = %lu SUBLEN = %ld SUBOFFSET = %ld SUBCOFFSET = %ld SUBBEG = 0x%lx %s SUBBEG = 0x0 PAREN_NAMES = 0x%lx A_ifIff.AWAVAUAATIUHSHHHdH%(HD$8B  Ht$0"LKHL$0IAD$ %@@=@@1II)L9wqHgHHlLLHNIfD1DHqH[HHH>H%HHAUATUHSHHIHufH9}1F"tFH^(Ht=DfC u H{HDDLHHHuC!@t H[HuH[]A\A]@H9uV HffufDHH[]A\A]fAVAUATIUHH-QHEHtHP tJvK t&aHLHqHH]A\A]A^@H@H@HtHHh(HuDHHHtLiMtAEu uLDqL{IHt9H-RHHtEHMLL]AA\A]1A^ CHEH7P *K1H=HH롐HePAUIATIUHHtx tgGH诺Ņy$ TH5HQHxLL?Hx̺H5Ȟ'H@H@HtHHx(Hu{ATUSH蠺HD HŸHEHFHt De[]A\HK:uH=ff.AWAVAUATUSHH(dH%(HD$G D@@@@t. t 0H5H'C 4%=Ht$BH>IHD$Ht\C <%BE1E1C HQ1HHHT$IHHH@ dH@(HD$dH+%(H([]A\A]A^A_fHHRHzBtžBH}HuC Ѓ % =t$Ht$BH躑IHD$DHLcH@HD$H9HFH)IAMLD$AHHHIHLHHIHLILIHAHHLI(LI8LIHHA HHLIXLIhLIxHA0HHLLLHA@HHLLLHAPHHLLHA`HHHApHHHHHHHHHHHHHHHHHHHHHHHHIN(HD$LD$IFI|I9IpHHD8*u AA)DHH9ufDH۬C =wHCHIH5vMtIT$Hx HIT$C 4.ff.AUATIUSHHtRHHt2HLD(HHtAD+H[]A\A]fHH[]A\A]鮾fD#H1[]A\A]HF:uH=|IfHt7ATUHHxL`LL觶A$LAA)ܚ H HIHHM>HH@HKHD`,@ LH@(H Nb HL+9HIHBIH0HLzHVL= MHH>HHI0H5VGHHHL$HM&HH5FH;LH)HHIL)HMl$IHM&gHH =NLGHpHIHH8IH+HHGHBHH HIH IH IHIH3HITf.1Ҿ oHM>HPHBLLI4?H MHkƵfDUHt"QH1HHH蔌HFH8HGH8tH81vH1*H@@PXHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$QPXHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$豔PXH=1HH5HaHHt*HHp"HtHt(HH5IH=T1H@:u̾H=tHQ>8u$ATSHH?L#Mt&HL[A\1H= Dη0IܮL#I$H@ID$LID$H[A\fATIUHS]HH蒞HLHjHHE1E1ŖZHCY[]A\f.HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$HT$dH+%(uH薯fDAUATUHSHdH%(HD$G tI@u#HHI萶I$H@HtIT$| HCLMt3Hu@1HA@!@tIp1LHIDH$H->HUHtB H;8aH5?LHD$dH+%(HL[]A\A]fDI@u3HHIУfDHP0Ht HHP H H5xL1Ӓ=fDHBHJHHH=y 3HHX H#HBH8G tDt H7H~t5% ="HHUHJHIH 8 HY tiL-H@:H9tIHHx HILH5L1H5L跒H9HP0H<$uL-HH@H$HGgff.AUIATIULHHLHjHLE1E1XHZ]A\A]HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$HT$dH+%(uHfDU14H1HHoHPXHAU1HH4t]fDH]ff.@UVHHt]H]HHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0CHD$dH+%(uHvfDHHH]HHDHHtt H1H|$H|$胃HCAH CHHH9H>HHH@@H;&9H„H;&BHHAD HH9vAQAF ADAD H9DAteD H9vEQAIcD D҃Ar.Dt2D H9v&AIAIcȃs H8t 韡HHDf.AQAF ArMDHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0HHD$dH+%(uHff.HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0蘏HD$dH+%(uH;ff.H;HHt Hx@tH=fATIUHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1觶u#HD$dH+%(uHH]A\H$HLHD$HD$ $D$0HD$]&fDH:HHt Hx@tf.ATIUHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1ןu#HD$dH+%(uHH]A\H$HLHD$HD$ $D$0HD$MfDUHSHHH9HC1HHHH*IHvHL[]1H)LÃr>HKHHDHH)؃r1҉փH<19rutt1fTfDDjff.Ht Dcff.ff.7USHHHdH%(H$81H|$H4$ H4%u HuH$H$UHHE$H$8dH+%(u HH[]@H1dH%(H$1HHHE$H$dH+%(uHĨfATIUSHHdH%(H$1H|$H4$H3%u HuLH$UH$dH+%(u HĠ[]A\Q1%DAVAUIATUSH dH%(HD$1踟1HcH0IH8HH8E1HŻ w wHEDuQEtLϟLHl$I蟔E4$A1HܝxpAtwD$t%A$D訛L`1HT$dH+%(H []A\A]A^@HH@ A<@A<$tAuE4$H5uA$JH/D$ D$ DٞD0I謠ff.ATHAąx HDA\蛞8uH5uHDA\fH/HD$HD$ff.AWAVAUATI1U1SH8t$HT$dH%(HD$(1)HJ-A<$wA@ŀ8EH|$>H|$ H2A'˝8 B H1Sy脐ADžxE~Bt|9-|HctH".H8H{ PHIcHP H'5D8EE1Ll$fDDHڋ|$ H)L{HAAvً|$ |||A ؜Hl$H fD;u1HDtD$1HT$(dH+%(H8[]A\A]A^A_|{B|{Ex|$ {|$${1f|r{Jctt@|$ W{Eu\|Lyk|$$7{tfHfD蓪H5@H=I谈覝|zDH=k1LEyw1B|A<$r@9tXvB|z1|A<$r9tzHL$HcD$E1AHTHqL$$A5[k&|뾋|$ Wz{fAWAVAUATIUHSH8dH%(HD$(1?-jH*]8AH|$E1H|$ wAAD$ EAAD|$Hެ.@{8 I H1vƏ1ADžxt$51B|}r@9,uB|By1B|}r9t+yL$ H116fDB|xB|xDD$E|$ q1HT$(dH+%(VH8[]A\A]A^A_DA|$E1}wH|$AAEbxD$ D$fT$/BtB|9;xJctH)H8蒔H{ <HIcHP H0D8D$E1Ld$DHڋ|$ H)L HAAvً|$ wB|wAgHl$H D;u1HDtD$fDB|QwJctBt B||$ *w|$$w|$ wEufB|Hu|$ v|$$vH輍;H5H=XB|vDH=1T$t$$LXZnA?QH=H1AWAVAUATUSHHIHIHt~HtfH9HN11H~@HH9uHHH9uMIL9!ILLHL˨HLI9}I9,H[]A\A]A^A_@6HH[]A\A]A^A_osLHLH)H[]A\A]A^A_oH50H= 1ʣf.AWAVAUATUSHH $HL$0H@t$6dH%(H$1D$LƄ$@tk/IHtiH衅L`LuLHHǧIH$dH+%(tHL[]A\A]A^A_E1HufDH)/H=ؤsIHnHLHLpMILIL9nHD$LD$7L$HD$H$HD$HD$PHD$(HD$ Ld$8@D|$LƄ/AL$7T$6H$$.ADʈL$7L)H9HHBHT$yHT$Ht$ LAD$h%Ex=@t=H|$(I9LL$Ht$LHA:LMT$LHIH9DzT$I诃McI<HwHcT$E1K|%+L)BHT$ ,kTHT$ @k8H|$(L苡}fDLHPHHT$HT$s]tAMHD$(fD|$7Ld$8uH|$(tMD$0H|$(fIMHxHHIt HtHLH)H)HHt$PHBxED$h%=@t5D$0uSHD$(臑I4AM҉ALL9HD$(OALfLH }LH5jHH=1~H|$(H QLH5itH Hl$(H5!I@ff.H,@HM*@H*@Hu @H,@ATSHHH +tE`IHt,HLHL`Mt L߀HHL[A\ÐIfD1{DUHSH觢tKHtE t;>HH_!HEHH5[1]MDH[]Ð wHEHWH@8HHDŀ>HL@ H!HEMtA@tHHH51[L¿]ކff.AWAVAUATUSHHH #Hh fHgDw E1EA Av* 萡H[]A\A]A^A_fHWHtLbMtI$ uHT$BHT$tALߞAA1ۍfL5׊H'HL,fL f H HH-ϽHxSLH5gLUD1莅Y^M I$Hx0@HIIL[L]DA\H5)A]1A^A_<@ >E1LѝA fEL5L-ffL-b"MtI$sL HHH-HX0fAAtL4A ffDAwHSLA HB8HHD1HHx DOE)LD$蕓LD$HHt;HHxt1SH-UL1L LH5DڃXZPH1H-HX0Sff.USHHdH%(HD$1HHH@Ht!ooHKoP S H@0HC0HD$dH+%(uH[].ff.wGHDG nl~impIHcHiQDAIH'I%)E)DE1iHcHigfffH!)1ƒ@ t %UHufDD%8H+HD$dH+%(H(D[]fUHAufDUHAdfUHAI|@UHA,_UHA ?UHA@UHAUHAUHAUHA lH^HT$Ht$HHHD$~vLD$LH Hl$HNE< vFH  ЋDD'H=1{fDA_DHHH & ‹%D=DH=61{oH=q1{HH=81{U1H= ~H0dH%(HD$(1It4Ht$ ljTHtD$ LD$ Hl$1HQiD$CBHT$RЉD$ XAHHH)HHHH1HHHH H1HHHHHHi[ D$ H1ieAi HT$(dH+%(uH0]nAUATUSH=}HH'kHHH\HHH@H8088fzH|H5H1L-|KHHk @D#H+zLHD1JH9uHL%btL%:|H%|LEyLHH5S|1JyHH5O[H]1A\A]Jx-181H[]A\A]jAVIAUATIUSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H-{H$$HD$HD$ D$0HD$E8H-dHEHt @8iHLIMHHVAEx;Hu.HD$dH+%(rHD[]A\A]A^IcH9rH=1wf.Qet=HV8eH8UH-zHBL-Z[E8dduH--zH|BL-HLIMHUHAAD1tdHEHv@8l1IdX15d?jAWAVAUATIUSHxdH%(HD$hG DHHz ;Hl$ H,1@HSLcI}.qLHB(H{z HIhH57~1CLLx8,HD$hdH+%(`HxL[]A\A]A^A_fD0I$Lj% =Ht$L@HMuLZpHHB(LHyIefHHz % =LHt$"M@H|$HHH|$oHT$HH7yIž LgLLv8HL 1H5}gBfI$LjIB(f/H@hgIAD$ L-PAEMteI$L@(HvH$HƸrfIM~HhhDHzIl$fB(f/~{L-AEI$L|$ @E1L@(HvH$H¸0QHcAE~AEH5fvLKHHT<<.t.I/H9s"fMIHmCD/<0tI}<.uLI#nLLB(Hpw HIeM0AvuAvfDLl$Il$cf*DVLsjHLhHh(MuLmHHB(LHvIž L*e`L1AjfDAH0H 1r8CHE1ɀxAEI$LL$@(MH4$L,dIM~LL$HhAE~AEM\LοL $rH<$ r=@AD$ fDH5MtH!fE1Ʌ]H5HLL$fE1Ʌ>HOSLxL#lLHHuuH5 HD$oqLL$H$L|$ @LjNLL$HcL1@ITHqI/H9yH.HHyL)HHL$H)`HL$L[sdH=Tw1%pDAWI1AVAUATUSHDcLIhuUAG 'M9tLLYL:JL1i@IHL[]A\A]A^A_L5t1ɺLLwjtHH(H`HEH uHH#HL-HEH HEIEXHHLLIUXHEHHEH@HEH@HEH@HEH@ E HE% @E V HHHD$3WK AG tML-uE1E1LLOdHt'cH|$E1LI$#dL-3uE1E1LLdHt'bcH|$E1LI$cL-E1E1L LcHtEH8G % =x^kHcbH|$E1LI$icL-E1E1L LGcHt*H8EGH|$E1LI$cE1E1 LL1bHLh&fjHHcHGbHH|jLHL?LcfH-I9@߃AmDHL$HQHT$DHWTL=gHgL1LA1H5HHt@ Hgt ItHiLL1DA1HZ5HsiHI8cXILLLH=m19DHL$HH58gL1HI#tHHADŽDŽAL$ $~uAFAVAFH ~lLDQH=TL@DH1f`t&THDDŽ@pTLt$(L@L)HLiQIFMt1LL[HHHWH_HH@HH@H1@tHHx Ht x<tH?)H5RHH%HHHyB oHHB8VMIT$HaHLEL-%L#H1{,|$&ID$HHPB#t&`<$1<@ƒ H&A7Hy@ HL$Hc?HL$HA@H HcA8ACAPL1WJHP8 21WH|R8 WH=Wց G:E1ҾGH=AHMHH9B /HA HB8`&HH HEH5f=tfHH5^HЄHEH=xL1&HH+DHH=AHff1 @8HHHHtSB tMHiH A8u8H`LDuHEHfu fǀHhA< 1WuHR8 먀,t )@RPA}/A}=A/TLILl$(DŽHDŽ@aT@RfDDpEtAH=!H=HTLILl$(DŽ%HDŽ@aT@RWuH A:cAuH E @@jHa@`HL$0HHtBA t]WuHDDh8AA -H52xH=X39u 1 PH5xH=-19fDATuJ1I= t}u LA\DH=&p1*-HLA\H5wH=18uiPH5wH=1c8H9 ATIUHSHDHHaЃu{EHI9EyHHw{LH)HUу? @H%@=@t[1]A\E%@=@uHI9u[]A\fLH5<D1DHHwPHH)H~$Wуu? fD1LH0Wf%Aff.H@SHdH%(HD$1HtZW HuHT$dH+%(uXH[Ð% =t2H"S H4$Hǁ H]1@HHHpH4$J*f.AVAUATAUS11H7DH7IHݸL MYI$HH{HL58I$H ID$IF`HHIV`I$HI$H@I$H@I$H@AT$ %_AD$  ILE1AD$ I$$H5H@ID$*ILE1ɹ$H51*MLE1ɹ$H5"*[L]A\A]A^fL;AD$ ]fD Iff.AWAVIAUATIUHSHHvOHIH$Hƺ̃HH"IMtI|H*HcH>HtHA,$ID$H[]A\A]A^A_@HAH?HÃʀAT$H?ȀAD$HH?ȀAD$HvAH0HjH%H=u HMH(H=H?H݃ȀAD$DH?ȀAD$ A$HK,[]A\A]A^A_HA'fHA(fHA6fAHtHA HA tBMLH=tHH1I2Hlj4IIAǀu~KT,ID$H9dIt$H@HH?ɀJH9u<At/MTH=JH1 3HIA 1fL@At9HL$MH=H1u@2HcHL$IHuEH1nfAt/MH=H14HIA1f.A^1H1R H=gH10HH5H21#TH5H31#H5H21d#HL$H5H41D#4ff.@12DAWIAVAUMATMUHHLSHHHL$3IcTFII(H=VIHEH0MHL$HH9t"s?tU0MHL[]A\A]A^A_øfHUH{HHHHTHTH) H)މHMHH8Ht'G f%f=H%HHD$`HT$`1L2H5*!@I $LI0HIL$H+I9IDHH8Ht'G f%f=Hp%HHD$`HT$`1L4H5)!a1L1H=&eH1-H11L/MHHD$H)H8cUTTNHcHT$XD$HT$PL,AMcEuM9uHutH11Lg/HMtE1@I11CtF/HM9uqOHD$`TfT,HD$`IMgf.HH=H)<IIH9HLN@~wL@u^Av2I~, t A+H@A@t .AL@<wE1LDLI@uE1€tfDAw"u ItH#A LLAAH-HAA<UyKAE1H-HAI-DywnHdyADAH-H MIAAD$eM,D$72D$\H<$D$H|$`IHt$H|$P1L\$` H5}H=H1L\$`IHD$`H<$UAA H[H8H0 G f%f=7 Hƭ%H LH5*@D1 E E1Ak /A:A8DH=N1"A H5גDHcH>D$muu4[ugENH<$IH ЃH,;HH)H9HHt1HHH?HѨuIHpHVHHL!IH8HH9sHUHp H)LEHI9HHBHH9vf.8HHH9uMt#HuIEHH[]A\A]1@H|HH9r^@HHH9t*yփ?HH@ʀQ@qH9uHH)I$MtIEH[]A\A]1fAWHAVAUATUSHHIIIH9AEHI׉11HI9srA4/C'IWHcH-H=wH9v91*B"HcHHw I0$H=Kq1rfL)IHH[]A\A]A^A_HEHqH5zHEH=10AE1ff.E1A~ff.AWIIAVAUATUSHH8dH%(HD$(1H9EAIAf.-L^A HA4D!HeHOH9wHH9D LHLG ?A1H HwHH)HD$ HHHT$O,I4,M\$H=H%MH HM[AHt$HC,A,MH9LL)IHD$(dH+%(H8L[]A\A]A^A_fD¾M\$fHt$LT$HL$E1HHT$ HAjH|$HD$0ZYLT$H<$HI1W)fHH@H<HHЉ1HIHff.HHHH8HHЉ1HIHff.HH HH8HHЉ1HIHff.LŇ@ELEy4It;L?HȀFHLf.DHLÐ@tZ@t<@tPDϺ1DH=AfDAxxSASNif.HvCHHmHHPHڅL o1PH^PHLH(@SfDHvCHHlHHPHڝL s1PH`PH~LH(@sffDHHv@HHflH1PHL qPHbPHL)H(@HqHc8HtxHƒ?ʀVH@tVt@tcH @D8LEy#L?HȀFHLDLHfAfDussAsfH@HAſſSHH6dH%(HD$1@yxLӄ@IҺA H!A@Hv@HOI9w|@HI9toD LHLG ?AH HwHuBHKHHOI9w rfHI9tgD LHLG ?AH HwHu:H;~H8HHЉ1HIHT$dH+%(u-HHHLE1jA1Ht$XZffDHI7dH%(HD$1@ysLƂ@ƺA H!A@Hv>HOI9w rfHI9tgD LHLG ?AH HwHu:HH8HHЉ1HIHT$dH+%(u-HHHLE1jA1Ht$XZffDAUIHATUHSHHL%I<$FHt8xVI4$HI0HHN+AUHEH[]A\A]AE1HEH[]A\A]H\HcHЋHAMHEHkDAWIAVAUIATIUHSDHdH%(HD$1EtzHH8IH:Du8H2ExFHD$dH+%(HALL[S]A\A]A^A_D7EyLH)HAH-HEƒA?A Ƅr:EHJcDExHJcHw1A$IEHT$dH+%(H[]A\A]A^A_fA$ƒ?ʀAT$IE1EfLAƾA HD!A@HvHHML9rHI91LHHA40?HHH HwHHLLHH'eL gPH}PHVPH3LH HT$dH+%(HLLH[H]A\A]A^A_@fDAitULH)Hf}ıtY1EfHHHE1jA1L!H|$XZİIE0fA $$IEIA$I mff.fAWIAVAUIATIUHSDHdH%(HD$1EtzHÁH8IH|Du8HE~2ExFHD$dH+%(HALL[s]A\A]A^A_WD7EyLH)HAH-HEƒA?A ƄrEHJcDExHJcHw1A$IEHT$dH+%(H[]A\A]A^A_fA$ƒ?ʀAT$IE1EfLY|AƾA HD!A@HvHHML9rHI91LHHA40?HHH HwHHLLHHaL }PH PHUPHsLH HT$dH+%(HLLH[H]A\A]A^A_D@fDAitULH)Hf}ıtY1EfHHHE1jA1LH|$XZİIE0fA $$IEIA$I -ff.fAWAVIAUIATIUHSDHdH%(HD$1EH~H8UHyD}8H{ExjH{B8Mt'AUƒ?ʀAUIHT$dH+%(H[]A\A]A^A_fDD?EyLH)HAH-HEƒA?A DŽEHJcDExHJcH5AEIDDAIqLH)Hn1ELyAǾA HD!A@HvPHMI9wfHI91LHHA40?HHH HwHHLLHH^L üPHPHTPH }LsH FHT$dH+%(HLLH[H]A\A]A^A_@fDEHHHE1jA1LH|$XZ7L}M9LL)H~ fA?̇#A7@ywLw@ƉA H!A@HvEIOI9w@HI99LHHA<8?H HwHuxH)rH8Hxt+D}AIAıI1fEEAH{IM9 f}İtV1ElHH1LjLE1AaHt$Y_]AEiiI^IiAEiC@AWAVEAUIATIUHSDH(dH%(HD$1A}HzH8|HEuD}8Hv87DE1ExBHD$dH+%(5AH(LL[]A\A]A^A_{D?EyII)I~AH-HLXuAǿA HD!A@HvCHMH9rHH9D LHLG ?AH HwHL$HH[L SPHPHCQPHmLLLH躺H L$E1I~f}f}kHT$dH+%(H(LLH[H]A\A]A^A_EAHHcHw1A$IEHT$dH+%(yH([]A\A]A^A_fA$ƒ?ʀAT$IEDEGD? E HHcgfDDD$ H4$DD$ H4$h@JIuLI9:H=xLHH9xDMADMELJtIHUD!HcH9f HH?H H9uH=H=H=A^AEtUA$AbBTfCTQfDHHXL PHvjjAAuIEA$ſſfD}H5:1IEfA$AD$}?H5:1ӵ~fDAIII)IDE1E L$HT$H1jHE1AH|$ ZYL$LHUI|$HHI$JTKTI)L)EADHHD$dH+%(up@68ıIE1fA4$f}İt2DE1E UA$BTCTsIEiA$iWff.AWAVIAUIATAH8dH%(HD$(1t0H+tH8Hbo8t&Hp8uAAHAtOL|$H11LHt$(LLELԷHT$(dH+%(H8A\A]A^A_Au:HHUL PHsjjLLL1|H fDHHUL PHPHKPHh@L$ H<$L$ H<$fDHD$(dH+%(uH8DLLA\A]A^A_>ff.AWL7AVAUATUSHHdH%(HD$81L9hHD$0L]sHIHD$AfLI9y DG$+MM9 vMI)IpwM9|@@@H-HCH HwH<14LT$H5DLT$E1LpE48C(HT^D"HHH&B &I$A B8~&L`LDLH1AHA]PHHTHfDPr@R1.nH5LGRH^AHH@@RHHfDhr?(Hx^HH0H`|HLH?^HYH0H`|HLH^A.HH@.@R HHfD`r?(jH]AHH@@R HHfDhr?('HL 1Ҿ71HHh=IH>]H@RLHL H]HH@@RHHfPr?(iH\Hu V8B\BRHH;L 1L%VII$@8HJ\HHHN@ DHI9"E$1LLLq |H[AwHH@w@RHHfDxr?(I?(y1I8(HfH[HuVvƀV@RH`H1IH@[HL0H%[1ɺ7L#qI$HT@@REzHZHu V YB[lBRH=E1111HS(HZHHJxBEH Hy 'uHA H TH1v$BRH9GΉ!7E1111H'HZH THH Bq$9t ǂ`q$BRH9GΉ6PHL) 4HYAHH@@RHHfDpr?( HSIHFYH HI$L@R9Gщ5HYHu VB\BRHjHXHu V IBYnBRH-HL HL1H5'CҼHKXH@RH,H,XHH@@RHHfPr?(H51K_H=KәHWHHf@RH8HLHWHH@@RHHfHr?(xHDWArHH@r@RHHfD@r?(5HWAHH@@RHHfD`r?(eHVAHH@@RHHfDhr?("HELH_VA`HH@R@HHfDPr?(P1Hǀ8{HVH0HA`@R@`HHfDXr?(r1{8(]HUHu V ,BZlBRHHyUAHH@@RHHfDHr?(jH6UH@w@RHHHUH@|@RHHHTH@v@RHH[HTH@u@RHH5HTH@t@RHHHxTH@@RHHHNHKTHHR$@RHP!H#TH@RH HTHHH@@RHfxr}(iHS1ɺ7L#I$HT@@RE10H<{HkS<'tZHLD$@Hƀ`&HaIHD$@Ht%L3IaH1҉^H1A3‰P@RH/yH:HHLH8DOHRAHH@@RHHfDxr?(HuRHH@+@RH+HfPr?(h1H5{F訶H!RH@RH-HRH@RH)zHHeA jL*H-j H=+PH@j PHBj P1H@HL HsQAHH@@RHHfDpr?(dHLHQoHH@o@RHHfpr?(z1HP8{HlHHBBR4H L HPHu V B\mBRHHDPA@HH@@@RHHfDHr?(5HPAHH@@RHHfDPr?(eH5K121H71HDH/IHOH@RLHcO1HH@1@RHHfHr?(VH"OHHH@@RHfxr}(H0LP[HN'HH@'@RHHfXr?(*HNA)HH@)@RHHfD`r?(tH3L H=H NA/HH@/@RHHfDXr}(lHMH@RH+=HMAHH@@RHHfD@r?( HcMH@@RHHHLHLH LuHmLYdH5O1AHM*5HLHu VBR^HH5sN1ܰHMH9LAPHH@P@RHHfD`r?(*H LfqHKAxHH@x@RHHfDhr?(>1H5K HKH@@RHYH~AHH@\  1rH;KHHBHEHI$BRH9G>HYLjuHVLNYHWL2=H9L!H5K1HrHLHDIH5JH HI$L@R9Gщ&HIHu V uBVnBRHYHIAHH@@RHHfD@r?(&HIAsHH@s@RHHfDPr?(pHHiDHHR$@RHP'HLH%DHHH@@RHfxr}(HCH@o@RHHTHnL-8HmLHCAyHH@y@RHHfDXr?(vHBCxHH@x@RHHfXr?(5HCH@z@RHHrHBH@l@RHHLHkL%0HBAjHH@j@RHHfD`r?(HJLH:BH@G@RHHHBAHHH@H@RHHfDhr?(xHAAHH@@RHHfDPr?(5HAH@i@RHHHhAAgHH@g@RHHfD@r?(YHhLH AH@@RHHzH@H@f@RHHTH@H@A@RHH.AEA%@=@H?HLD$(1ɺLLL$H`ŁLL$HIIA%D=DuAFIIA%D=DtE7A H= ZH!'A=F A:, L)1LJAHHH B  I$B8| AAUHH5 MU!1OY^H01HP"DDH D$u?vEu #HD$@HHHD$@1HA4DDtvHtq,uAuH5 $1LL$HL$覘DD$HL$LL$HD$@HHHD$@ADDtHuAAHH@xP tI$P8HHDD$H)HL$0H1HُLH Hl$DD$I-H =H@h@RHILWuH82B:4H`H;%@=@6}<y1Ҿ(H= 襥a1H=/IHǀAM@~&DLH5Atu߹H5,LVHLHߜLH5&HHHtwwI$LDr$D+t$0|$@ʼnz$H荕HHHDr(HH@j ~AEC]1H5 1z;H&BRH1eH.;HLL$LD$HL$r`$DHP$AVATLL$8LD$0HL$(Ht$HH fHb@R@bHHfXr?(?H,HPmyhL 4AFA%D=DI~1LL$苭ILL$I$@8u^HHHt9@ t3HL91L*@錽Wu H*@:uAA%@=@uHH`LLD$@qw1H׬I5AyCHH:HL)HZANσ@F? ADH8nTHDŽ&HDŽ@pTI~H5Lb@wH=1åL苔?HbI~1LL$׫I@C&ItH5wLhL 2AFA%D=DtWIA~:A~>AVHk2%D=Dt9I须I~1LL$!@LL$IqI~1I^Hxxwv+wHH=H@x1荤H=F聤 HHxxwv+wHH=H@x1LH=@ˏL/bA H5vL1}IIM)I BH`H`111 aWt"1ҨzHv'"1WbH^'DH8AAP8Aff.AW1ɺAVAUATUSHHH-1dH%(H$81LD$ HuHH`sL|$ LuII`LH<$KA$H<$u :+II9L 0MIAUI9sA%D=Dt߀=IMLt$(LLH$Hb/HUAL2H$LL$ HH['HH;)BRH`u<D1D27LLqlDA|$:IMI9@E1E1 L9A}:A}:HIH@ H3)HA @8H`LD`1LeH HUH ID$I$L9GD@LD$1LHLL $Ll$0D$0&{L $L1Iq谛IHH"HH@JL`M1AD$tI$Hx Ht D@HH[]A\A]A^A_`x>HUHt$ HHXHHxLlWH@8%ҁ€ LajE1E1j1jj(HULL$ A:2AA4H=1舚E1ML$1HLD$(LHD$(+kIƀ:H]Ll$( $L`DLi4… $'HH@ H"H@8LLH=j1˙x:H]Ll$(L`DL3…t3u1ɃmuHE1E1LjLjjjjŭH01 LLhHAE1IAL\$AICPPHxEE1HU?HET$E1E1 H`H !H8H$艎E1IHDE1E1Ѓ ICHHxI@uHY!E1W/H"D@8AA H'!HJ8vBPHEE1E11ɾLH`1jjjjH yMW@H$HULE1LLL$H0H`L$7wL$LL$H`H=1T1WfH&1@:@PH`H=1UDAWL=KAVAUIATUH-SHH(D7dH%(HD$1HH DH9A~rHAHcH>@ *HAHL u[L%$I$LEuyH$HVf.LfHT$dH+%( H([]A\A]A^A_DEL%h$I $HHfypHIuL9HnHǁHǁ8u yS1H@1KL "AAA%D=DyA9wH{HDHAHG?L%#LI$H`L9wU^tTA%D=DtAH0H v4ЃHAHv"I$HHH9v H_H9rI$L)HT$H`HH~-EuDL%"I$HHB H HB8HL9})AE)L 5!ADLtWfDL%9"I$HrLo1H=T]HHHI$HI$BRH9G:>fDIEudf.L%!I$ A#HDI9r-DII9sAE< uI9IA#u I9!#LhdI$P4t ;P8!Euf.1 vfDHD$dH+%( H(L[]A\A]A^A_vH Hu VIBRL L% AEI$JR<+I]<=u uVfB?PBRHA}=IaLH" HBR< AE<*<=B8IEBRHA}=tO/L%I$CRx< pHH9!L5 L8VIII$I$@RL9GщHD$dH+%(BH([]A\A]A^A_L%1I4$~R Ɔ`@1ɺLHa薨H=[HHύI$a@ tP8tH1mHI$xR)HH9T@RDŽ@HDŽ@pTHH I$H9GщL%5AMI$>#IML9tA} uHH)H~A}>>>>A}=uu V#BGqBRHA}=IaLL%AEI$J4t ;J8JRIM<.<=uu VBCPBRHA}=~L%I$u VG1I}蓔I$8{H GH1v$HBR9GΉEuA=MUIUA>#A~#E L 0AEA%D=DL%HI$BR<'AAHAH$HHI9t A} $H@8tH  HMfDEuL9\IA uI$LLL$H $H^I$H $LL$LLL)H~A}=cutuAEA%@=@tHʾ LL)z_H $HtHHLHH $>^L,$EuA} ƀI$)H5mH9ELA`]WuH.@:HB%@=@CIH'&H5DLD$h$1L $GTII,$LD$L $@$I$H5H}DLAYH)\H5[I$H UL@E1WHBDP8AA 1LgcHHu VARHHH@@RHtpH # @@|Fu V IBRnBNLpHH'CL?HLC+I$LMHBA}t)IA>\uI$LHBI$H5HBL?MAEyqAH-HHL)H~AUЃ<lD? HD6I,$pYHHDSLn>gWuH@:8UHR%@=@uEyAHHHH)HUу? H~nhI$HUTI$Hx4JI$LX8USP4PUHD$dH+%(LLD$L $ULD$L $H13R~AE2IaHHD$HEHEHxt I$HH}LPI$LHI$H HhI$@RL9GщHD$dH+%(HD$8H([]A\A]A^A_+H11~#MEqRDAWAVAUATUSHHHwdH%(HD$81H LqTTNL H5HcH>@HHH  AQfyp!HHHxHx H9LIHx 'u HyX D9H IHAXHt D:-A>\DL9THqHHARDŽ@:TAtPQtqLHH8 @ . HSH@8 LHT$0LHL$LL)/2 HHL$@8 Ɓq4@LHI9i AVE A~\IvH)H~fA~L\cfA~U\wFLiHw/HHr"H5LHL$,;HL$HHcA< PQH IIcMTDŽ@:HЃTy4N$fH@H@HAhH9Gx =Hx 0H9HAhƁ HHfHHiRHAċB8(wH Hr@LLLL)MH5HA} }A} rI$H@ID$@ @I$L+HhITDArV<DHiIH A$A$A`tA$ADž`1HT$_HT$L+H i$MI $Hy'E@AFH=4IVHƋ%H=Hu fDBHHƋ%H=Ht@ t@ IH9H LL$L)/-L$H1H=H_1B?H E1fDHǁH@8WLǾ3H1L#H:H ID$LA<R1H5 'H HH;t HHƁLHHBHPHx{t HHTARDŽ@/HЃT@U@uoDŽ@@rAWH@:#1fBp~Ht DYHAH8H$M7HH>7HH`/7Hǀ`HAT@{7AERADŽADŽ@/A~EIƁLI$Hx%AUAI$HxAERHpTHHQD@AtSAt HcA8dpHQ@q8D At HAt HEApH+EL`LD$5:LHIq%If]f=TMtwHH @  HvA H@8 `&H%LH5KH=HE11/HHv4DHHIHHH[B QHH2 F88H`L}HMj H+V|$@u HH@ H H@8MID$HaLELVH+1Hk2|$&HEH$8H;L$ HD$HLIuDL$8L)HL$ .HD$tHL$ DL$8D`HMc䃀`HD$0IHxHiHD$0Hx MHD$0M)L)HxHHP x$HcD$\H|$PH@HH< HT$HLLDL$ L)H@HD$@H|$0DL$ HL)pHH;T$`|$sHD$XH@ Hct$tL1*LIHH.HH@JH@H1@tHHx Ht @ tLcL|$`HL$MA|$Hl$hMHcDL$`HL$8Ht$ HHt$ LHHD$HQHL$8DL$`B HH`HD$HHcT$tH)HH9MVI1WH@8% cL|$`Hl$hHE1E1=H|$@HHRHWH0MM)Hx 1H¿,)1H=41H.4OL|$Hl$8yIaACAHHTHL)HAWу? YBff=`HD$@H9BPHDL$8HT$ [%HT$ DL$8fJ@HBPHl$0IHl$ L|$@L|$Lt$HhHt$HDL$ H)MPH|$0DL$ HG HL1 9LpIMtXL1'1H5FLHL|$`HL$MAHl$hLE1QL|$Hl$ H12H1LLT$(5LT$("H8E11ɺt1LQDL$5HDL$8L5L55LQHHwvFwHH|$8HH|$@HH|$HH,1LB;?5H=^1IH=+1IH|$7Jt$H=1uIBLcAHAAMcLHH=e1FIIHL)H=1&IH=|1IS=AWIAVAUATUSH8H-dH%(HD$(1LeL-D$ IMQ8pI$1LH@HD$NH}IHHpH@HD$=HEIUƀpB8_HH5B +HL9{E1LFAA<'"<:AāA āAHEL=H5@RI?G2OA<(u t$ 1<:<{<(E<;GWHETDŽ&HDŽ@pT.T$ L2WuHB:AHC@@@RIaLD$ LLHD$OL}Lt$ :LAƇ`&LBHu L=BLLI?0HEH@ t IH H|$1AoLIyD$ cWDqPAADt$ ADIMQ8HEA~:E=HI?H8`H5a0HEL$ L3HT$(dH+%(H8[]A\A]A^A_DD$ L-!h@HM1HQxDTHL$&HL$JHETH@xDŽ@:HʃTAyCHHHL)H_ANσ@K? H D}8fD4fD1fD<}I7H=ƞ1DAP@AoHLL)jHHT$ LIHEH;ƀ`&%.HEH@ t HH H|$1ILeIMt\A$TL1j$ILeA$TIH# A$TADŽ@7HЃA$TAD$RM$fDEH=X1BLE1111/)IHHMIEP$9t ǁ`/HL$FHL$I?Hqx1@L1HIA~:;hH5,f.LeL5L61IvI`=Ht%Lt$ =fDLp0HL=]H0I?5+I?H5HT$ I?LHEH@ h5HD$ML+D$H={BHEH1@H={1@ff.@AWAVAUATAUHSH8HRdH%(H$(1HfHLftfL{HLEH5{AtAH5W{H`HELH={16HI{"1LH7HfDH1IFL5 HI@8HHHtsB tmHH91H8}\L+AERIH$(dH+%(H8[]A\A]A^A_ÐWuHHB:yUH%@=@uHHLD$H`L|$HIIL+M`IA`methC|8:IMFIH^@ TI @8BLǹ LLD$LD$Ht H@HxHtALD$HH HH@ I @8DLyHƃ`HL=HcC8HS@HK8I$@RIAR$HǀPHT$dH+%( H([]A\A]A^A_H{@ Hc+HC@I${R DHcS8HHHHS@H91C8 I$=0H@}I $AR<VL>|@q*L=I@8yHHO@ EI9Ru @L1Hn/I $HLI9vAL5| fHL9t-HA%D=DtL9s,=ARL=<:A8HQ@HI$@R@HWuH@:L5VA%@=@pHH~@ tI@8gEH`HL9r6I@8ukH5LHI9dI@8u{HHtY@ tSL5AtjI $HHt@ uWuHB:vWu H@:uL5CA%@=@tI $LHHLH)HhSуV?L5ռ A+H]L9uUL5HA@@u5fDL9gHH[IA%D=DtLrM9bA=Et#[fD8IM9'AI^<\uL9sIA\t1HZL5AHBH<$9I$H<$WH+@:vL1HR'I $LAR*@p@H-HVLH)HUЃ<{?L5H AI^kHZE^AH=hHL$L$0L$HL$HpD8}M9rD@8t*D8IM9sAI^<\uIL9rуI@q~@xtL=.@I@8udHuLHI9I@8usHHtQ@ tKxtAI $HHt@ uWuHFB:ufDWu H(@:uA%@=@tJfHHLw/H)HSу? J1HCDzH1$I$LH1I $LH]L9EA%@=@-bz>z{ff.AWAVAUATUSHHH|$ dH%(H$HHHH$H)H&H\$PLpIHcHHHpB fHD$D$HB8EHD$Xw+ LzHD$PH9$D$E1D$D$D$D$HظH3f~p#HNX[J]H|$qHHH?H '@&PZHHA H H A8HxH;<$nH4$1"Hl$PH=du,Hu'HHHxX+ILI+oHPH9AIM+wLpAG €DD |$EAG IHPHJH;HHt$PH|$ H9QHرHHVHHfDHH9t08 uy$WQ$`tHQ$ǃ`H9uAGHSXH WH%A8HH fbH{pHDHMIIHMf#tEf!HbHt/H1HbHHx 'HHx 'HbHDH|$ HME1jLQH)LP蚁H IH,HL1HCAHD$PH$dH+%(<Hĸ[]A\A]A^A_Wu/H(@8%ۃ\$D$D$D$qfDWuH تA::H 7%@=@D$u;HrHPH9$v(pH=aQH8Hl$PH$H9.E<\uvLeI9HLd$PHCpf!f#EH{X;H lL@@{f|$t$@@t@uH$|$IH)LI+oHiHAO DAMAG I? AO HOH4H9wrzIGHl$PL4EHsIHD$P\$HD$PfH9$|$fDHwHLIHJvDL!IHl$PLpEMw]\$LeLd$PEIAFHD$Pt@(HH?€*@  T$ HHHx 'Hl$PE;|$]-|$Hl$PD$\$øG؈\$gfHW|$H\$ H1HKH9vD$.fDH9t Hx\t҃T$H{XEb H=^H H{X}NW}{MH4$1H}~6Ld$PA$PЀHH HcH>@#H D$GHxAI~|$AVMOIHEVDL)H\$(I^M9 M9IBH^wI@H^@LLH=}1O"HED$IIHD$PEAFHD$PHt*H;qxIAFHD$P?ȀAFHD$PHHD$PDA\Hl$PIEf.HUI~HHIHTITLH)H)Hi@A@0HD$PH9$/H $+fHPIHT$PAFHD$PH98 uD$H@H$HSH9H9D$ D$Hl$PуufDAT$IуtAt$LL)ˉH\$(I\$u@sHtL?@@ELNIt5HK!HcI9v DHHA?L I9uIDA,HM,HIL$D!HcI9rDDHHA?L I9uL$D\$HIAMˈL$H9F\$HD$PD$M\$IjL9LIL)L $I)D$"D$D$ M`LL)IIHH|$HQHEAGMwIxHPITHH9ps"LLD$(L)LT$LD$(LT$HÀ|$<HD4IL9~!A.IHL9@yIAF?ȀAFELXL4(HD$PoUAUTfATEM9wT|$t$HhHl$P\$xD$GÈD$HT$hHt$pH1LD$pJAAHD$xjLd$`H$HD$hHILd$`XZD$h@L;$$A$H0H w~ !tpH!HHHB HuAHB8H $E1LHH5uT H1}H\$XHV|$ILI+OHH$ H۾̍SHH"H4$H+t$PHt2HH9p #!Ht$XL1HD$IHD$PIID$HD$PA|${1ҾH=IAFHD$PGHHHH@ H4HA8|HL$pHT$XE1E1H|$PPjHt$A[[Hl$p1H.1HHqHD$XAIHD$PA IHD$PHHD$PA IHHHH@ HhHA8HL$pHT$XE1E1H|$PPjHt$ ]A\4H\$XA IbA IUAIHID$HD$PH;$A|$1HT$pL IAIAIH\$ H1HKH9v H9t Hx\tЃD$HrHpIIG\?v<3D$Hl$PDDH=Nu1PπUH0H H5SU1Hl$PE$HCL9}L)@@,+HL9uM)LDLp\$HD$PD$\$vPy`HHzH $H)Hp<Ѓ?H  DPH oDf\$HD$PD$D$\$1IrI@IfH@IDHP#WN<p{Y?^x{TAHD$P\$ID$I\$IHuAGu H9LL4(HIOIMAO D$1ҾH=t1H=91H[E1HfDHǀH$I|$}H|$PH)H|$(MH|$(HHHHH9H HGHD$PH9HHƋ%H=HtIH9r!@IL9tAB%H=Ht@U)+L_HzXL\$Pe H 4GDt1Ҿ'HIH=GRH\$PAFHD$P1WuHp@8`1WHL@8Hl$PL$HH $HUH9$w1HT$PIAFHl$PHUHH9d8)uJt H;qPI^HM9s'HLL)L)Jt HL)J| M) LI\$ED$HD$P\$\$\$ID$\$nH5\q1 hHl$PEjHl$P\H5p14AIHD$PIUATATx{H4$D$HD$pHH@ HAH@8HD$pLDLT$(HHD$@Ld$pLT$(HMtbHHHHZB PH<H A87LLT$(T$0aT$0LH LT$(HE % =%Ht$`"HLT$(JLT$(IHKHHxXpHT$`H-IH $LHD$(IGH)H)HL$8H|$0E DŽ$\N{U+f$H4RHt$8Ht7HAGu IH9rsL $HD$0Lp$PL9d$(vdH|$|Hl$0HNH\$@HLA $1HHIEHsNfCECL9d$(uHl$0H\$@Lt$8IF}u HuH\$PHnHIHowIHJLH)HPAO DAHT$XHv!HH$HҍBHH"H$H+T$PLHTIMwD$H\$XHHIHE1W)HD@8AAD$L6L $A@(HTH9$wb8tMAILHD$PH)HD$PHH/AH9HOHTI9y})ƒrHUI~HHIHLILLH)H)HD$JHl$pH 1HHP1H=1HE1HfDHǀHzXX<H=el1H=z16HH|$PE1HfDE1Hǂ7H1AHI`1WH@8% HHAGIH9pMwLpLHT$M HT$ILd$(L4I~ LfALHH|$PL9s=ASDu.t _dACDTL\$PICHD$PL9rILHHI)ILM_A$zH= Hc4!HAIT$H;T$(rHH9T$(DHHLF?A0H HwHL)HD$pHHT$hHD$pL$1HILH|$8HcHD$0Ht8AGKIHH9p>IGHL$0LHT$0HHiHT$0H|$(Ld$hHL9BHt$8Hl$8Ll$0MMHH\$HHHt$(I+D$HAErH=K Hc4!HTIUH9rNHH9>DHHLF?A0H HwH L)HHT$hL1HHLcHD$(H4(LAD$I$H9pIL$HLLH/Ll$hJ8L9Ll$0Hl$8MH\$HLp}IDŽ$\N{_f$AF\N{_$AFfxp#E |$LHT$`H+D$PHH9s6IGH $I)H)ItHAGu IH9qs LHT$`ILLVLt$`HELeH@HD$`E1W.AVHH0H wpI IލPH v<_I9uMI]M~L9111LH|$LL)HWHL9wH\$HL$E1VK DA)H K -z>Ht$LH|$H) <..H]LDAWIAVAUATUSHxHt$dH%(HD$h1<9<0c<.[<0:Oʃ߀XqB.@ǀE@@@|$(O3 I_AAD$1_ D$ H1҉E1E1fE1D$L shHLc6 Ic L>|$(H '7Ic2H\D\$H5z7H1?D\$LD\$D\$I6fDHt HI9LfDA|$.$A.A|$_I\$IQIIH6A$p@ @<_@lj@mM A|$_A<.AD$H0H hfHLHT$`HL$(LL$H`H)LLL$HL$(jH|$`HL$LL$HL$H(IH}A@9H9HLMjE1LjH`jH)SH IYH{5AIܺE1fD|$H5m51T$PD\$HDD$@LT$0D$8aD$T$PD\$HDD$@D$8LT$0/M9 <_AIIQMfI*IcοLT$8H*ZHH5Դ1HL$0D$@HL$0LT$8L ^D$@@H=41DD$@LT$0D$8HI1LHCDD$@L ^D$8LT$0fCH5HNju߀P{_yIܺE1 ߀PEH sHHLI D1D\$HH53H D$D\$3fDH=31DD$@LT$0D$8rHI1LHCLT$0L ]D$8DD$@fH)XH HXH LLfHH H*XHt HI9tPЀ v <_t|$tHLf1HL$PLL$HDT$@D\$8LD$(D$_HL$PH5a2LL$HDT$@D\$8LD$(D$HLME1jL)LjHTjPH If|$wH511T$PD\$HDD$@LT$0D$8D$T$PL \D\$HDD$@D$8LT$0@H= D[A|$AD$Il$PՁ<_4HD$HH.D$(AOI_E1A@HHELI9|$Hֿ1HL$8LL$(\$LL$(H0HL$8f|$HH501HL$8HT$(D$HL$8HT$(|$1HL$8H5Y0LL$(hD$A$HL$8LL$(|$7Hֿ1HL$@LL$8DT$(Dt$HL$@H/LL$8DT$(fD|$ A|$ MIw"|$ OIw|$ IOwDΉL$ <.sAD$H5HNjADT$PI\$ELl$0ALl$@L$ D$8DDD$HvAAAD AADDA9| @_A<EtT4DDt$8HIL I@CHHNju@_15DMEcA|$ 5MHD$0HfH*|$HL$ LL$LL$HL$ AAD$Il$IW<_?D$HHHI"@Ll$0LD$8D$L$ A…AH[H5ZPHDH=MJ1HI1LH&HE@RL1HHH0H vAvuGH0H v.1Ҿ7-1HHUZH[]A\A]Ð;t}uAHUTHDŽHDŽ@7TZH[]A\A]D1H;t}tvu1Ҿ7HR@AWAVAUALMATUHSHXHt$(L$L$L$dH%(HD$H1 9ЉHJRHcH>HyHxRiA$DP$AVATHt$H*H HT$HdH+%(AHX[]A\A]A^A_DөH:yHHtHfnb:>myCL vAFA%D=DCIA>(tA<$t<\yCHHLrM@RL#DHw111LD$@H@sHDH|$@E1111WHHaDE1E1E1E1/HuH@M@RHH HruH@L@RHHHLuAHH@@RHHfDXr?(=HLy%Ht=HH@=@RHHfXr?(SHtAHH@@RHHfD`r?(HL$HDL$HL$HL$HLi$tHLM$XH7L1$HmHzR1?=uu V}B>OBRH}=\HaHGH=J蜻HlHH@@RHHfPr}(HSlHu VHfH@$BRHB%H lHu VHdfH@$BRHB(^HaHLH8)4HkH@@RHHHCLH[kH@B@RHHH5k}HH@}@RHHfpr?((Hj~HH@~@RHHfHr?(ZHjH@@RHH$HjAHH@@R HHfDpr?(~L%dI$Hx0Ht HHx H 1HjHL+蟼I $IEHI$@RH9Gщ>kHi1ɺ7L# I$HT@@RE)HL HviHH@@R HHfPr?(iH5iA8HH@8@R HHfDpr?(&HhHH@@R HHfHr?(XHh<HH@<@RHHfpr?(HLHThApHH@p@RHHfD@r?(EE1111H5H rbHgH1HBv$BRH9GΉDMHD$(E1111HD$@腿IHV5HgL%bHI$@J$9t ǀ`Hhx@RHELpMM'$ DE %=8/HHt$@DD$DD$HEE1HL$@DHtgEL eHA%D=De(Ht H| DH9tHH)HHL$@EHA%D=DtH (M&H+H}xw/wHExLER HEHL=H/fHH@@RHHfXr?("H\L^iHLBMH>L&1HL H~eHH@@RHHfXr?(qH=eHWH0H`藃HLHe11LD$@D$3HD$4@躼H1HL%?_E11H|$@11I$@$D$胼IHD$8HMG11!IA(1L5KIL|$8At(IH`HDEuVvƀV@@RHLHp`AHH@@RHHfDHr?(a1HHH0H $vuEH0H x(H_H7Hƀ`7L%HZ"U P8 fLCHHAHv1LDT$D)L$(kL$DT$t6AILKfDH1LDT$DT$ILKAD$<*i<#gA|$*[PFT$ H0H M0A( v<IAALM̓0< vH\ff.AWAVAUAATU1SHdH%(HD$1$IHX H@8L5V^ IHHt_B tYHL9S1LHD$dH+%(HL[]A\A]A^A_fDWu H0S B:uA$H\ %@=@uL5] IH`ILԟIE8I>MH4$H`膞I1HDTܯIIcLITHJ# THʉ@TfA<$:A|$:ILL5\ IH`IE/IH4$H`H?COREf::HfHA$yDHHHL)HAL$σ@? H Z Dd@IH4$H`I1g[fDA$tf.1LfI>8(It GR,fGR!LȻd&fDAUHATUHoSHOtoʃHAHL%:[ 8J> I$zR=uLDEu@Vv7HHD[]A\A]@?L%Z I$zR2BAAPBRHx=uHAaHfH5QY WL%~Z @@/I<$HXHHDhH9r$HH9t(HHtH)H~ f;=>#AU9H /HcH>fDI$HzRH GT A}H1v$HD9GΉH[]A\A]DH5YX %D=DtH%D=Dt ~I$BRAHPf.HA{BRHD[]A\A]ÐHx1Hʼn؃<$E<*$<#L-VS IE@8I$HHB HH9Bu1H)]I$$&IMAI$@RH9GщG@tK%tF*HE<*t <{8DI$A@R H%DuH=  Ht뼹H=蹦I<$AC AMAAt+HHEfDHM6!!HfOrAKWHDGR HH[]A\A]ù((봹,,먹뜹''됹  넹++u**f))W%%H9&&*##$$ --""..WuH0K B:HT Ë%@=@,1Ҿ8HII$LA@@RAHpf.Äy>H-HHH)HUЃ<؃? HS DS]v}* 11Ҿ7H;II$LA@R1H뤹;,fAWAVAUATUHSHHH8D+dH%(H$(1H& 7L%N HI $Q8Ht  1A$H<HE tOHM< Ht>t7H5R f‹%D=Dt ;QHuـ;$tDL|$ LD$LȕLD$1LIDLD$_Aƅtw1H$(dH+%(H8[]A\A]A^A_DL%M I $Q8utAQLD$IvB|:IpHR H HH+@ !I$ @8 LL莡H5P ) H@Pu HxHtHxf.L1IHHL)H~ A}=Ht$L(L#1HA$T}IHTHB# T@RDŽ@7HʃLTA}(&83 WHF @8%ҁ fHHHH\@ RI$@8DA t$DLHf;$CH-P HEHHrLbf]`HAHHHfO DDH@R?(9 HGHEHx5HE@] NH@HL@@*qf.A}>B|:Ht$HO D4 fDWHE Dp8AA 1L)VHHEHHZ:f.ATAHSHH I HeO LHpE@$HfprD9AGȀTHHuPR?(t;18(t/HuVvƀVHD[A\AJHD[A\ff.@AWAVIAUIATIUSHXHN H$T$$L$HD$H$LL$(HD$H$HD$$D$3dH%(HD$H1HD$#HH;t z@|$#1xRuH;A<'c<:L=tH D$4@t1LH=D込IMH|$H=i>LHHkAu AuH IR$HL$89G1HꉁHL$8H|$HAHH@@# HHHnH;aH;D$(H;@R1LI<={<(H3IR$9GH<$tEAEH nK ImH‹%H=HuEHH‹%H=Ht)H|$THVH|$H$HTDŽ@7HʃT@A LHD$HdH+%(3 HXD[]A\A]A^A_fH Il$B!^:B!_:H $|H $tLHH @  I @8 H`L dH H Ƅ)`M IH $R$9GL1譝H $HAHH@@# HD$HdH+%(. t$#LfH+IR$9G1LꉅGH|$HEHLH@@# `E1H @# H5|$3HD$HD$(@ < 5H|$(H<$ HGx HDH<$fDA~:HLLD$@L)J `8I@HD$@H ID$4L=DD IDD$(L=D IQ8myAPNjfDA}>uDt$4E7DT$$EDL$(EIR8ubHHHt=A t7HI9u I91L胳AE5@Wu H > A:uH G Ћ@@t<$u+|$3H$1LAƅH<$H= l$#@9HH@H#H|$"HD$HdH+%(f LHX[]A\A]A^A_&pfD<$u\H<$QL$$u T$(H<$HHD$HdH+%( LD$HL$LH$]f.<{]H<$u@H<$HHHD$HdH+%(LD$HL$H}H$HX[]A\A]A^A_zf.t@1HH=.f.L=A HA H51&Ih$1覡I@$f.H|$AH$I7V8/|$$t$(OxRt%HrHO9 D$( NL1E.IIHMHL+RA8B tHI9|j1LLT$(肰LT$(A>$sD$(HHLRMA(tPrft9H<$f`_HrHu8  yl$#HH9@RsH|$(HD$HdH+%(lLf.HLH`.H|$HxH=~HHHD$8詥HHD$8H<H|$HH~芢HTDŽ@<HʃTa@H$HLAƅH|$ DBH> cL>SAEEfCff3HHL`HtoB tiIA8u[LH5e1Q1AJWuH4 B:t IB8e 1WuH4 P8H|$|$30M7WuHX4 @:t AF8ME jLLT$(LT$(msHA>'LLEHHH`Ht,B t&H9 HB8uLH=1ۯ1WuH3 1@:@ff.fAWAVAUATAUSHH%> H-8 dH%(H$1L3IHUIB$B$A`tȉB$Adž`HEh$HLEtXHHVAttwAfKIHHHHRL9rHL)HA?=cutL%; AOA@@H11>HHLyLLLHHRHQHǀrHHǀ@HtCHLL3ArtJIA1_HHurtruIIMMMMHHJHHIdžHEIIdžx$AF4"A;F8ATAƆAADŽ@VHЃMATkHQHH HqA!gHHfAIh$AH$dH+%(HD[]A\A]A^A_f.r@fDHpAAWWALH=1@A/Au AIL9L豛IHfDAIL9L1~IHA7L9v6L%8 fDIGH9;IAHA%D=DtH / @:A?#A!AOL%\8 Mo AMIA4DDtLu%EHtHcA%D=DuH5LOHHuHA HHvDDufDHA}ArAgRAwIA:I9A.OA $HHHHHA HHt@-iLHH3 Hl$D0H4 D(H37 D$H/ D$#@HL$A ƒuHD$AL#IL#H8[]A\A]A^A_DAD@@H-H HL)H~/AD$ƒu?H @ŋ1LхH81[]A\A]A^A_E1AWH` Dh8AA f@DD\$,DLT$ LL$LD$|LD$LL$HLT$ D\$,A EWfE^ f.@H1LLT$L$ wLT$L$@A L#t@A L#afH $A!dL#7H $A% AlL# A L#@A L#@A L#H$A% AH$aL#fH $ueA%AuL#@A @L#qfA @L#\@A L#IA L#<@@8tcDH=&1WgHHl1HH߁HAWuH { A:@@L|$ L $LD$L'NL $HHA%D=DuBHHA%D=DtHE;HHB  I $ A8Ht$LrHOHEHL$HHB I$B8MH51e1WHN P8nAFyBHHHH)HAVу? ADOAyBHHHL)HAVу? AD^AySH-HLH)HGƒ? ADroAFHA%D=Dt =/NHHQ*HHAF;AFH0H -HAhAFA%@=@L $&iL $AVHADDHH)HT$7HT$H LM`6M`HHHDIT$LLHL$LL$tA><|$tHL$H9HA`$D$HD$(!H-L+HEP8 fDAH MIljуvIHK@ AM9"1LL\L+A<:y<'HMQ8vAPIHt @ ;AW?H A:)f.IAEHAnAERMA|$UID$ H-hD$M|$M_H}G$Aƅ` At$D$IHD$0IaHD$@~uD$At$M|$L%Y@ƉLA%H=H@BHIƉA%H=Ht">A"@\u IA'G8IHB II9fAAЃHEL+@8LLT$(MfAMH5 I͉ƃHHA LM9(AEyCHHZLL)H AM΃@? AzHE@8ƃHHt A 3W9H52F:#AWuH5F:A7Hj%@=@ILL1#KL+HUIR8уA7@yC@HHwLL)HAAAA? @H=QfDA7@tf.M`HcT$tM)I9AEE1111LoEHD$(HRL#HD$(AD$RI$HD$xdH+%(HĈ[]A\A]A^A_!>9EuAV ~AELAnAERIf@ H=Y7NA`$I=HHHB HU B8L)8IMgL1:1H4YL1I:L⿡H"Z@HEL#HMID$`AD$Q8ut APL踈rW;H2@8% @I LM`M`HL)/HHHDA|$>ID$Aƅ`D$tH9ID$D$HD$(AaMa1H¿g9t$HrDEuAV EIAETAmAERM)HHlH|$HELILL$t4L+I;EHHcT$tHT$HD$(I_L9{ H|$(f2H H)H_T$tLLH)Z.HWI9/H# HHH H9 H u@ z HWuH A:6AMA @@LT$(MIH|$LLLL)H)H9HOЉT$tHcHT$(d_HT$(IHT$HD$(@u AELT$(L1LLl$(LT$8SL+LL$(LT$8vfDz @ HHHHH H+BHApIA' D$XA`uHD$XH@ \H;D$L$ `H|$8HLJ<HLJ<jfp_PL5IH@IIWH@AG %DAG H8L+H=G1L5HAal$tD$IHD$8IHD$@IHD$HF^|$IHDoHHRHf`HHUDz$@\uIH@HIW| HE|$Lx$IHHzt Ix tEHzHTHLH'2LIHH@HBIHI+A`IǀIIǀHPH ) ` |$IHcL$tH)H9IaLD$ H|$0PLD$ HItjH|$0H9 HpH9HO1$DJH9HH9DA%H=HtI9 ILFHHDD$:uIHcT$tH)H9|IaLD$ bPLD$ uIHtw wH|$8IHGIHHBIHD$@IHD$HID$A`AIHPHJH;HHEL#@8u9I$H@ II1Hp-$tAO D$XM|$xAD$fD x @ L@ @ LIIHIH H+BHA HE1I9 A%H=H(AAMcHH@HDL$ Ht$nPHt$LHIHD$YHC&DL$ HHtw wH|$8HHWHHH|$@HQHH|$HHT$`HIMwDL$H@HxM$GDL$HD$H DM9IDL$Hl$0L|$ L|$@A> LHcl$L)H9 HLLM I4.I9'LI1H)f.HIH9tA> uL-M9wL|$ Hl$0IEIuLHPM>H|$cTAu Au.f.LIH5)3-HD$BMcH H4HHx@ H|$PH|$(D$\HD$0HxH|$8HHpfpHt$@Dl$ H|$(L|$Hl$ L|$@Hl$0Et H}+L}H}I LpMwLH)}%HTHmHuL|$Hl$ MtAw\Aw|$HEx$H;HaLL1=HAARGVAFA$W#H@: HD$8H|$( HHHD$H)$IHKH|$@HH@HGHD$HLct$tHT$HL)|$LHzH|$ eHI9H|$8L|$MLl$`IHl$8L`HIA u`M9<LLLJuLLl$`L|$AHlIH@ H9Y#HY IP8уIHt @ rAWuH A:V_fAW#Hn @: AWuHG @:3H ;%@=@P H9s7H HSH9HHыDDtـ,H$dH+%(H[]A\A]A^A_H-HwFHH)HKȃ<?H ҋmH1H:MuIHH(HnH(L- MuIH9LfD1HHMuIUH-HMHH)HMȃ<?H D~IMuP8Iу8H D@KH,0H)1HQ…IH@ I@8u| HH_+HtH@PGH4H|$HHI)1HsL$&IHLH=1mMDAW{H; P8 cfIQUHM@))Htt (uH= 4DDuqHH4DDttH=\H}LH515]HxyH,;HHHHH DDVHHT@@AVAUATL% USI,$HH9t []A\A]A^@L-1 AD%D=Du)HCHHHATDDtL5 IP8DH  HÉуHH@ t~LI91LHVDI,$;-IHR8уHt @ pWtH A:U^WuH5 F:hAD%@=@|HD3@yF@HHLH)H+{AAA? @AD/;-DHH9vH)ھ(HHLHL)HcHtJ@ tDI@8u6[H5N]A\1A]A^<3@jo1WuHv P8LH14I,$EIfAVFAUL- ATUHSMe<v @*A$rtuM$`Ll+II$Htl@ tfH H@8uQDMH51D;DDH51;MeI$7[]A\A]A^Ð1A$WuHt H8됐AWAVAUATUSHHL5 H/L$IDL$HH9sbIIE@L9+UEEBH s DI/EH‹%@=@t$D$H[]A\A]A^A_@L9+s-HEIHHPHUI/E%@=@tIHH9SH[]A\A]A^A_@HH6H T@':c}:Y|$t }$HHEIHHPHUIHBIHHHH II/HH9UHHLHH)H<Uу*?H D}I/H+ EH4fDzEnH t}EHIHH9vEyHHHH)H}?H @ ufI7H;HH)HI9BJHI+HI/IHH9SfDHp*H! #@Hq H0V8v&bVFPLuSEtNIH}HH91ҹ->I/U1H> @E%@=@HHPH:HHPH:IHhI/IHH9JD1H=H UDEy@HHwMHH)H/UAAA? DLEt2-I/UH5kH= {1Cff.fUSHHC H+Er fv f-DfwHw @9@-ty%Gtk`H`HHaHwHBHHHaHvu1HHtC@ t=H& H@8u(AHt>H[]HEH#f1WuH p8 HH5 H%[]H`+AUATSH dH%(HD$1HIH H-Ht H)IH HHHtR@ tLHB AH@8u6L"HILDHH='1'AAE1WuH Dh8AAH] HHHvGHHt`B tZH HB8uJH\$ 11AHCII)K@D$ ^E1H\$ @t$ AD$ &Wu H) @:uHw@t$ E1H\$ AD$ DAVAUATAUSAH H)L-x HIEHx8#MuIcv8dwIF@VAV80@IEH#I}LJHV.IEDVL~t IEt;L##([]LA\A]A^I~@ Hc4IF@MuIcv8iH=w14H%H H@*t>tHBRHOH uًJ8uBQf BRt3TDŽ@HTHNHfr8uƂuTDŽ@~HAUATAUHSHt!IL- IMHH@ H H@8LHDD1HIuTHHDŽ@7T@# EHX 8HHtf@ t`Hq H@8uP HLH[]A\A]D1WBH P8 *fWuH @:uAU1ATUHH=,SH0CL-Y IIEHHtfB t`H= HB8uPUH = HH4 H)H9HGBL HnBI+fWJuH=t11IIUHHH9vNHNHH9w8F t>H= H@8u.HH1IU0tHH9tC< uHuWHH)HDHH v]HF H= H@8IHH9wDI9vA@IA}x9A}AEHc,I$ID$[L]A\A]A^L5 IH4HIAEw.tt 1fLDAEH)I$u  H=C,AL$ HH9 H81HCH@ Ht@I$HI$H@@<,L5ٽ IH\HII$HI$H@ I$H@I$H@AT$ %_AD$  AD$ I$H@DID$ID$I$L[]A\A]A^fID$ID$I$L[]A\A]A^fIHzHHHDHH)1HwI$H@I$H@I$H@ AD$ % @AD$ L0?AD$ fDT4q @T4Y HDff.AWAVAUATUSHH HH@0H@Lp(MtL= HHIIdt{1L<%L AD$ <tlHtxHLr&AD$ uAD$ I$H@ IdtXH[]A\A]A^A_fIċ@ u11L!HuLHLWDH LLHp$H[]A\A]A^A_J f.LAD$ fAWAVAUIATIUSHHL5 LIIHxz"HILjAM#HfJrHAG  THBHHHBR<@Tu VLSH[]A\A]A^A_L10IMfDHH!L5 I.HEHx(Htw wHECHX({ .HE@#HEH! HEH"LH7[]A\A]A^A_ILj< II_LH:HpMt3L J<+HADDtHHH9uH@H9ʀ;tOr@;w:H>H3p@\<&u A<${I3@PH;uPH;t@ƂVR@HUHEI.H IH I$@RL9Gщ?f.B] HBIWHJ\*L)If.I;uHH@RL@DI.HE\pI@fDxI@t@[H@]tpH@t8@]ux;uHHBR@L@]H9 H8H״ H8tCH5"IuVvƀV@RLAH5ff.AUIATUHSHHu+&HHuMImH[]A\A]ÐHHLd5HHHH H ȃHH)H9HHfDHHUI9HH#UtHҍBHH@I9vQH @H1fHv HH I9wHujH)HtHL9rMtImI9H[]A\A]H@@}ywI9wAHI9}yXHu}u1LHHxLATIUHHHD H@8uOH HHHt!@ tMu6HLH]A\\5@WuHг @:u1fDHHJD%HHHH H HH H)I9rH5pUH=v^1H5 HHtƀqDAWAVAUATAUSHXH|$0Ht$ T$,L$8dH%(HD$H1H]F D$% =vH|$ Ht$@HD$HD$@HD$HD$L`Ld$@H1D$? E1Lt$D$*1L=TED$D$(D$+@l$)AH Hŋ%D=DD$)@EEt)H=st$ 7t$ HD$ADňD$ LH@@[@]@@@%tDl$(D l$+@_AD@\D$(IILd$@I H|$Dd$*H|$A A|$,H= 1 !H|$L|$HT$ HL)B LHHE1E1hHT$ <HXIXZ|$8t#H|$0:HHHPH|$+f|$*3|$t$HT$0L/1H5\IfHD$HdH+%(HXD[]A\A]A^A_f.HH@HD$HFHD$fDD$(E1D$*fDD$*E1{D$+E1kD$+E1[D$)@l$?D$+ED LLHH0ID$? A1D$*D$D$+&HT$0L/1H5B[HT$0L/1H5ZzT$?HL$0M1H5Z/JH H8H5{HH Ht$0HHl$0j f.H HPtkt`THpHHtRuEp8L@@p8HcA40 @T@fDuڃfAUATIUSH8o dH%(HD$(1% =zHt$"Ll$Al$ HI݁ I9 fPA!fH*^HYXI9Iu HyHfHH H*X비H=q  H4A!AHHSI9wHI9DHHLF?A0H HwHunH)HJf.Ld$3fHD$(dH+%(H8f([]A\A]DHH_LhLl$T$LHE1 $HL$HT$ HjA9HD$0HT$(H=Y^T$ $fHnH. @AWAVAUATUSH8HL- IEHW1HHIMA IHX0I@IEHIEL1HIEru H HIcDIvUIDHHBIVI@H[]A\A]A^A_@A} IEHpHPEtl1H)NDLH9HGIuHIEHXHLLo H}HHfDIuIUHH9r fDH9thH< uH9tXHڹLH)(IEI+]HXHX0>H H8oDLӉD$ D$ h1aff.AUATIH=U1S@HL-x LHIEHL)HH1HBX1H1Hh HH@8IEHHHBH1TIUHH HHHIHHHH@H[]A\A]f.AWAVAUATUSH8Ht$dH%(HD$(H HHHHcljHIL,IMHA LqXHi8HD$H HD$HMIM}HQ HL$LbHL$HthLHLH|$1L)LLL$D$.Ht$LD$DHT$(dH+%(H8[]A\A]A^A_DHHA8IEM}LXMMsIHRHIItAEuH9psLL\$L\$IuL\$K?HL$ I~LH|$E1A#L\$IUL\$ LZIHPIFTIH@IMIHPHt|HvHINHL)(<w]L߁ HcHyIUHj8DAE1rL\$JH@kIELXH=N1 HH=,O1 ff.fATI UHHSHrH{Ht _H H{L[H]A\HAULTLSHH(H|$dH%(HD$1H Ht$HHHtc@ t]H AH@8uGHt$H|$ALGHD$H)HEHD$HT$dH+%(u,H([]@E1WuHm D@8AAfAWAAVAAUATUSHHI H D L+%D$ H-\ HDH H8%H-A <HHD q\H H I$MH(uH;HEHHMtvH ח AELhPH HXIEH@HHt H@HRHBD$ u4HD[]A\A]A^A_f.H= ,ŐHa H@PHPXUSHHF f%ft%HHPPHB\H\ H[]fDH~(G % ="1MHH5HtPH5xHt=H5sHt*H5 HrtH5H_jHH\K H[]HRHHNHRHHRHB1*!fHoMPXHH HHt#HtH=K1H=K1tH=@1H=K1H1H= 1H 1HfHǀHff.AWAVAUATIH=USH1H(T$ dH%(HD$1 H- IHEDxMEAHLHHH9HH)HL9L9H= DFADADHDIHHRA DDtHL)AAT$ HL S H IHEdHuH$HP0Ht HHP H 1H5>LMVHuIcHH7@ -H@8MH5>L1OHEDA9}H I$)у8H H53L1HE1fHǀHD$dH+%(H(1[]A\A]A^A_fDMtHL9AvA oLpXM=H5x=LE1&AM1WH* P8@L(HL)HZH=^ ADDINfIHHIADDtc H5<LWAAHaH+A@AH5<1YI@LH5<L1,LE1H5<AfH5=G1LHEǀH 8t4H Ic@u9DH5"L1AE1fIIcIDB@tHt$LE1D|$ACAW@ H5J;LALE1H5;AI,ff.UH#H1]HeDATAUHHHDHH]A\5DAWAVAUATUSHH- HExRLLHLH1H=EHIHHEHM9HuLHML= LIDH8EAM9H H DP8A#Eu:H< 8IM9A}%D=DlHtB uWuEuMfL)HHB H( H@8H5EL1HUHHi@ _H A H@8EAF % =k1L"IHh LDLHHELH[]A\A]A^A_DI9 LH1H=CI\$MHIL9L9H H Q MLHԃ DH8A%AB8u9Hr 8IL9zA8%D=DcHtB uWuEuE1WHQ Dx8AF A% A =MnD1WH P8@LEHB LM9tAE3HHSLL)HIA}6?H ۋ D^IDH8>DWuH8 @:bH AE%@=@MfAH IDσHB LM9)1LLǹLD$HuLD$HA<:~IDH8DσHt B bWgH Q A:GQf.WuH( @:OH A%@=@nfDAylHH$LL)HEXDكA?H  D !DAH fD&H5/@L'ef1LƹLxHuH(H %D=DLL)HB }I@8uoMH5?L1fDLL1LD$HuLD$HAE:H D 1WuHV P8qLL%HuHDAWAVAUIATAUHSH(dH%(HD$1t  xFHHw HHCL8HC HL;HC(H ƃTHHXMAE1ǃdǃƃ CRLƃqAtMMAFxLc HC@U(HCH_HHE  8Ht$"HVIƋE 1H} @8AREHM6HEAHHHHHUHBrHHǃHǃDWHD$dH+%(+H([]A\A]A^A_@IH=l1HHHZ CRE1ǃdǃfLƃqrfDHULuHRHT$ HEHT$LLxLH|$K4>1U Ht$L Hf.HEH@HuLkLLILHHL H H H)H9LrXHu^fDHL0@yHD$H=;1HI1LH9@H9rfDHH90@yfHH5/HHAz L0MIHH~ HH { IH IFHAXHHHQXIHIH@IH@IH@IH@ AF IF% @AF M?H@HHpH9HH#0tHVHHHD$0y{I( H z ;H5N.H=6USHHH-[ HEHHHHH=D:H16HEHH9r@HH9t; uHH[]AWAVAUATUSHXdH%(HT$H1ҩ?H5 H@u f{pHLLHHUJHII)I)LLI)MH)H<$I)1I)HHLDLL$II)HHIEH|$cHHMu HEH@11HL$L$7HEH*H AAHHEHMLXHJE5I91LD\$(LT$ H|$H|$LT$ Hm D\$(HLL$8H A MH^ Dx$HL9H=q ыDDvL@LT$MHL+hvLT$IHA9}HLbK<,H|$8"H=m MH|$z$|$`EH@TjE1WtHg D@8AAEYD1DHD$8HAH0H lLHt$@H|$8E1EHT$@@HH)HH=Q1:f.AD$H#l HB8EHI|$HH92Є H=3p Du_<$<{uQH0H vGHIyHHH)Hf?::t"A-fDH tƀHD$HdH+%( HXL[]A\A]A^A_HT$@HD$8A0A^ID$HLd$8 zP8oHLu XHƀIfDH5o @@E$HHt$@H|$8EALLT$HD$@ޘHD$@LT$HRj Ld$8HA $Dx$HL9vH=~n %D=D[{~EpHi H]fD}HLbEYL91LLT$ ELT$ IH5m ы@@@8EI9D1LLT$ H|$VLL$8H|$LT$ AHGH=`m HD$@Hы@@tuGƒ߀[tH^ H:O8փ utGRt<$<@wAt$H=<:HQR@BD$ Lc^ AkAI@8GHc HHHB  HL9C1LDT$'A]DT$$Au@ H= DT$DT$HAuH=l ZEGDT$IAGMADAnf.A]\rH=4 HtACFT$ < v $AfDWuHW B:AUHJa %@=@1ɺLDT$H$ HHDT$HHH.b HHH;B 1L\ I A8HDT$DT$HOAd2fDHAHAEƒHAHAtA2u;AH= 蓥Ht!AH= vHtAFT$ fAH=r KHu@1پDSDAEyBHHHL)H0AUу? Hn_ )A]fDA HAHPAEtf. fD$G D$Bu5 H=a LL$?LL$HFT$ A(VfFT$ AE1WHP 7M9IM)EujIH=1?ff.@AUATAUHSHH(dH%(HD$1HG H9$% =DHt$H߃ IHE % =DHt$H ߛHt$ILD$MHC U 1 H-Y!HB8 =LLL迡fHLkH@HD$HRLD$1L HD$MM9LLLl% =Ht$H"ښHt$HNjU HË@ 1I9nHT$dH+%(~H([]A\A]fDHD$L-(]HELMHpHt${fHLLLD1@HH}HpHt$Aff.ATUHHtmHtHG H}F taHT$ H4$؛HH4$T$ u=fHWF uHN!Hh@HOH E HE@HH@1ɺHH4$H4$HI@ LH+>N!HHAD$ CtID$@@HH@0HL1]A\gF t HF@u 1HVH]A\fHH@t"HM!HpHqM!HhHDHYM!HhL;%IM!H$T$ H4$ H4$T$ fD1PI$HtHPH31H(ID$80I$Hx ff.AWIAVIAUATUSHHH $LD$pLL$`dH%(H$G Ƅ$ t HT!HR8׃@$$ %= H$1LaHH<$ H|$`A>%MM9R?$L|$MIeffffffHD$xMֈ$Ƅ$Ƅ$Ƅ$HD$ @Ƅ$LHDŽ$HDŽ$DEIH<%I9wI9H|$IM)H |$HA$ $J\ Lf.>HHH9u(H9YH|$HGI9r>fDIHI9t)Ayу?IHʀPHI9uHD$HIHHXDHoA>%eH|$`t H<$RH;H<$;H3A~-(A~pH<$/J<ЃHGH01L}H$dH+%([=HĨ[]A\A]A^A_@L|$HLD$LILD$H@f.M9(MGM99AGIH1HtAWEIoA0HH0IcH w1L9r*HH0HHPUHH0H v<$HD$ D$E1E1Ƅ$DeE1HD$HD$hƄ$Ƅ$HD$8D$0A.TAD$HM<.wHHcH>D$@HL$(A%EtdA H=L$H$L$D\$PDL$H0DL$HD\$PHL$H$L$H<$ AD$<7HHcH>DMHU0HcLI0I w0L9(DJH4H0HH4pLI0I vLJ<$DLL$(H<$H|$1ɺLLD$GƄ$LD$M9$L|$A v'IHxtwL@HHtL[HAM!8HG!8E11ɺt1LlHK!H@ f%f=t f."LD$LD$mH޳H5IHL@ f%f=HHE1LD$M9" LLD$H5 LD$L"1LD$H5|LD$fL1Ƅ$E1H iƄ$EAT$HHwHcH>DDeHD$ D$1E1Ƅ$H )HD$DIDLM<*t5${H$tAH$HϾ L$D$PH$L$D$HMWH$EEt1ƃ<2@<1D9rL+H0B!HH8Ht"G f%f=MHG!%HH5;1DHAsE1~D$HD$IH$D$PHD$@D$ E1A+kHH;t$`6H!MIHL$LB8nH$11D$H胷D$D$H)L$H$|$H|$0ҁ H|$xHHE1E1L$D$RH$H$HE $% A[=]L$D$H|$xH$"L$D$,L$D$HH$HHH0HEu<0`$RE0HjEHH|$8 ˆ$HD$8}0 $Ƅ$D$0@L=!@־LT$@A I,:Hc!AH IBH9w fDHH9DLHLG ?AH HwHH+D$@HPH|$xHHoH@H$LH@$IH$HDŽ$D$@c<wHR|$@qH<$WЃHGWD$ \$HD$H|$PD$HD$D$cD$$= D$Ac2)L$Hf(fTf.oEff/lE!Ƅ$+H$H$HPIn@ff8HH)H$E1E1IHDŽ$D$HHD$@D$P_Ƅ$Hl$(HD$HHHD$`Ƅ$11^D$@c<wHHT$AB D$ $bI`(d$HD$H|$PHD$@HDŽ$0E1ED$ MAB zLD$DL$PLT$H@LT$HDL$PD$;DD$ EfH<$ T$@H$V$H HcH>E1E:D$ LEu+H$/ H<$ƒHWH2EtED$ E1H<$/ƒHWLLD\$HLT$@蔨LT$@D\$HAB  L׺"D\$PH$LT$H{LT$HH$HD$@D\$PAB D$P tHs8!H@8D$PD$HE1ED$ D$@q%E1E D$ D$@H<$E1H/ЃHGH(H$|$0D$Ht$8HAsE1gD$HD$IH$HD$@D$PD$ E1ED$ [E1HD$H $HH@HH+$H} H9HFH‹L$@V$wH52Hc H>/H<$HOH,E1ED$ D$@qE1H<$€|$@ ˆT$PE $ D$0D$PH<$/;ЃHGD$HH0E1AxHD$@D$PD$ E1D$@c<wHH<$Af,fE1ED$ E1H<$t IGH9 EoD$ MHT$JHT$HT$/BH<$HOHHE HT$E D$ E1f/H<$ƒHWH2/5H<$ƒHWH2HT$HT$HT$HT$HT$AR % ="LD\$@H$LT$ 8wLT$ D\$@HAR H4!H@8|$0L$L;d$8! u'!IB@!HH@!Jt%HLT$ D\$D\$LT$ HHD$8H9HFAB ^$tIB@tHH@?$L׹ 1D\$ LT$qLT$D\$ HM$L$0HD$8E1HD$@L$D$HIAsD$PD$ HT$HT$NHT$iHT$H$HT$@V$wH HcH>/H<$ƒHWD$H2E1HD$@D$Pi/pH<$ƒHWH2E1D$HHD$@D$P3/kH<$ƒHWD$H2E1HD$@D$P/H<$ƒHWD$H2E1HD$@D$PH<$HWHBHG+IIJHzHL$@H$LH5f般LT$@D\$HIzE1E1H5蕞LT$@D\$HHw 1"D\$@H5N詛HJ)!D\$@LP0D$ E1H<$ZrEtD$AD$ D$ E1HD$Af|$H|$8!ЄD$0t @{$H-+!E8@ H-0!HEHt @8+Ƅ$#DH<$/ЃHGHHcPHhH$HcPD D$AEĈD$H=D$PHD$0Ƅ$D$HHD$@IAp1D$ E1t$XL1t$XzHcXZL$8HcщHHHigfffH")<)0хu@.HFD$HIAsE1HD$@H-+HDŽ$D$PD$ AB IB@xHH@hLD\$PDL$H0RD\$PDL$HIB@LD$DL$PLT$HiLT$HDL$PD$AB 1LDL$PD$:DL$PD$D$H{H<$HGHPHW}HHH;t$`HD$pH1Y1LD\$HDL$ D\$HDL$ HH<$HOHAHGIHp AB % =8H$"LD\$@fD\$@HD\$H蹈H$HHHD$@H^qD\$HLT$@Ƅ$-H$H$DL$ =DL$ [E8DL$ wDL$ UH $HQHBHA9H<$HWHBHGƄ$EH$|$ ƒˆT$0HDŽ$Ƅ$fH<$HWHBHGbHL$LT$HyH4bLT$H$wEn$`$R|$@qGD$HH$DL$ H$WDL$ HHH$H$HƄ$LH$$D$H1L$H$LD$$HEH$HHT$@H$HD$hDŽ$HƄ$HD$HT$@LHD$HHHD$ HT$@D$l$PwT$HfP¨(HD$-LP$D$HA0AaH A#!XHHL$@ABH9T$ IIL9|$ A?tHD$ HhH$H9swHH9c}tl$Pzt$$A<E1AuEL9H$1D)AøDD$PIGH$H0L$PH!D HD@pH;$uЀ}H$H|$0M $LLD$ I)IL9D$8LD$8HHyH)I)fDHD$@D$HAsE1ID$PD$ L$0t4HD$8$HH1H j!!xHL$@(HƄ$HHH<$HWHBHG{u5H=\`L% !SƄ$11HD$HHHD$H<$HWHBHG:L=4DL$ L`H!DL$ HHHjH"@  4LDL$ `Ƅ$DL$ QH<$HOHAHGE~ D$HLT$IIjH@H$$D$ Ƅ$D$0MHV D$HE1IAsHD$@D$PD$D$ |H?D$HH\$8D$HD$0H<$/ЃHGHC  H$"HD$_D$HŋC tH!H@8D$ADĈD$Ƅ$H<$HGHPHWv/H<$HOHfD$E1E1HH$H$HjH|$PhAYAZD$H$H$1/aH<$HOHVIIjH@H$WH<$HWHBHGD$0HHD$@fH<$HOHAHG|$0HE1H$HL$@H|$ L9MZ$ABH|$8|$0u$)H!E18uH!8@H!H8G % =H$LD$8L\$0D$z]LD$8L\$0D$HH$LLD$0D$WMLD$0D$It,LD$8/H=1HD$0ALD$8L\$0D$L$Ht5HD$ H9r+HUHt$@H)1HL$   A HH9uIMt1LL߾0LD$ D$`LD$ D$IMLH+l$H9HHCH9$AaH$L߸PpD$DL$ HEH)1snHcHH9IDL$ I)Ԁ$$Hl$Ef|$H[HHJ|%H螀L0H_H$#A.IHT$ |$0AB0MZDŽ$Ƅ$E11퀼$}$oUHH<$HOHAHGL|$K<'LL L_TH|$ HL^:H<$HWHJHO-H<$HWHJHO:D$HHkHRH$4D$HD$0HH@H$Hw$HH/H=LD$8L\$0D$ZLD$8L\$0D$L=!~|$0.HEL)L@L9D$8LHD$8TH, EHyƒU<vXHD$8HDH9s,DHH9r8W$@0wHQHyH9u$.E1[H=1A~sH<$H/ЃHGH0HLLHHD1eHqA~.fA~0[A~fPHD$pH8G % =}D$sD$H$H$DHHH$1LfH<$HGHPHW)H<$HGHPHWHL$8IHQLH)IHD$pH8G u$HD$p1LH0{yH@(7$ZfLE1ILD$DL$PLT$HYLT$HDL$PD$AB H$H$H$Dd$0IE11D$PApƄ$HD$@D$ HD$8OH<$HGHPHW;H=1谋ˤHG!H5H8Ht"G f%f=H!%H4H=o1`H<$/ЃHGHBtwHHh Htgx<tuHmHHtHEHtIHcMHH$HHB Htz<tEHHu=H D$PD$0Ƅ$D$HH1HDŽ$1HEHcPD D$AEĈD$H<$HGHPHW=D$0Dd$HH<$HWHBHGWHD$8AR L$ utlIB@tbHH@tVJt%HD\$~D\$ID$HE1ILD$AsHD$@H)D$PD$ GLD\$hXD\$t$XH=1t$X[$$fDH9D$0E1HD$@D$zHLD\$ LT$WD\$ LT$H"D$HcH=CLD$81$$Eƒ ˆ$t$|$@q ˆ$ukHD$8HHV$hH|$1ҾDL$ 貅Ƅ$DL$ ?HD$D$HDLPSH=J1[$tmH!8uH~ !8l$PH$DD$8H H\$D$LHDjH$HH !8uL=b5L$SH!l$PDD$8H$H ;H\$D$Ԅ5LyL=5LRHB!H<$/ЃHGH(D$E11HniDd$HD$IH$ApD$PD$0Ƅ$HD$@D$ qH5<1D\$ yD\$ H<$HGHPHWeHMHVHtQH !041HHsH)H9$L$0H+\$8HD$@HD$8HÈL$PHtHtHVHVHtHH@DHHBCmHHcH>HEE1Lx0ELD$(MD$AD$M'E  M9HUHB xIEu MAE HD$(dH+%( H8[]A\A]A^A_fHEE1LxEXMd@HEA@Lx 0DHEHLxEAzH !H=!HcHHHH(LxIHtBHPH@7HO!99MHEHM9 MHIHx0@\I $1A\HD$ I4$H|$ HEHR8F\HEHH(H4$HHtHHP 1AtHHp Ht@|:3Mt#ABIHx x<L1HLL$(L$HEA Lx(xDL踁H!8H!8HD$(dH+%(H8HE11[t]1A\A]A^A_隆f.VH!L$H8KL$:E<ArArLAML AD$M'Hp'x:fxISx AHB(H@HHx |x<rMt AB@,AD$@ILL$vL$HIeH@ 1ۀx lH!L MI$HH!HH I$ID$H3!H@XHfH LT$H !HQXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ QxI$fLT$HB I$ID$HB@I4$IG IT$H~H$HGH98H;FoHFH $H Mg H9HC x L`HH@t4HHLI$IL$@It$I yL9L$uL1L$L$f.AD$ AAI$AA HJ< aIT$@HEHHHEHx(HvE7HExH1!AD$M'PLL AgDLPAHzHtwwHUHBHE@&f11LHD\$L$XHEL$D\$@HEHHHEHx(H#@LT$D$HT$8D$LT$EHT$B] HBIT$HHT H)HMfHELT$D$Hx(VHULT$D$BD$eHUD$DLT$D$VD$LT$LeX)D$uD$ LLT$D$_HULT$D$H@HtHHp H=1LT$D\$}LT$D\$HHE11ɺILL$1L$DI$H@L$H9O1HLRgL$HtH8A1ɺiL褀L$HAD$tLL$(vL$H먾ILqL$IL׾IL$pAD$@L$HH9Hs 3@Hs I L$,vL$BlHH+HtE uHE_U ѩ@M tH0bfDHEH@(f.ID$I$H9hHB(Ht @1ҾH=DsIƹ H5CLG LIAvAvHUJ\HUJ\HUHt@HB8fHtU сA QHl$HE)HHx H&@\HEH8HHEG % =LHt$"5IH{L9tNHD$HPCu HH9Ps"HHLD$cHD$H{LD$HPL?ZHHT$HPH He HH9IEHHHtIH= HH0HEH+HHFHBHH2H= HvH4H7H2IHvIMHHE"QC <vDHHzt:gHDaHtH@wH*aHHtHC LCC fDHLGH@HD$VIH9HHHD$RLL$ GfD1Ҿ cIUL}HPHBLLLL$5TLL$ISnLL$\^f.DH= 8uSHHt^Ht$H<$P`YHH<$Ht$H 9tEH 8u HR 8twHH1H['ZfDH= [7PH<$Ht$H 9uHQ H 8t H ŜH uH1Lgff.AWAVAUATUSH(H- dH%(HD$1HEHHPHz Ht G#HR8L- H5HA]HDHL` H_ ILAE[LH=PEA]LEI@Hx H$E1E1 H5ch8\HHt.H8Ht&G  eA^Ht @LEI@Hx HE1E1 L%1L[HHtH8Ht G HU L-NL%ɛRDE1E1 L}[Ht H8HV HH9t G LkHMt;LGLEI@Hx HuLǾ T$ \T$ H@Hx 끐HD$dH+%(WH([]A\A]A^A_DH5H=EDc+gkH H3LH DHE\H$HEHPHA H5kH=}H CSDLǾ [H@Hx IfDLǾ [H@Hx fDkfH;Sf:H;L-) G E}% =Ht$"j/H\$ILE}L9AH  HƋ@@L="@IL9AH HƋ%@=@t@L%6HuL9vH LH=HAEzBTH H5H=H. OBHLwHXH\$IVH9AFIHƋ(WAVHAUATIUSH HF0HF( F f($B$fHa,f/fHnV^~=t5t)<$fI~f(f(fTf.f(T$BHT$f,fHnf/^ $f(fTofInf.PHɘf(T$fHn5BT$f $D,f/^f(fTfInf.yAWAVAUATIUHSHdH%(H$1 L-S MuIH9XH fDH]H9OӋDDtۀ(NH9s+H @HH9tUDDtL=C IP8уuuIHtR@ tLH9CH$dH+%(HH1[]A\A]A^A_KfDAWu H @:uH }%@=@IH@ EH  HDH HÉу\A]A^f. OHfDk0I< 9KAWAVAUATIUSHG tIH!H@8u91H=>VHL[H] A\A]A^A_UI$Il$L~8HLpIL9sz@DeEEA A A 1A\E6HO!8>Ho!Ic@MHD#HI9wvHH[]A\A]A^A_DH!8H!!Ic@]EAM-HAfDSA GA\nHfDKHI9vI9 I9x..C.HfCb@A\rHfDCHt$3Ht$IAIDB@[\fHf{qfD\0HfSYfDHt$F3Ht$IIcIDB@AT$HaA@^@HDFHDcD\\HfKff.HhdH%(HD$X1Ht$bHH!H8HtPO fftXHa!H H5o 1\7HD$XdH+%(u=HhH5j 1-7HT$>HT$HAf.AUIATUHSHH!L MI$HHC!HH!I$HID$HCHthHfHHS@I$ID$MuHt Hn/ILHL-DHL[]A\A]C,It t5fAUIATUHSHH!L Mt}I$HHg!HH$!I$HID$HCHtTHfHHLHSL@I$ID$fCHL[]A\A]{+IfD 4f.HH!HHtAHH H!HHP@H"HH!Hp:u"HDD$*D$DH!!:tHE11ɺt1HD$RHD$@SHHH]!HHtEHH H!HHPHXHHH0!Hp:uH[fK*fH!:tHE11ɺt1HD$;RHD$@HyWHH!HHtLHH H_!HHPHxHHH!Hp:u.Hf?H|$)H|$H!:tHE11ɺt1HD$QHD$@ATSHHG H@Gt5HH@t)H! HHpEIHuH{`KH[HA\$@ u&uHL[A\fDI|$H;{tLLKu AD$ IH!H_!AUIATUSH HpjE11ɺyIH1L@HyrPCI$@HX@I$Lh0HI$HHB8HL[]A\A]ff.fATSHHiHsIH$I$H@I$IT$H@AD$ %DAD$ H{!8uHL[A\H!8tE11ɺt1LOff.AUATIUHSHG < FH!E1E11<LHBL` I$HZ{ (HtHH!HH\HHHW!HL-!HH HCIEXH2HHIUXHHHH@HH@HH@HH@ c ?CHCI<$H.I<$tHHKHBHHBI$HI$HHpHSHHpH,H[]A\A]@<>HHHpH;p|HH-HHpfD} I,$I1r%H( .ATIUHG tBtot=ufHoHHAL$ uv.uHL]A\DH5b 1H1H=ob1xEATISHW %!=uHHHtL`H[A\fDvwH|$$=H|$HHuH!E1E11wH@@HfAUATUHSH(dH%(HD$G  Ht$ +IċE H&! ;t1uMLl$HD$dH+%(H(L[]A\A]fDtHt$LL 9IuQHD$Ht$LL8Ht$HHIHLgHRHT$FwH;Ht$HD$HtLhIt:;1Ht$LLi8I9HHH=`L^H@(Ht$HKHxL(LL$8I7f.HtG u=@1DHH|$H|$H=@AU@ATAIUHSHdH%(HD$1NBHH E % =H"H/Eu U u_H$L9LHNMy I1HHHCHSƒྃ@EEˆCHD$dH+%(H[]A\A]@H A!H A8u utKHUBtAHHBt5H4$HH6HHD$VHEH@H$HE,HpfDH@H5AWAVAUATUSHHW uFHIIIMH<Hh(HH!8HEHuL}H]H[]A\A]A^A_HUHk]fH*H9I)jfI*YHH)QfH*HH)fH*HfH*YYYYXXXX/BHUHEHU1AD$ @I|$H4&5L9LHH=]L[vw18IEHH!E1E11wLH@;IEH@IEHh(Hu@!2HIEHh(RH9sDHUHEL}HUH]Tf\\YYXX/w HEHUHEL}H]H[]A\A]A^A_LH)fH*H)*fH*HfH*Y(YYXXMfI*H9U\\YYYXX/YuHHfHH H*XLAfHL H*XH΃fHH H*XfLAfHL H*XCHHfHH H*XHfHH H*Xf.HHfHH H*XHуfHH H*Xf.HʃfHH H*XfMAWIAVIAUIATMULSHHW L!A%!=tkHD$PL1E1E1I<IH)AL9ۺHD$PFEtI9t ;t EH[]A\A]A^A_@tHHHP(HLM9HJL9M99HHI9rHBLHD$PHH|$PLH)HH)LH|$@XH|$E11L!HD$PAAI5LIH)!HIAfHHHtH|$PLHH)H)LH|$hVH|$E11L!HD$P#DL9H9v HBHHD$PHrLMH)I)LH|$PLLHB/HH|$PLLHH)-HD$PAH9@H)HD$PEI9LHH=VLTHrMH)I)L`H|$PLL)LHCHEHMHPLrL9L;pTLpN4IIm HHx( @HHZH!!8JH!8:E11ɺt1HL#! HCC H"S HE11ɺIH"HHx( #f.fxIS|E1|:|:HCALp MsL@bHS fHHx(~AzHA(Hm@cHHx Ux<KA@+HE}HBDCI} H6N4I>HwwN4I>HwwfLH%HMHELHHMHE( dWHuHWH)%H{C "QAUATIUSHHG @Ct H@PIl$E uc E E1HHMCHMtAuAuE@uMHL[]A\A]<tHM L)E wD~HHt6H HL[]A\A] AD$ HECHeUHCHuTfL8H=51H=:1BH=#:1@ATUHSHDgG EC tAE H7HHEHRHPC % E Hc H@CH|oEHE{ HCuHCHHDcE HMuHHfDE E1E fDB2U HUH fH*fW%HB(HEHH fH] E C(f/f/ .2U C(f/$ 2E C(SHC HUHB HfH*f.B(EфHfDH{] HEHpjHfHH H*XH0U H$2E HHC qHHfHH H*X5 2E HC ;ATUHSHW dH%(HD$1 t {tFHE@tHHBt g1DHT$dH+%(uH[]A\%@@=@@tI%= t;z)tH1HELeHpHLi ƒS1 Gu t H譾DLP fDHEHHH1yBtBHU HHEWLe E<H8U uHA! HHpHHP tHEH9Aaл% =HfHHHE tkHEH@ fDH$t/HH9vhH1 @HHtHt1DHH@ @HHEwfG % =tHH@ AWAVAUATUSHDL$B HG zF Ht$kL5!IIMI. Hʑ!L\$HHHH,!H;H!HH+ HHH&!HH)H(L]H(H]LeIc}HIHct$LHEH='HEI.IH+HtqE oHH+Ŋ!HHkE tKtHEA@t'HH@t1HA fE1AD$ % =tDL/AEH!HE!IHH9*-HD[]A\A]A^A_I$H@ fDϐHEHH@AHrHfHE80AYfDHEHx AAfDL\$.fHHL\$L\$H0fDH@H;-I!AH= +1zf.ATUHSHW dH%(HD$1 t {tFHE@tHHBt g1DHT$dH+%( H[]A\%@@=@@tI%= t;ocZ) tH1HELeHpHLƒ3HK1 @u tHƸfDLh#fDHEHHH)yBtBHU H HEOLe =4HXU uHa! HHpHHP tHEH9Aaл% =tVH fDt+HEH@ .fDH$fDHxt1DHH@ @HE*f.SHHHtHcHx>H[DHt[B uax}t8HH@ HyHH9tHH?H9~11H@H1[HHT$HT$B f%=t1HHyHH@ ATUHSHW dH%(HD$1 %@@=@@tr%= )tHfHEH@HtxBtBH0Hwu{U uCщЁP%@tdHEH@ $fH*fHE@(HD$dH+%(H[]A\f.H8x% uHEHH fH*@(E tHE@(HX H9&M "HUB(BfLeu NHD$dH+%(HL[]A\fHHƒfHH H*XfHU HMAtnHH@tb H ! HHpLHt3P t HMH9Ht%ѻ H(HMHHȃfHH H*Xf@W%=uQ҃ wF @HUHU_U HEU HX H[!8[]A\DuH!H8G f%f=H5!%L$1HLH= H1fDHCE M>E fDHU 8H!!8F[HE1]1ɺt1A\~IbfDUH#E@u]H]ff.@ATIUHHHy"1HEM L` H]A\@H]A\ff.UHcE@u]H]Off.@ATIUHHHHHL]A\@ATIUHHt%HHH*HL]A\AD$@tLאATIUHH:HHHL]A\@ATUHHG <w%H J*HcH>@%=HUB(U %_E uz"E H!8uxH]A\þHD$HUD$뭐0HUHUE fDD$E D$Ff.HHE vH|!8xHHE11]t1A\EHv!H8G f%f=t.H!%L$1HLH=qH1IUHE@u]H]ff.@ATIHD$hD$HHLA\ATUHhdH%(HD$X1Ht`G HKLgAD$tWI$H@tJHsz! HpHt#HD$XdH+%(Hh]A\@Le@1HLHCE 0 30 >< @<H}-HHAHw"HHʃHAHvH0H w@PHH0H vHULBJ H9HHH9_H%fD:0HHH9})pHǍVHH0PH vǃHAH{fDHUHJ HH9}_M M HB 'Ѓ%H u %_E E HEH@  _T@ HE H߉M )H8M HU@HUB(f/% +f/_U umX%HE"U @(1E !HE HD$XdH+%(HhHH]A\HD$rU D$w@HUu LBMHuL9JsLHHULBILBHEHUHpHHH9?DPHPH9ErH0H 1FшD1ҹLuHE TH}HD$XdH+%(XHhH]A\HD$XdH+%(Tff(fT f. D7H5.D$E D$ @ RHt$H蹣H5 H1*VHtG u @HH|$H|$H@H;ATUHHG toLgAD$t7I$H@t*Ht! HpHLe1H.LHE 0 *< &@u6 HEH@ U %_E XE |HEH}1Hp-]UHE <@HUHJ xHQHWHMH!i!8iE11ɺt1HPLHH1趶IyHLH=< 1%DAVAUATUSHdH%(HD$Hg!HH9&G HH t;H$t ptHHE  un<tj tZ7LMMQME Huf E MAHD$dH+%(HL[]A\A]A^fDHULBHtJ4uH9rsHHEL@HsuI9qsHE LMuE1vIL3E Ht HUHZHީuH9ZsH@L$-LELLKLHHL H HH)I9LHu{HoHHHƃyHGIIHIHM)HIIH I)I)L كH H)I9Ht1fDHHH?HΨuIL@IHIHL!IH8HL9sHJL@ H)LZLvHM9AH IBHD1H~fH9w)fH9tHHyE  U MAHJ4I9qrA1H9v8HHH9uLvItLI9q MHwMMaHEH@HEHHHBH9s>fDHHH9t)y?HʀQQE LM<IygHHt`wHHHtHSxE LMaH@HHpH9oHH#0tHNHyHeH(LMJ< J/fAUIATIUG t  tWuP1LHH11HE % M~1L=tRH]A\A]UDtLtfDЃ vLtxHEH@IEHE]A\A]f.11=HEAD$ fSHG uH1Ҿ@c [1虭AVAUIATIUHSHdH%(HD$G HIAD$ @ ǀH$Jt*u I$H9ps L/H$I|$L9HDHLHI$LhI$IT$H@AD$ %DAD$ H7g!8t AD$@:HD$dH+%(3H[]A\A]A^ÐǀF ;@IU1LI$HPH$>fH$Nt-Jtju I$H9ps L9H$ID$HL9rCfDHHI9t)Ey?HHȀBJI9uID$I $H)HQHLwHRH$N@H`!8E11ɺt1LDL`fDATUSH dH%(HD$1HF IH% =Ht$ HH@}@C t!HIg!H@8Ɂ@@HT$LڷtAD$@uZHD$dH+%(uTH []A\ÐHHvH@HD$@AD$ wLHt$]Ht$`LHAUAATIHUHֿDHL]HA\A]0UH1SHHdH11hHH@HEHCH[]fAWAVAUATUSHH $HH $HHT$HHdH%(H$ G t1H@\C <H|$C %_DC HD$HH@HkHe!H ]`!H9}L%e!I$B HHxHD$Hf.H H7t1H$ dH+%( H []A\A]A^A_K AHDžHD$HE1D$7HD$ HL$L$ 1LH#D$LD$HT$HHt9HHxH9w-Ht$ H)H{LD$HT$HT$LD$HD$IH$[HT$HH LH辺IM~ B1MLD$IIH|$D$*LHD$LD$,HD$HD$8HHL$8H9H^HCWH0I<$G ! t苰 I<$G % =Ht$H"}HD$ HD$HHHL$ Ddf.MIAFA8tM9s HuMM)fDHpC  11HHt$1H߹" HD$HC %_DC HfDH]HA EHD$7HD$ WH2A HD$HHD$ D$72 \%_HDC !Ht$PED$h%=HHH$Ht$H 2H9Ht2H)Cu HH9pHsD% = Ht$HqHD$ HD$HH芻Ht$HD$IHIUHt$8H@HH)H9OH|$HH9„t IP]MHL$IOHtC5HD$H9#HL|$L{^IMBH|$H;AIMPMwAD8GLALLT$өLT$HL)LLHPHT$(~HT$(LT$M<MI)HT$HHvLH+CH9fHt$ LLD$H))LD$DHT$LHLAHLH+KHH|$7@H tHHHD$fDLLLLT$LT$O<.O*E1H|$LLH3HL+{WHL{AxHIIA%HL+{Kt=LxCu HH9psHLD$TLD$HSLD2LzHT$HE8HDHL+{HL$LxHCH@HtunHt$H9sHLD$LD$Ll$L{HD$LLLLD$LD$MME1fHT$HMMHt$HzG % =tiLI$H~B OD$7HD$8 HH@HD$HHOHL$ vD$7E1HD$HD$8HH@ HH)HBILHHL$IHzG % =IHD$ItCHH9pLCLD$LHLT$LLD$诳HIMLD$LT$… ˆT$71MHt$HIIH 0HJAHH9p`HlV!L M1I$HH [!HI$ID$ L1HL11L"HL|$LHLxF衺HL;xsHLT$LT$IK8MIzD\$7L1H|$8E1H9PE3L$L9r)IL9A$H a!L L$L9sM9IM)H|$8H)E1HL)H)IHD$ItLCHH9pLCLD$LHLT$ K48LD$(HL$D\$ƱLD$(H5LT$ ID\$K4 HL$K8M9 M9M)MD\$7M)UHLT$ HL$D\$$D\$HL$LT$ INIHLEIEHXIEH@AM DHD$(dH+%(H0L[]A\A]A^fD1HL$AH8]"D` H5DHcH>fQD3$\QD3$XQD3$TQD3$PQD3$LQD3$HQD3$DQD3$@QD3$<QD3$8Q D3$4Q D3$0Q D3$,Q D3$(Q D3$$QD3$ QD3$QD3$QD3$QD3$QD3$ QD3$QD3$D3d$I@AH|$IcDHIEIEHXIEH@AM D00fHT$ Ht$HD$ H|$HcH\$貝uEt9_I|H\$1AHcfDIcAH!["DIEHAI)LHBH8HzHRIDH3IH HHHL1H1I HIHL1HL3QH1H I9uLuKc L>AHH0H AHH(H AHH H AHHH AHHH AHHH AH H1IH H L1HHHHH1I HH1M:H HL1L1HH HHH1H H1HHH>HH1H H1HH HHH1H HH1HHHHH1H1H HHHH IH1I1IHHI1H I1I1LH A1o1eAvP$IHiz3p(DI)N Dg+7AA HA)1AAADD)D1I9wIpLQE1HHHM9IGH<AIGHAt+H|1 DDDtUtJtW4)111 1A) A)1AA1`w727ff.ATAUHHHDH]A\6fDHN"SHGHHtEHH HPS"HHPH@HHpHc HXH [蛪fAWAVAUATUSHHHN"H8H_T"AHO"L=dL(HH(2H:uEf.S H HH9ZHEtHEHP Ht̋HM}MeIEHx0Ht @pH@0IEHxPxIEHx`kIEHxp^HL"L9(u HAE I}OHuHOH)I}QIU<PHRHFAE 1A %MA AE I1H G"EIJ4H0J@IINHBHqHpHrL,Mf.IHPHx HwHJHHL,fDI}t|DMIH%H5 HAG yx,9I9AW fAI}LpuI}HvA YM`E1VDI?`hHD$dH+%(H([]A\A]A^A_M`IA f.LFEe A L$ IEHxLIEHx HoLb%P=P=HR=HLIEH@IEHPgH&L"L9(IEAE@t HPHHx M)AE XE1IUBHIEHx Ht IEHx(HLc艽MAE E1^HHo?"HHB@HPHzHtwwIEH@@HyH"H HIEH@@HHBHz ML,AF XME1HRIEHPH@ML,żAF ME1茧肧IEH@@e ATIG GtHH+k<"HHvUH;=fI"tLL謜AD$u1AD$ AD$ uH>"HI$L H.C"H(A\AD$%AD$ A\fuHA":u˩tHH+;"HHv6H;=H"t-裩tLH51A\7AD$pfHtwvw3AUATUSHH@"H)H"L ME1fAD$I\$H@I,H9vRfC =t6St/H P="H9tH $@"H9t C t*SAHH9wM$$MuHIc[]A\A]þHsH1[]A\A]@HGHH,A"UHH9:t,H\E"H9:t OW q wvv=u]DHxHtGtH@wv"wufDH]פʤuDAWAVAUATUSHL%F"H-<"M4$EMAFI^H@M,I9w qHI9vgC =ttKtH{Gt׉HCC wHwI9wf.M6MlM4$MCAFI^H@M,I9wfDHI9C =t%= u݋StHCHt̓SH8Ht GHx(Ht GHx Ht G/HxHt GDs^HsI9jDM6M,M4$M[AFI^H@M,I9w AHI9v7C =t%= uStHHNI9wfM6MuL5B"M<$L-f>"MMf.AGI_H@M$I9wfDHI9vwC =ttCtIEHtHPHt@ MtIPHtA@ H1HMI9wM?MTIMA@ HI}IEHtG ApApEH[]A\A]A^A_DH;ZPfH;ZH@ w4wHCDH@wwsHʠDHwwHC)fDH@(wwHCDHXc HC LLD$LD$)I}IEHG  ӟHC{ş軟HC=譟HCBL5?"L-v;"ML膟! LD$LD$ff. AWIAVAUATUSHHHkHAIHAHH+HED9uHEAuL9uHUHHtH@ HtHLH}(Ht'E."HC HE0HCH%HHHC0HwXHU0HC8HHHHwXHHE0HsHHHH=HCHHwHM0HK0HCPHc/"HC@HAHK0HAHK0HA HK0HA(H +"HBHB Hz(HKHBH7"HSXHSHHBHSHHBHSHHB HSHHB(H -"HH[]  ܐH@ 輐H@HsHtH@HÐG t3SHV՟HtHtHPHH@([fD1[@1ff.fAWAVAUATUSH(dH%(HD$1H9HIH.] AD$ DDE<AE1t!%=ILu] AD$ HUHUID$Ht@HEAU %_E O0D E MtAvAvHD$dH+%( H([]A\A]A^A_E AA H5DHcH>fDWHEA"HEAD$E8IT$% HUADAjAF %_E HD$dH+%( H(H[]A\A]A^A_Ӭt] DfDH訬E HT$ q] T$ DDH%"L`El$ A t  D%=fA ] DE9_1H6}] fDHD$dH+%( H(HL[]A\A]A^A_ tAvEl$ A AFBA8D%R=A~HH}Ht?HEHxt t$ 踤HEt$ H@HEH@] %_E ID$Ht@ u HEAD$ LץH*"8H %"8HD$dH+%( H(HE11[t]1A\A]A^A_鹪fAT$ H襋] El$ T$ DfDEl$ AAEAFf%_E i E I$HEHR HP AD$ M f.El$ AAAFI$HEB(@(U %_E "E AT$ T$ T$ DfD=u'ApAfD%= SA@I$LpLx%_DE u8D%=D%=uI[fAD$ PP>AQMI!LL)HOK6L9I$ID$HJ|H}Ht0HEHxtE H _MzI$ID$HRDID$HEHELxHELpM @A t/I$HEB(@(D%=ue AE A3 Ht$LA Dm ]HHCDD$V1H]M #LH蕯DHD$dH+%(H(L[]A\A]A^A_6fDA5H #@à :MD$A@ < HAmHD$dH+%(]H(LH[]A\A]A^A_9fà ,ArH55 1l.@Ht$ t$ A0ځ_U D%3 ЉE AtI$HEHR HP A I$HEB(@(fLHvA%_E oHebLHխDI$HEHR HP E Ey DDD%=zAŃ jH LH趃AŃ A HD$dH+%(}DLH(H[]A\A]A^A_{fDAD%= ] D@T$ f.Ivu HEH9psH蒖It$H}LHELpHEHUH@4@H}HEHtHxt+HEIT$HUH@HELpM PH芣E D% ="Ht$Lg] HT$IHu HEH9PsHH豕HD$HPH}LA eHEHT$HPE %_D DE HE`\H] LwHH9HEH@ HcPH|:H}tHuH@huH{_HEhLT$ hEl$ T$ EEl$ LL)HOK6L9AA|$xMoH}HEHtHxtmJHEIT$HUI$HRHPI$HEHRHPe AD$ _AT$ ID$I$H@I$H@Ad$ fD%=I9HD$dH+%(DL HU $DIvLDLL)HOK6L9I9IwdHUH9rrZH蘠E I$Mt$HPHT$'H}H_ID$H@ID$ IT$AD$ I$H@DH}H";HEIvH9pfzx:pHELh MLs@H}PH{•HEHx AEIEHx x<1HLɜ|:GHuHGH)ǁH}] HEHPHсHtH !"Hx(H H9y(t HPHEHHDHJrH@qH{HEHx HIGHuHGH)lj%]H}DE kLH9L豞WHuHWH)%H}E HqH@gqGHuHGH)lj%]H}DE mff.H5"髀ff.H"Hp0釀@uHh"Hp0bfH5Q"Off.@UH.E@u]fDH]ATUHSHC"L MI$HH"HI$LHID$H}""HHyH8H"H;8}OH0"HL$LAL$ []A\G lAcb@tIvcHff.ATG I< w=wHtzI|$G tbI|$G I< vuLA\DuHGHt H@HuSI$H=3Hp 1ؔL>pHt;P w/H@Ht&H@HtIxH= "H561~AD$ uLH=а1eL|IATUSHG H=tr@uJH3"L MtKI$HH"HI$HLID$}L[]A\é ttafsIfDH51E1躆E1ff.ATUSHdH%(HD$1H;HcwHD7 Houv茴HCIHhHHcSHPI$H@AD$ D0DAT$ HcKD DAD$ HD$dH+%(HL[]A\ÐHIHcCDtAL$ H4$H1HIj_H$LHAL$ wHD$dH+%(ujHH[]A\lf.H9"L Mt1I$HH"HI$ID$f;qI!AToIH["HHzH8H"H;8}%H"HL$LAL$ A\kHfDHHG H"HHH9H;5 "@@ulHAHH=w\HAHxPHcHHH 7Ht7H)HHu$@HHtH9PuHx驉fHH9u1@AWAVAUATUSH(HHIIAքHT"HH9HH;5="G ff-H HcH>fffv.fH,!p E"T@E1H(L[]A\A]A^A_G ffwf(v(fffwH5 HcH>fwrfvfff xH5HcH>@f@fJHW ?fH0E"A%f%f HHHuf&H}(@fff7HHrfH](HH1B f%f@fB"tHu4HB!@Ht"ALLH([]A\A]A^A_eDLLHMHt C!@H[Hu E" H#"H@ L9`H=IH([]A\A]A^A_HRHLB f%fHB(@ f f=f%Pff= f  f= f=b 1Ʉ H}(G f%f H"H9(H}(Ht HGL9 HHx(AE111Ҿ$H([]A\A]A^A_HUtH9"HL9$D@AE11ɾ$1@H}(G f%f` H(HEHHx(7cHGL9 "QDHWfE"@H}"H8HGHH+ H=AI9HUHHd"HL9$*f.H=iHlH@H=ҧL9 NH"Lu0H9* Lm(AU fJfEft fIu(N ffLV(MIJfu Ly(MMt!AV E1fff f f%f=[ LLIH+ AE IUf%f c %f=T AE11LGE"HU(B f%f=f 1HRAE11ɾ@RIME f%f=W H"%L$E1A11H LL`LkE1LI11L`1ɺLH55cH](E"@-C f%ftAfH{C!@HC@!@2HXAwE#0<0HUH "HL9$oLm(Mt9IEHx(HGHu#1vHL9 LE#A11Ҿ$LtCH& "HUHHfDHHȃ0H %H0HAE1E1H H9l$HD$E11AMH "H J,HELHHT$fHT$HImE RHoH0 "HL$M2AD$ "%Eu H"L`0j11E1jE1LHrZYH\ %AE11LLJ@HHȃ0H H0BHE1E1E1f.HNHCE1L~E1HHȃ0H H0THbEHFAH1E1HD$A@xMt I9H@E1LvE1HsDAXDAE1FHUH}"HHE@E E(jHE1E1jHt$112^_HL9`HL$E1L%AL1xH@HIv(Ht$F EtzAG {E D\$LT$f%f=BI~(tD\$LT$HEtH1LD\$LT$nH#L9 LT$D\$E f%f=LT$I~(EvtLT$HIIUA1L׾@Mv(MAV AfHA"HUHH<@E11LLL IUAI1ɾ@LLLLT$LT$HHIUAE1L׾%T@LHLT$HT$DL$ZDL$HT$HLT$H)AE1LL%Hx(HUAE1%HoIE1SLy EHHHEIEIH8;A1L@LfMIBL E%LD$A1L@L+Ht$1HkHL9 D\$H=PjLT$Iv(HHD$lD\$LT$E11LHTkHNqLT$IaIUHL$E1LA%cjE1E11jHt$1LB~AXAYHL9`LT$D\$LcqIZAE1LL%LAM1L@LHD$E111ATUHHL%"dH%(HD$1H$I<$HFG f!fE ffD_f|H5"%LL$HH!H8I<$H1HIHt}AA11H HRL$MuiDLiH5J")1LLd_fDLpL$Ht!H !H8qDL$MtH!L`0H5"L)1H _dHD$dH+%(H]A\H"Hx,L@ AH!LL$L`0fG# LL$H:VDkInAWAVAUA1ATIUHSHHdH%(HD$8G t AtdH]C <ZH"HB;U с߁ EщU Mt HH@I$H["@@Mt HEH@I$H]HD$8dH+%(NHHH[]A\A]A^A_@H H AVA SHH ! HHpKuIH/H]HCtARE@HINULLfD@@F@MtI,$ Lk+DAA<HEDH|$ LD$Hp HXuLl$II)HEIuH9p{H]HLLLhM @H+]MtI$HEHXfEE fD >+tbC f<LmfAE(IEf.HfHE0HXf0bfD1HYHIYICHH iMAH $H@tFHHB Ht:z]Hnf.gI}IƋ$uH]L-!AE8@L-!IEHt @8L-!AELmE1AE(AHH ڐH~qMtk H=A׋$AnC P tHCI9Ft9I^MtIH@I$AV E ߁ DE DLL"AV HȾHfDHaBH1KHNj@ % ="1H9fDH7H@HH%HtH>?븐cH@H߉HljTuDHzHs@Hc@H>S@H>CH7VH|$dIHBMH|$G HGAWHAVAUATUSH(G DJA9+HAM1L}AH JcH>fA&fDE1E9\EE J 0D E AH5ݙJcH>H Y!JHHJHEHH@A H@AH@H@ E % @E A<HEIWHPHEIH;tH!CJ LHJH([]A\A]A^A_f17HwfA(E1A0D E L AzA:ABLD$L$Hc\LD$L$HHuKtXCAR8s)ЉHHcHI4H^HttDfD f.AfALEE LEHiA0HSAA9DBE E1EJ fDDDH=#1i@E1C v1HyKDLH="H1bifHEHEHEH([]A\A]A^A_ÐHEHEHEH([]A\A]A^A_ÐHEH !EJ4HHJAt ABH)-H@H@ EH@H@U %_E u{ E fDHHzHHHDHD H)HH)HHH~HHHDHH) 1H@fDH@oE uFDB4DL $HL$LrPHL$L $@ L$H=H1EM IH@!H884ID$HUL$H@ Ht@HHEH@@<4f.0E1AeDF\B4DHL$LT$LLD$L $OHL$LT$LD$L $HDD D1fTLH= 1f@ATUHSG H&<HLCHP1HHH9vTH@HHHDH9HCHtxHHEHH9HBMtZLHZL#ILCIl$[L]A\H8mHLCHPH9wHH+HH HlMbH`HsL#IHtIT$HtHUIf.HNHLCHP1=C 1Hl~ff.AUATUSHHG HHo%PHJLb{ =u HHt$HBHTH[]A\A]DE1HCHBHH@t%c EtHH}[]A\A]ffDIt$Cu HH9psH4^H{LHTHL`HHSH@DAhDE1HSAWAVAUATUSHG HAt < tE Áu]t2DA tDH[]A\A]A^A_f.HDH[]A\A]A^A_;A 1蟄IHELxH@AJHEE A %% ؉E IEHEAE AuM}0 AE AuH[]A\A]A^A_DVHZH!HHV[]A\A]A^A_6HEHx!ʃHUIHHRHPHEH@HUIEHHHEHHUIEHRHP} L}M@AVMA%E1E H^<@HEHtIHu:Hxt3HEHx(Ht&Gt HHB HtR</4>@H;HEHx(HtHZHEH@(HEH`HEHx Ht|cE €U < iEE _U :H@!H;(tHd!H;(rHf%E HEHuL`Ht$IT$HH$[Ht$H$HHt=B L8eHEHEA HPHIEHHHPE DT1/H8蟁IHL[]A\A]A^A_K1LHIMe HHgfHIFH%gHi!HC8Ht@HHS8HUooJHoR P HKHHUH HSHHEE G0HH83fDUHSHG uteH!HH9tEp3=_U H[]ft/%=tH] ww17] H[]H1H=<^Ѓ kHH5~ 1[]X,*E $fDHH[]jef.H[]IDAWAVAUATUSH(dH%(H$1Ht z Ht)H$dH+%(rH([]A\A]A^A_IHL:ItH|$1 H|$HI4H$I9sA$A|$-HLIAɃH\$A)уI9H<LLL,AW1ۅHUHcLtuHHf.<v|I$HxtqtLTKHuEILLLBNt`H@H[]A\A]A^A_fAL$ H[]A\A]A^A_EILtLLMH@'H=s1RHtWAUATUHHxwIHrI.HLHB(I$HhH!AL$ D8u]A\A]fDH!8t]LE1A\1ɺt1A]YHH=Qs1RfH!AVAUIATUHSL MI$HH!HL5`!I$HID$IFHHfHHLIVL@I$ID$HA \$ t+H!HHyH8H!!H;8}$H!HL$[L]AL$HHL\$PH`EHT$HLLT$hDL$`L\$X2L\$XDL$`HD$@LT$h,HT$LIwE1H+t$ LDL$hL\$`LT$XrLT$XL\$`HD$@DL$hH|$@LDL$PL\$Hl2|$L\$HHD$8DL$PtaLLDL$HL\$@;2L\$@DL$HIhHLT$PDL$HL\$@q*L\$@DL$HLT$PHT$H|$@E1LI+wDL$PL\$H蜍L\$HDL$PII@ff.AWMAVIAUATIUSHHH|$Ht$L $dH%(H$1 uH[H$@ nHG"H@8D$HL$L$HD$ $Ll$$8YL$HSp HtlHL$Hހ$KIM9r$8y>L9l$v7f1H$dH+%(yH[]A\A]A^A_DLl$LS`KDI9rM9rH9"Ll$pD$8`t$8HSxL1L)HRXHt$0HHOLH9cLt$HtwwHpH$Ht@HH$HT$HHL$@@H$LT$(ALT$(HL$@HHT$HHBXHpHr`@BhH"HH- H5"H6Ht'~ Lk"A<wHBH@8HBHt@H$L$HT$(LHL$HLT$@HT$(H c"H"H="H LT$@H0HL$(HHL$HHr H7uMHB0H$H$HǁHǁH)HH$fHHB0HHB8HHB@HHBHHHB(uf.HSxL1H)HRXHt$0HHOLH9-L$fH LT$@HHD$(r.C8x-LT$@HHT$ Hxv1M92 AƒttHT$ H " HIHM9ALL)H9vM@HfDM9A@I2H$LCH9H(H$L/DHwH "HHH9YHH9wL@HL$pfDH$LL}H|D$ILLhXH\$ _fD`HT$HHL$@LT$( *HT$HLT$(H "HHL$@@HB HD$@HHHSxHB HD$@%H򉃈qfH|$`H$HH)HHT$pf.D|$E`HD$@HHBR(HD$ H)IHD$0@LHA HD$@HHHCxH@ HD$@l@H<$GfM}D$HHSxHBHD$@HLLD$PLD$PHMH$LLI2H$HLHH$H9+H "3D1IL9LBMLT$(.LT$(HUL9rfDIAL9ttA?XH=S15H $A DtHA@tHH@%H<$ 1HM,6LL)HyLL#HHI9 H5"HHI9sLL9HD$0oHL|$@LZIL|$@LEIHB@HLi8L;l$0Ht$ L.MMtMAUHϽ"<)t9<8t5L)ր$HH$LHH$!ILHLHL$UmHWxH$HHH)HHt$pHt$txHAHHD$@HHB0HD$ HHCxH@HD$@"HT$HHL$@LT$(HT$HHL$@L"LT$(IHpHtHA@HHD$@Li8|MH!AHUHt$x"LLT$ $LT$ IIELD$xx(MLT$@M)IML9HIPLHL$ LD$0*HL$ LT$@JM9|$<LD$0uwLLLLT$ *LT$ HSxLL)HB0n9%H1 HSxHBHHD$@Lj8%I8H+ DHKxsMMtK LLHLT$ kLT$ IMyI_IEM}H@HD$xHyHt>LiHHyH|$uHLT$ HKxLT$ OHLT$ U HKxLT$ H=I1/I@H1DT$EPjHff. HuH@HtzLP0MtqHu8H@ 1҃P@HtpvUpHD1HÐj11E1jAL0ZYHHf.1DHfUHSH} H?uHHtOH0HtF!} HEt'H@ ?H1H@HHʀ[]f.H@f.H1[]ATUS L'uMd$MIl$0H1HHtyHPLBHHz H~?E$1A A9| HcLvI$J4H~tH>uHH9u΅tHx[]A\% DutfD[1]A\fփ@u@ƀt f.PH=M1-ff. HuH@HtjHP0HtauyATUHH@ 11P@HxHGu9HL`IuvFuHL]A\A"H"H@)LcIfHHx"@HXH=oL1,AWAVAUATUSH L/uMmL%"M4$MGII$H5"HH-"IH IFHEXHHHUXIHIH@IH@IH@IH@ AF IF% @AF MIm0HHD1HVIHIBHxHHp H~BE1DA9|#HcL IIJ Hyt H9HH9u̅tIzIIvHJLyL9L;zLzN"HH;H94HH)H9 H9"H H8QH[@H=71f.HH=671ff.@AWAVIAULcATUS8HIHҠ"H(H^HUHHp"HL=-"HEH HEIGXH2HIWXHEHHEH@HEH@HEH@HEH@ E HE% @AE I,$u e I,$۸HOÉƃHcI$H"HHH@ HI$HH@AEAD$$ID$(KDmID$MlID$IAD$ LL꾫HID$HL[]A\A]A^A_fDH( ff.@1DAWIvb'vb'vAVAUATUSHL%ͣ"M4$Mcn$CDmHcHCL9wsH@I~H4H6I $IFHL)i$L9wHH@HIEH4@HH4HAH<I$@ H[]A\A]A^A_DAUATUSHH{"H-ܢ"Hc;Ut,Hm"HJ H " H[]A\A]fDRAAAAIcHH>u$L-%"HI}PDeHcIE[ff.AUATUSHL-ۡ"L% "I}I,$H)HDmHcHcHHH_"IEHHI$HH[]A\A]fATUH-"SUHcH [H9HH?HHcHH9~69?HsHH=u-L%"HI<$a]I$[]A\DHcH=D31DH"8H"+8uDAUH~ATIUSHH-1"HMH~ HHHH)I9~ DJ\"HH=uL-"H4I} H]IEHL[]A\A]@ATH"UH-K"SHs"L HUHL9~+HHH|Htwg vwL9[]A\@+HUHfH }"H"IHcLc HJLLHpHPHƥ"99|D)!ATUHSHHGH0HHF FE.H_H"H+HHHH H"HHH@H} v%HUHztHƺHHD$`uHD$H[]A\f1HXH3F dL% "A$H;A$H3H;2fD^fDH7HtFvfDUHH?H3]HOff.@HH?,ff.H7+ff.@AH"H"IHc HHHLpD@H@6Hϣ":9|fD))fAWAVAUATUSHH HwC HjHjHHLh(MtCAEtxH"9HV9|fD)A H M"Hv"AHcLc HJLDHpHPH"99|D) HcL"H#"IcHHHIHIIH ʺ9u#H<"H9B< LQA89| 1HA&D)q H }"H"Hc1HHH4H>HxHН"9HHHV9|)! H -"HV"Hc1HHH4H>HxH"9HH HV9|) 7Lۓ"H"IcHIHH ʺIID9u$HAH"H9B< A89|!1H%fD)Q H7LZ"H"IcHIHH ʺIII9u#HAH"H9B< A89| H1H-D) UHSHHԒ"HE"HcH; CH"p3HuH H4HcH p3H,HcHH H(H[]^ HcfHH?)ff.HH?0ff.HH?,|ff.H "H&"Hc1HHHH5"H6H4LA@H6HzxH:"H2H5@"HB5H69Hr9| )y fHH?#ff.HH?2ff.H="Hf"IHcHcHHHʃL8H"Hr9|Ð)ffH"HLHL)Ɓ` HHHH!HH9u5H"Hϑ"HHc0HHH 8H"9|$HHL1H=&h )9fHtGL4"H ]"H"McH J H1HyAyQHA9A89@)fAVAUATUHSHHdH%(HD$F  H"H%L$$IŋE DMt$ݩ LADCHMB LLH Q"Hz"Hc1HHHHH"jHZHB999QHD$dH+%(uJH[]A\A]A^@HLnLbL$$Q@L1Nyf)fH "H֏"LcHLJHtGHzxH"H2HB199|fD)IfHM"Hv"IHc HHHLHpH@H":9|@)H"H&"IHc HHHLHpH@HE":9|@)ATUSH"H{HDC8HAL% "H ~"I$HcH@H׃Hh H"HHȞ"DHrHj9:HBH"9|UI$HHPHB L`iH{PID$ []A\'Hi"[D]A\"D @)AVAUAATUHSHHH"Hэ"H;Hc HIL4G usHtEI.IvHHt@IFHܕ"A|$IF8:9|WE @teDHAu L#EucH[]A\A]A^fDHt$H"Ht$rD)E @uyHf.PHHtHL[]A\A]A^f.AWIAVAUAATUHSHHH:G L5f"H"IcHIL9|HDHAu L#Eu>H[]A\A]A^A_Ht$vLD$W@)PHHtHL[]A\A]A^A_USHHH7F uzF/HHr"H+HHtwHH H"HHH@H} v%HUHztHƺHHD$cHD$H[]fHH3Hvm+fH"H"HcHHHH r"HBH1H2H5""8H"H6H19|@)QAUHcATUSHHH-F"HcuHL$Ht9HHIH!IH9u7H "T;@H9"؍HHHML,HL[]A\A]fH1H={Eff.AWAVAUATUSH8H"D$L%"AA$9L"H-IH={"HcH4H=HHډA؃??A?<H)HA$H)ր:HcTH>fL6L~M7A$fA9|\$H"H8[]A\A]A^A_fDL6L~E7A$H~A$L׈"DL6HAA$HFHD$Hh"L6L~L "B:HzHLL$(HL$ HT$mL$ HT$H"L]":LzHLL$(Dr8f9IH@Hx !A$H)A$HFL611L~E1AHD$LLjLjML߇"HXZtAwSAwH^HD"LAHI9FM=HQAF#LL$x@L6L~I>M>L~A$L[".fDL~L6HF L>LLA$A$L"HLN1LL MtApHApAA@AqAqHs sA$DHLNHSLL~H^L6IGH\$HH;L3Ln"A$=DL6L~I>L9%M>L>"A$ DL6L~H"H5C"H "L:I?HH+HHGIFHI6HvHI6L2HvHHH"HL0A$DL6HvLAF@L"eH"LA$Lw"Jf.L~L6H^EAE#^ H\$A E^ f.L6L~IFHx HtwwIFLx AG@Av AvA$f.HFL6L~HD$IH\$L@(LM?A@C IHz &z<H|$Ht   I?H  HD$IL6H^IFH8HHmw wVL6L~1IFpuHxLIM~L"Hx(HGHHz z<H@ xuAOIA-H̉"}@HH^H8H>HA$LU"(H>A$L5"L~L6E1H~E1DA$HF DHF LH|$A$L"L6AA$fDL6HfAA$@L6MtAvI Av[H>A$Lm"@H>A$LU"(H>8A$L5"L6Hv"L2Mr INH"H Hх"L6HHz@H@H;=9"@t!H;=B"tHA$L"DLr@HY"L6Hz@H;="@H@tH;="tHT$A$HT$LY"L6HL;5/"AA$ T$L6H"L2fDH~"HHL<ظHDl$M4~H ~"H<  " YHHHHK"HHHCIAuAuIIH M9HM/I#UAE HcЃ 4 = IEHX8@]HCLIEL"@]tHx8HtIEL"HX8IEH\IEH\AE D%I AE M9+Dl$A$_HHHH |"H HcHH L|XfL6ML,A$L)"@H>0A$L "L6HIA$DH>PA$L~"L6Af H"HcHH HX~"H H>A$L~"hL6H~"L2NfDL6L~HFLLLHD$%LL$LA~"HAF @a HHy"LHI9MAFEHD$HfDL6L~IFHx(Htw; wIFLx(DL~L6I?L9u M7L}"A$]D%_fDH[HHH"HH |"HH HCHAXH5HHQXHHHH@HH@HH@HH@ C HC% @C IAu8L L|"+@IELH8@]HHHH "HH {"HH HCHQhH)HHzHHAhH1H)HhHB`HHHCIH@]tHx8HtLL$ L{"LL$ IAIHLH8IHH\IHH\+HHHHB~"HH z"HH HCHA`HHHQ`HHHH@HH@HH@S %_C  C HH@HCIrLAE Lz"8LhAE Lz" ILH H+LL$ Lz"LL$ HfHC Lz"WIH@Hx HL|$MADl$ ILH@ wwHH@Hx HuDIMLL|$Dl$ {IHPHz Htw9wHPH\$HZ H7A$Ly"t %AE  x:LAE Lby"MtAvgAvH|$HD$pWpA$;L y"H]'Lx"H( HL$ OHL$ Lx" HL$ %HL$ Lx"'Lx"HIVL9wHJPI9w z-H~"I?HT$(HT$(LA$L3x"HHX Hc1H= Hu"HHHHHz"HL5Nw"HH HCIF`HHIV`HHHH@HH@HH@S %_C y E11ɺHC H1HLL$H@HCLL$L9w"IH@HX A$Ic $IHHL HB HZHB H>"A$9THYw"LNA$Lv"L#Lv"LLL$ Lv"LL$Lv"Ic $IHHL2HB H~"A$9Hv"LA$L/v"h HL$(LL$ HL$(LL$ Lu"H<L>AE < uTL.AE Lu"1PLLD$(LL$ HT$rHT$LL$ HLD$(Lu"A@LbfDPLHL$ HT$)HL$ HT$HL=u"LAMA@LA@L(AE Lu"pHLL$ C LL$mL:AE Lt">MAqAqu@H)r"HeIFL}t"LHL$Ldt"HL$IFLJt"7 LL$LL$^LL$@LL$HfxISNx ADXLs"LDLs"H|$.A$Ls"LL$LL$Ls"IHP)LL$>LL$HD$IDH=}16LRs"N)ЉLHD$I?HD$L#s"H|$LL$ HT$rLL$ HT$Lr"ff.Hr"Hy"HHHp"H@L@H HLHHHBHRH9uHǀHPǀHe"HHjj"HLHfDff.AUATUSHL%p"I<$HG H%Hu-@HHtpCuHߋG H%Hu߅tOL-ll"ImHu[H=f"1IEI$HHd"HH[]A\A]ÐuwL-l"ImHtU Bt#H@H\DH{?HHH9uH]H'HcH-ff.@AWAVAUATIUSHHL=k"M7MEn E;nAELAF 51IKDmILLL@L`h LHHie"LIHLH9sDHHHHH9wHHL[]A\A]A^A_fDL0Dh I@ISUSHHH-d"HEHtCHHUHooJHHM`H HU`HH K H[]ff.HwHGt?VHtFHHHHQHxHx` HHPHf.11f.HVf.USHHo @tHHih"uxH@(S %_C uk€"fE‰C H[]@ tH$f"H@(fDtH/H E(ffW{HC Ha"AVAUATUSL MI$HHMf"HI$AD$Al$ w-TuID$ID$I$[L]A\A]A^ÐHb"AHN4J4HNHAJs>Ut XAVHID$H)I$L[]A\A]A^ÐH~HHHDHH) 1HDۼIH b"HCXHHHSXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ L[]A\A]A^ÐID$ID$I$L[]A\A]A^f( l[B4BTOHD1fDUHSHHHtHH9HBHHUHEHZH[]ff.@ISIHE1Hy HALL H(\(HcvIfDHHHHHHHHHHHHH)AQfHHH='wH w0HA@yEt@-HM[fHHAzfQHE1Uff.fSHW HC@HH@H[" HHpHP tHKH9H uLt<uR1HÃk _H7S TE1[DfHHtHRHf.AD[Dʀ%= %=HH+Z"HHE1u ADtHAHy eE1YHff.@(ADE;HAH@H$E1HHC80AHH@80AHHH@HHuDHhHHx AH;Y"AG tI%E1=t DfDHHBH=vHRHH)HOwHH9sfHH#GE1HuHHxADfATSHHu@HI["L MtaI$HH_"HI$LID$H[A\HCHsHI4HL[A\fIfDG < t-tH<Ht+H@ Hf1DtHH@(f1HfATISHHG < tx= uH=1(<HtHp H HtMV t|L9HH[A\tt!HtH0HuHX"Cut‰HiW"1H=H1DH>HVHOL9"t HLM9u "fL9 tCHH9rHHVHoH>HHOH[A\HW"8;LH>HqW":LH=1f.ATG It9tSu*uJH%LAD$ GLA\1H5 }LA\H=q1i褩@HHtGff.@ATUHHtmHtHG HuF taHT$ H4$蘢HH4$T$ u=fHGF uHU"Hh@H?H E HE@HH@1ɺHH4$zH4$HI@ LH+T"HHAD$ 3tID$@0HH@ HL1]A\'F t HF@uHأH]A\HH@t*HQT"HpHAT"HhHDH)T"HhL;%T"HT$ H4$۠H4$T$ fD1^I$HtHPHA1H6ID$80&I$Hx  ff.HU"ATL Mt[I$HHeZ"HHI$ID$H _"HHyH8H2X"H;8}%HT"HL$LA\Ð蛱IfDHfDATIHt=G uAH^"HHzH8HW"H;8}DHUT"HL$AL$ LA\HH+R"HHvH;=_"uDHff.AVAAUATAUSH0H|$dH%(HD$(1HcH݅tkIH|$DHVHI$H[#@A AHcD!@Hv>HOH9w ~'w6H=HcH>HH*u'u%H=1f.DmLuLERs1H<$LT$hHDHH)HHD$HH|$xZ6L9T$@HD$hDd$LHD$ Ld$L$-DH5S# HH9HMH|$hH9|$H$HE1M1LH$UD$(PAUH t!A|$XHt$ LMZHD$h|$(HxtI|$HH)HaHqE1fDH$dH+%(cHĸL[]A\A]A^A_ù*E1HޞL5gN#HD$ELd$hHD$HH؀|$(Hz:H$L9$$EE<HD8]DD1H5KF#Ll$DЀ</#Hl$(L!DH$t$ Hl$ALpHgfDH|$t'HxD$ H<$PHD$(HpHD$H<$t(}XHt$hHXZHD$hHxH|$hH9rDDLYHD$hIH9v@E1)[L|$h|E<)ZM<+YAHT$hH9$HIK#L<$1AH|$BfDEt H9.Xw;H9W -HD$hHpHHT$hI9tMD @DA!A9D8uH19E1_H?K#H8hKHvF#E:utH5:1.ELd$hu }`BHD$h1HD$L9$$Dl$L|$MAL9u L$I/AX?M9oi,HD$hHXILl$hL9,$MeE1LHLL9 uML|$hHD$}HPL5I9CUAGIUHD$LP„CHF#A AHcD!40HvCLGM9wUIM9UEHHLF ?A1H HwHUHcHc&S1蹪DCHt$HD$h H9FtPHH#L4$1@@@L9=Ll$Ld$h,A}XAI9E+HD$hHHD$hL9=@@9uL|$hHD$}H@Lz<I9I5ZAIYHD$LP„IH~D#A AHcD!40HvJLGM9wQIM9QEHHLF ?A1H HwHQHcHc"Q1):IHt$HD$h H9FtPHHG#L,$1@@@L9q9Lt$Ld$hfHD$hHHD$hL9L9@@9uA~X'FI9F,HLG#H8PE1E11ɺH賟H\$hIH$H9D,$E1MA/IH%fDHG#HH\$hH9A $3AHHAEAHH)DD)HH9w@y{H=~B# 7H!HvIHKH9r~CfDHH9kCDHHLF?AH HwH:CL肘H $t L9;9HD$xX$EHD$LxI9-HD$hLH)HAH5zF#HH9LMLH|$hL4$1ALd$H9<$w.uDAH5F#I<H|$hL9OHMULtHD$hIL9+Eu H9*A|$XM;|$wHt$hLLL|$htH|$hE1H\$hH9<$Lt$H\$HH,$*fDAH}E#I<H|$hH9I SH͕HD$hIH9tL9u EY*A~XM;~wHt$LKL|$htfH|$hE1H\$hH9<$!Lt$H\$HH,$fDIH|$hH9I SH,HD$hIH9L9u E)A~XRM;~wHt$LOKL|$ht1Ht$HT$h H9VtBHB#L4$1%@=@@L95Ll$Ld$hB@IUHD$hHH)H)0H=C#47HH9HMHT$hI915%@=@9uA}X^AIEH9'HL|$hHt$}HNL2 I9tAWHB#L,$,M9d?Lt$Ld$hHD$hHHD$hL99?҃9uA~X AI9F?+H9B#H8KL|$h}L1HD$H@L9H:BAWIRH5=#8;:_@H,_HD$(fAAL9<$L:L,$Lt$Hl$h|@H<#8A_:HBxfD9c#I^HD$hHH)H)H5 B# HH9HMH\$hI99D;E{AIvH-H%HH)HZ4CƒH4?AA H<#8(EH4@#BЃ?H@#H8cELt$hL%;#}A$Mx;HD$L9p7AV7_@H,H,(fL9<$6L,$L|$L$$A1H ?#ËЃ9!HD$hLpLt$hM96AEuƀ_t3oHXfE1E11ɺH]CH|$hL<$II9D,$1ALDH)dHD$hIHHh0@y~H=Q;#@ H!@HvGINL9r`.@HI9O.DHHLF?AH HwH.LRHD $Et L9_(HD$xXGHXI9#HH)H1EH Q?#L\H9IMHH|$hI9[HD$hL4$1H\$hLd$H;$rE;HD$hHH)Hj'0H=>#47HH9HMHHD$hI9H8@x'MH5^=#@DA!D9!H9u E$A|$X9IT$H9kHL@E=IT$NH=#H8/BL|$hL%8#}E4$L}8HD$L9x$9AWE)9_GH,H,(fL9<$q8ELl$AEH|<#ЃD9+A}XEAI9]z"HD$hHXH\$hH;$8+Eu@_4?HhfHT$hH;$H;#L4$1AL|$H1=#HHT$hI9LMD @A7A<$tH '/##@8uIE1H/#H8<4Lt$hE1Ld$hL94$aLDl$MIIHl$Ld$AH$jDM9u D$}X3LuM9pHD$hLH)HH5/# HH9LMML|$hL9A}HL{D8uAH/#I1D8t!HD$hL`Ld$hL;$$A$8uH|$tHD$AVHuI|$ЅtA}Xz:Ht$hL5tL|$h1H*.#H86Ha)#8HD$L5(#@ZD$(HUzHD$1IL4$Ld$1L9<$f.H1-#9!Et L91!A|$X1Il$L9rHD$hHH)Hh)H5*.#HH9HMIL|$hM9;IwLHL)HH5-#H9%,1<LAAAG1H-H(L$$Lt$1L9<$fDH),# 9GL9u E "A~XW1InL9HD$hHH)H$H5$-#HH9HMIL|$hM95Iy1HHsLL)H4AWу4? 0HwL5R%#HD$Lt$E1L9<$fH!+#, 9(M9u E!A~X+MfM9HD$hLH)H#H5,#HH9LMML|$hL9<$,Ix1HHrH5+#H $L)H9*<LAG<~*<7AG1H-H@L4$Ld$1L9<$H*# 9L9u E( A|$X)Il$L93HD$hHH)H"H5 +#HH9HMIL|$hM9IwLH-L)HH5*#H9N.p U.1:A/1A H|E1L9<$Dl$Lt$MMAH$H(# D9M9uDD$EA~X(M~M9HD$hLH)HH5)#HH9LMMLl$hL9IUrHH-L)HH5)#H9++15A}*1A}H$L9sE1Dl$L%L'#MMIHl$$HAu@y|H=7$#@ƺ H!@HvEIMH9w^'fHH9O'DHHLF?AH HwH'K<9zHH҃HH8$ M9uDL$E7}Xw*L}M9HD$hLH)H#H5,(#HH9LMMLl$hL98H|$  ۸HD@D$DH=HcH>MHD$8aH"#ALL$8 K49AHcD!<:HMAL9w fIL9 EHHLF ?A9H HwH HD$xL+D$8IPI)HT$8L$HDŽ$H=H$IVI4BAMHD$8bH!#ALL$8 K49AHcD!<:HMAL9w f.IL9 EHHLF ?A9H HwMTL$H$L\$XHDŽ$A}LLT$PLL$8LL$8LT$PHHD$xL\$XAML$LLLT$XLH$LL$PL\$8hL\$8LL$PHD$xLT$XLL)H~AMH5I%#D<I9LOL$Hv!HH$ Hй̃HH"I4H)$Ht$8E}EH #A H4A!AHI}I9w" @HI9 DHHLF?A0H HwH L)HD$xHWH$H=^H|$HH|$HE1E1Ht$x L\$XLT$P5LT$PL\$XHRH8G % =HL\$XLT$PȒL\$XLT$PHL$H"#H:L\$`LT$XL$P5L$PLT$XL$L\$`H"#H8QE}Av2H#8u&:L\$XLT$PLT$PL\$XL$AJHA"#H8|$(E}AH^#8:L\$XLT$PyLT$PL\$XH#AǾ HA!EHvJIMI9wm2f.HI9V29HIH<:?I HwH(2H&#H8G f%f=4,H#%H L:1L\$XH5LT$P|E}L\$XLT$PDMtE|$(LL$0L9l$0s 'fIM9rAEǃ@@A<:sLl$hL;l$0"4$fH|$ tnH|$HD$ L\$8L$XHD$hHt$h(L$L\$8Ht$Ll$hHFL9v~ZILl$hL;l$0*H#H#HH9yE1fHD$ fDL$1L|$0L9l$0sH #8IM9AEAAEG AsHD$x0AEHDŽ$HD$x@HDŽ$AEHD$xAH#I<H#HyEH#H|WHt$hH&L|$hffDHt$hH<$b&H<$L|$h<@Ht$H;&LurHt$hH<$&H<$L|$hfDH4$H%7LcHt$L%L|$h@AX M9w3A~XA"IFH9H{H1HHp AI]'LLH% IUHt$hH*%QHUNLL%IL|$h@H{0P_H0H}0H0sHfwIV@H@4$HL$ H1+pHHt$HD$HHD$ H7H;L$ ,HL$ *H y# 9HH{0IH<$H|$H0LHL$ LT$qHL$ LT$HD$ q@uxktXxNpHH9HL#2L|$hsHt$hHs#L|$hQHLU#KL|$h3Ht$hH3#)Hl$hHD$HXI0Ht$hH"(Hl$hHD$HXuLL"L|$hH1HsxLL"L|$h{Ht$hH{"'L\$hL}Ht$hLX"(IwLL<"wL|$hf.LL"%)I]Ht$hL!(E<$gHL$ HD$ `HI:I|$0I~0EI~0-I|$0|H HAEH#IcAEHr#IAH[#IVAHD#IAH-#IAH#IH1Hv{II|$0QyH}0HNHL L|$hl@Ht$hLk  'H$D L\$XHT$xH$HLT$XE1AjH|$HV_L$H$H$AZA[L\$XLT$PAUH #LH9LC HH{0Ht$hH$HD$Lx1nErHt$hH$HD$hH]Z I|$0Ht$hLH %I_%I|$0$HH<$LL$ lL$ H$cHt$H#LmHD$Hx0JmE]HI0VLLL|$hyfHt$hHse%L}@HLT$XHT$xLE1H$HALjL\$`Y]H$Y^L\$PLT$XH}0HD$Hx0Ht$hL!M~Ht$hL&Il$Ht$hL&Il$oHt$hL~$InWHHt$hL\s"Mf9H$LE11HAHjW\H$XZfHAWуz? L|$hL|$hL\$AE11H$HHjH|$[H$_AXL\$H|$L|$hxHEAOȃ<3Ѓ?H8#  HD$L9x E<<`<+HD$LPH@L9N$AWI$H- #L%SH}fE,L9<$Lt$\$HDMVA7@yH=#@ƺ H!@HvHIOL9rDHL9DHHLF?AH HwHH;eIVMFLE,ADS:D$t A~X!Ht$hL!MVL|$hLL)H~AH #IH9MLL|$hL9<$D<HD$LPH@L9M!AWI> L%#H-I<$ eDtL9<$XHD$Hl$A\$LPHLEMILAu@LR#@A HA!@HvFIMH9r*HH9D LHLG ?AH HwHI?RdHt$MDHHK,jDLKZY:D$t{X Ht$hH=H{Ll$hHL)H~AEH =#M\H9LLMLl$hEL9,$vAMH|$XʾL9(Ht$hL|$h餾LD$8HAMȃ<Ѓ?HZ#  _H$LE11HALjxWH$AZA[H #8H5:1PL|$hL\$XLT$PuL\$XLT$PL\$XLT$PuL\$XLT$PL|$h鯽1HD$L9x E< <H <H- #AwL%OH}@bE,L9<$Lt$hLMMIH\$1I<$HL$ bDHSLCE,HL$E1Dj@8t{X_LHBHD$hHHHL$hH; $rIH|$X¼L9 Ht$hL|$h霼<uL%I#AwH-I<$\aDlL9<$vHD$hLt$MAHD$MIA0I?DT$ DLD$aHINjE,LD$(|$0MNDSZY@8t A~XHt$LHD$hAL@LD$hL;$rMS(@@9Ht$L|$h~XH|$H9GHt$hL|$hqC(%@=@9HD$L|$hxXBH|$H9WHt$h9L|$hH$DHl$ EH\$LhaH|$tL`HD$ AWLHpHD$Ѕt({XHt$hHHD$hL`Ld$hL9$$LLL)QHD$hIHuػH_HH}0lHD$Hx0M1HwI01TI|$0_H1H2#AǾ HA!EHvDIML9r@HI99HIH<:?I HwHfH#H8G f%f=H #%H L:1L\$XH5LT$PfLT$PL\$XAL$fH}0{LL|$hҸS(@@9Ht$L|$h~XH|$H9GHt$hL|$hvL|$hlC(%@=@9HD$L|$hxX=H|$H9WHt$h4L|$hI~0I~0H}0I|$0)I~0I1A}HX#8 Hn #Hcҋ,C(Ѓ9иHD$L|$hxXTH|$H9WHt$hKL|$h)L|$hI1Ht1AD H#@(Ѓ92HD$L|$hxXH|$L9wHt$hL|$h鋶H$HE11HALjOH$XZL|$hN[ H#Hcҋ,TL9$$Lt$H1H\$h6L9uEuiA~XGM9fs;HD$hHpILd$hL9$$=A$ƒTrIHLtL|$h霵@I~0u1H$E11LHALjNH$AYAZH#8 H#HcD$AH;HNI4H$L|$hH#8AH#@(ЃD98HD$L|$hxXH|$H9_Ht$hL|$h鑴1xXH}Ht$hL|$hfHD$H@HL)H~AH5#H9IL|$hL9錵@ H#D$AL9<$ Ll$L4$Hl$hIuNA}XcIuH9H\$hHH)H~H #HH9HLH\$hI9H9s%x4Hu#ЃD9uIuA령1H'qHHHw@H)H~Sуu? HL. Iu7H1bsH#@(ЃD9HHD$L|$hxX̲H|$H9_%Ht$h L|$h顲L|$h闲H5:1 EL|$hE H5Ҫ:1DL|$hL|$h=DEEH#@(Ѓ9HD$L|$hxXH|$H9_\Ht$h JL|$hرL|$hαL|$hıHE H#Hcҋ,HIPH5"80 HU#@(Ѓ9ŲHD$L|$hxXIH|$H9_Ht$h@ L|$hI0\$DIJxXHHt$h L|$hHD$hLxHD$L|$hL;x./S(҃9Ht$L|$h~XH|$H9GHt$h L|$hqH$HH1HAE1jIH$_AX钼L9<$aHl$-Ht$hH. HD$hLxL|$hL;<$-A u 1A? UX9t˄tL|$hӯL%L"AwH- I<$TDlL9<$Lt$hLMMIH\$1I>HL$`TDHSLCE,HL$E1DA@8t{XLHW HD$hHHHL$hH; $rRL|$hL|$hL|$hH^"H#HH9B[L|$ QQ?L|$hˮL|$hL|$h鷮AL9<$cWH@fWH@fR1ҹLLl1L|$hNL|$hDH$HE11HALj`GH$AZA[L|$hL|$hL|$hAGPp @Ń_< @H4$1L|kI鯭L|$h饭L|$h雭L|$h鑭H$HE11HALjFH$_AX8e鎴L94${?VH@fWL|$hL|$hHD$ALP|LHV"A AHcD!40HvJLGM9r@ IM9, EHHLF ?A1H HwH Hc1`D H5",L9<$Ll$L4$Ld$hIuCfIuH\$hHH)H~H :"HH9HLH\$hI9H9sQx`H"Ѓ9uA}XIuH9rLL{L|$h鑫1HAiHHHw'H)H~Sуu? fH1[`H "@(Ѓ9|HD$L|$hxXH|$H9_YHt$hGL|$hժL|$h˪L|$h1HLoh1L|$h鞪L\$XLT$P:`LT$PL\$XHGIEHD$鹬Bf$HD$ AU121A}#HD$ALPKLHa"A AHcD!40HvMLGM9wf.IM9EHHLF ?A1H HwHjHcR1 ]HԹE1};LU飫L|$h3L|$h)1LLf1AW11AL|$hި`ǽ``铺L|$h鶨L|$h鬨HD$LPH@L9 AWI H"L-gH8LMAlL9<$Lt$\$AMVA7@y}H="@D H!@HvHIOL9rDHL9DHHLF?AH HwHH"H8LIVLAlA:D$t A~XHt$hLMVL|$hLL)H~AH "IH9MLL|$hL9<$]H$LE11HALjK@H$A[]9HD$LPH@L9}AWI.L%J"H-I<$KDlL9<$Lt$\$HDMVA7@y}H="@ƺ H!@HvFIOL9rHL9DHHLF?AH HwHI<$JIVMFLD,ADʺ:D$t A~X*Ht$hL MVL|$hLL)H~AH "IH9MLL|$hL9<$DL|$hvH$1LLHE1Aj>H$Y_)H$LE11HALj_>H$A]X\U1ҹLLb1\L|$hؤ1MɤL|$h鿤M鷤\I饤I靤)؉D$DDD$(D$D/L|$hnH18\XL9<$?MH@f\鑩HU1L|$h[(HE1H$PE1E1j1L =AX1ZEiH$H9rHH9t tw#H= 1gfDALH" HcD0!IvL\$@DL$HLT$PIHD$0LD$pLLHLT$PH0DL$HL\$@ܓL\$@DL$HHLT$P_M9HSxt$(HBpHDBhHH@ 0DHKxHAhHuHyptT$(tHApHH@ E1H$dH+%(HL[]A\A]A^A_LHDL$HL\$@=L\$@DL$HIIM9rHt$HxVM9_HH A"H+D$LHL93UHHu4LLDL$HL\$@ HEH$D$D$H@H>SH #H$H5q#H9HcG H@HHGHHB@HHtH@LBHH5w#HIH$rPp`HBHApxApB8G($H #H8G"u0G#*lINNNLAp(r8HI+pHIAp(HjHHuv`HB0rPH5#H6Hr@E"G#$fBxHE@`HEHcp`~GH$H$D$D$~=HEH$D$D$Hcp`H$H #H@HHH@H$$HHHcB HrH @HHƉxH#HH$HD$pHP(HzHB(t@!@TH@P fft H #HHD$pHt$HT$HHD$0H+VHHPHF@HHpXHt:HB P VI IH|$HD$H+GHFHG@H@XH@H|$htOH=+aD$D$HL$pHt$hH2HL$pD$D$H#HD$ D$H5#D\$pH+HD$ HT#HH=#H5I#D$D\$pHHH+H9T$ MHH=#HH$XHH^#L$THLH$XG  |$TcoZRLGAP ^rX@ jkH#H$D$H$H=#D\$pHH#H0H#H$DAD$DH|$0T$ %'H#T$ |$TD\$pD$H#H#HH H#HH\H$LL$IA$rHl${HL$0AED$c;YHH@HDHxD$c:HD$HT$AD$0LAD$(IT$8IID$@D$TIL$HAD$,Ht#qDD|Nlt"@*<)@42)HHIHl$A$HT$D$THT$|$cBHBL+IAEI\1I9HDAEfAD$8AE Ht$0LL$fAD$:H#D$Hl$DEMlAD$(I\$@AD$,H#A$AD$0H#LHD$pH$HH$H|$0LDT$ $DT$ $H|$Ht$0WHWL9H@HHH0HPHHH9}qHHItA<$|$S$Hx0LL$L9L$s$DL9tIqL$E:)_HD$H)H,H9l$HH~>DT$pD\$ IJHH$H|$D\$ DT$pA}pHl$IfH#JHD$pH$HH$|H(#H8fhH#KHD$pH$HZH$:AEIDI9IH#A|$4;8jFH|$0H$DDT$pD\$ #D\$ DT$pHt$@LL$Hl$It$(HF(Ln8A$HD$@|$SEM*MEHD$HT$H)H5(HH Hk(< g|$SH(<qW<HD$xq@H-H] (|$SHEMMEH#H8f|$SAMMEC|$bCH5C#DɺHH=#?A}H9HT$H+T$L9%I$DT$bH|$LD\$ LL$pD\$ DT$b$D$byH#H8a|$S"HD$DAD$H#8:DT$pD\$ ED\$ DT$pD$HD$AпHpHU# DHc!DHvDHL$HH9w9HH9t-DHILF?AI HwHt@DT$pE1A1D\$ H$`PjH|$L$pXZDT$pD\$ H{#H8G f%f=qH#%H Lʿ:1DT$pH5 XD\$ (D\$ DT$pDAEfAD$8AEHHt$H|$HH9|$S\HH wNH9nN~ tHD$IHeH|$H9|$UHH/|$SpH~#(HD$HL$H9L$ HD$pH#H$HH$Ht$0AMAEHV@HIf.9r MH4RI4H>t H~I@PuAEH|$0IHt$HT$$HH@HH+VHHP;$D$DHD$@L >#H@0pHPA|A|$H|H|$ t$@*4N@4*NHHHD$ HD$@pPnt$phPH@XID$@ID$894aHD$@HT$H;PXAE<HL$DIHEIALPHt$VLuXVHHN8BHyIHcHgH;VP\1D$D\$p; HD$D\$pD$PLH|$HD$GLAUH+GуHcHHкHHPHHHW8HRHH4HcHFHD$@hP{HD$HT$H;P(8H*HH|$A"EA;EsHD$H9`HWHt$A"EA;E>HD$H90[|$S HHD$0A8uH9D$ @HƒHATHHD$|$S8A8}@KH #@ Hc4!HvHH|$HH9|$ w?HH9|$ t1DHHLF?A0H HwH=KD\$pAE11D$H$`HjHt$0H|$?H$p_AXD\$pD$JHHD$|$S8 A8}@JH #@ Hc4!HBH|$HH9|$ w6f.HH9|$ DHHLF?A0H Hw@|$SHHD$H|$AUH)H9IuDT$pD\$ )D\$ DT$pH|$0E1E11ɺLD\$pD$D\$pD$HHD$ yH|$7@mHι#@ֿ Hc!@HvMH|$HH9|$wHH9|$DHHLF?AH HwH|$SHAUHD$0ɍHH)Ƹ/)ȉHH9H|$0E1E11ɺLD\$pD$tD\$pD$HHD$ JHD$0@>H#@ Hc<!@HHT$HJH9L$wfDHH9L$DHHLF?A8H Hw_@|$SHHD$A8EH|$0E1E11ɺLD\$pD$kD\$pD$HHD$ AHD$0@5H#@ֿ Hc!@HH|$HH9|$wDHH9|$DHHLF?AH Hw@H/H  Hx H |HD$ H+D$HhHT$HD$H;BHFx D$p|$SufH H|$H9|$AMH# @!99D$pHD$IZD$pD$pHHT$H9T$AE$H |$S HD$ H|$H)HH-HWЃ<?H##$ #49D$pHD$ID$pHg#H8>A}>HD$|$SHx HL$H9JHAIEJH[#8C_$ cD$D\$ x$HP?D$p|$SA}(AEH XHcH>H$AL$(ID$PAUDJEL$0AE*H|$h)I|$@EtHIH|$H\$BD {ZHSHH)H9r HAEL$0EuLËt$TNKAEIDI9D$TIHD$pIHDŽ$HDŽ$H5#AMHIME1|$S@ |$bDA}H9H@:<. D$bHD$pHDŽ$HDŽ$D$pHD$HL$H;HH# HT$R@@H%@=@8;D$pAD$pHD$HPH;T$ ;D$H HD$IHD$(D$pPD$pD$pHD$pH#H$HFH$D$pD$pCHH#MHD$pH$HH$+1<)HHT$It$hD\$pD$D\$pD$$Hk$D$D$D$LD$pH|$ IH|$ LD$pD$$D$D$HID$8HHD$LLL$H$鈻DH|$8HtHtS9Hl$8LL$ HI@CFtkA<,wIrQHcA@utWADH|wEuHcA<@tf?t]fUt`GH<HcƀWtHtˋEHtċW9uHcA@tBרD)6H|?u HnGHHf#D$H)#D$dD$d9$(H=2/1PHD$0HIXHH PHD$0HOXHH 鬻AM@H# !9٩H#HHL$H|#8$H#D@(AH+HD$(@#HB#8m(@_ D$D$DD$ ]HhA(HD$AT$0IT$8xZ(2HIL$HML$@IT$8D$THT$1:19D$pHD$H@HH+L$HaHt$H-#THH9HMHD$9HD$1(169D$putHD$05(1;9D$p_@)$ HL$0H@HHH@AD$$AD$(HT$1:/9D$pקAU5LT$0Hl$8L;@DAoD| HcP;HP+FuxP;$wlILD$H IHHH~H>IH|$I+xH|A;vAAA9HtMHt 9D@H #AD<@(||H| * 4 HHHHHH|$H95WHGHD$ H9wHH9t փ@t=HD$H$H9$4Ƅ$H$Ƅ$iID$(HH@(Lj8LL$A$~HD$@Hl$釽D$d|$d9$(H=r*1c E1黥1H5/?:D$D$5HD$D$D$H@HD$ ?AM3 H$H#ȿL$ OHc!42HBIHI9wA3HI913DHHLF?A0H HwH3H+$H$XHHI)H$L$PHDŽ$HH=L$PH$HHL$ HIA9M H$H#ȿL$ OHc!42HBIHI9w02fHI9!2DHHLF?A0H HwH1HH+$H$XHA!H#H8B|$SEE$AH!#8:D$8> D$8H#A HA!EHv>IMH9L$w6HH9L$t*9HIH<:?I HwHt.H$`VE1LjHt$(A1L$p_AYH΍#H8G f%f=@HB#%H LH5k :1;EEEH#A H4D!H@LD$IMI9w/HI9n/D HHLF ?A1H HwH=/L)H$XHHH$HH= H$0HKE1E1 H$XH%H8G % =+uL$PH$HMtAD$@IfHL$ QH)ӍDm;AdHQHH9hQ(AL9l$@3f.H)#H:A$8~L$P$8 H#H8?Au@H#@$88:7 $8H#@ƿ H!DHvAIMH9L$w9@HH9L$t*9HIH<:?I HwHt-H$`PE11jHt$(ALL$pXZHNJ#H8G f%f=1>H;#%H LH5d:14L$PAH?H9T$1@L$H HT$HHD$HÒ#D$0D$H:H 9PH=#,HD$H?pHjH PLL$0LD$4HL$X_D$XA[]D$D$lH9T$H?1@L$HQHT$HHD$HӇ#D$0D$H:H !H=#,HD$H?pLD$ E1ɉH HT$H{H9wHH9t փ@t{Ht$~U~FH$XE1LAH$HHjH$L$`H$XH$hAZA[H$H;$,鷍MH|$H\$ D$Ll$pD$L$D$!qMH|$H\$ D$Ll$pD$L$D$pMH|$H\$ D$Ll$pD$L$D$pAXHD$0@H|$H_#@A AHcD!@HvDHOH9wBHH9t2D HHMF A?AL HwH;D$1HE1D$H$`HAj$H$pY_D$D$HD$H׾D$D$HPPHL$pxHL$pD$D$HAHD$PLLHt$H9 v@H9wfDH0H9t @t8DBHHHa##HD$0@H|$H8^#@A AHcD!@Hv?HOH9w =fHH9t2D HHMF A?AL HwHcD$HE11D$H$`HAjtH$p_AXD$D$E1mD$D\$ D\$ D$H5D$@D$DD$ 辷\VBp< _ HHt$1D$D\$ ND\$ 0D$HD$HmLD\$ DT$TGHl$+HD$x1Au$DDT$pIH|$0D\$ Hl$LL$AD$ HqV#D\$ DT$pA$AD$$YoHt$~^~OHHH@D$cHD$cHxHG80D$cgLH$0D$ D$H$eH$0D$ D$H$H9H-HHD$ H)HOȃ<v?H^# ҋD$H~HD$0@YH|}LDAAE1A}LDAAE1A}LDAAE1A}LDAAfE1A}LDAAC}t"E1E1E1/}t1E1E1E1E1A}LDAAE1A}LDAA}t"E1E1E1}t1E1E1E1E1A}LDAAE1A}LDAAg}t"E1E1E1S}t1E1E1E1?E1A}LDAAE1A}LDAA}t"E1E1E1}t1E1E1E1ѿE1A}LDAA鮿E1A}LDAA鋿}t"E1E1E1w}t1E1E1E1cE1A}LDAA@E1A}LDAA}t"E1E1E1 }t1E1E1E1E1A}LDAAҾE1A}LDAA鯾}t"E1E1E1雾}t1E1E1E1釾E1A}LDAAdE1A}LDAAAE1E1E13}txE1E1E1}E1E1E1}E1E1E1}>E1E1E1׽E1E1E1ɽ}t1E1E1E1鵽E1A}LDAA钽E1A}LDAAo}t1E1E1E1[E1A}LDAA8E1A}LDAA}t1E1E1E1E1A}LDAA޼E1A}LDAA黼}t1E1E1E1駼E1A}LDAA鄼E1A}LDAAa}}鳿}}长}}w}}Y}x}n;}Z}P}<}2}}}}þ}}饾}}釾}}i}}~K}j}`-}L}B}.}$E<<<}}鷽E<<M~8H9v3H=N$@IHM~H9vpHH)H9vHHH9ttIH9w3fH9s#HHtIyH9rHWHH1H)H=>YfUHSHHHHHS0HtMH y HuH@HHS8HHS@HHSHHHS(HHCXHtHS`HPHKXShA@ ЈAHS HD$H{PHHtwwH;HtwwHFJ$HSHHx8HP8HtwwHCHtHx8HSHP8HtwvwwHUH?$HHEHJ$HxHHt$HǀxDHHx聾HuH[]P{F*<:2AVIAUATUSHH?dH%(HD$1H9IH-) H-L$L% DHI>L97@yLF$@ƺA H!A@HvFHOI9wHI9D LHLG ?AH HwHHJ$H8AtJPwBI>;HJ$wH8ŜDtPwI>HGIL9rθHT$dH+%(u9H[]A\A]A^@HHLE1jA1ĐHt$XZVCHdH%(HD$HH9"IuKHPHH9 pHhF$H8IHNBHT$dH+%(HÐH .J$LLI9A3@yH=2E$@ƺ H!@Hv$H8覚PwIHPH9vI.HT$dH+%({H[]A\A]A^H9(HX@"L%VS%@H=$H81IAPwLH9vsLkH@yL9rIAUL9t ЃT$ DL|$8DLLƒ-t4DudZtHT$HdH+%(HX[]A\A]A^A_Ht$T$ H|$@@ Dt D$ HA|@L|$8T$ @LL#)XL|$8T$ @LLDtt:!H6 f.L|$8T$ @LLDB6Hg@T$ D$(<P7wHHT$ D$(<P7wHHPƒ 5DHt$T$ H|$@@y4fDHt$T$ H|$@@Q<P=H5fDL|$8T$ LDL`7DLLDD4jHST$ D$(<WP7wHH;Pʃƒ: DT$ D$(<P7wHHƒ5 DLL]D,#H4wH@HE‰H=HkFHH|$ 8D|$(HWH9r<HH9t0 MHHA ?FH IwMHHHE1jA1}Ht$XZRfAWL=uAVL5AUATUSHH(|$ H $dH%(HD$1HHHD$0H$HD$AĉD$AA<w:AIcL>fDHl$HHhPvtAA vHT$dH+%(%H([]A\A]A^A_1@AHl$AHH tDAAA)AzD$HA<tHl$HHPvttAA +E1|$ Hl$AHHPt3ttMZAA p@I]ff.fAVIAUIATUSHHdH%(HD$t1HH9I҃Pv IHL9HbrL9BHZL%:2H4$H8豆IAPv 2HL9sHkH@yI9rfDHUI9t Ѓ@T$Ht$H|$@T$*DvHT$HdH+%(HX[]A\A]A^A_1@D$*T$HT$8Ll$,\$+Hl$ HD$  DD$ HLLtt$ \$+Hl$ AAA)AK\$HcA<I@Ll$,L$*T$LHT$8Lƒ fT$Ht$H|$@T$*ǐL$*HT$8LH|$,IH5H@HH)HD$WT$Ht$1H|$@T$*v@ ffDL$*Ll$,T$LHT$8L7T$Ht$H|$@T$* L$*Ll$,T$LHT$8Lr貕fAWDAVAUIATUSH.dH%(HD$1Hi*$@@IH-Hu:nF ws  )@@AD$<?H HwH|H+$J<HHЉ1HIn@A,$@VAD$<<@AD$H-H*f.fDL5($@žA H!A@HvIIL$I9wHI91LHA46?HHH HHwHH#$H8G f%f=HS)$%H 1H:H5uL wi  A,$@@A|$H*$D#@uA,$fAD$<AL$1/H|HfDFH fDAT$Bp< _ Lf.A,$AT$B<  HHLE1jA1LYqHt$XZYDHH1LjE1AL)qHl$Y^/訐AWIAVEAUIATUSHHHXEedH%(HD$H1CLHHED!HD!LDHLDrLu EAAHc$$B L }DADՃHT$HdH+%(HX[]A\A]A^A_1E1҄u}HLA@tu IvEtCH%$8tE3I0I1C1afDՃL$$@AHD$8A AHA!AEHI}H9w@HH9{DLILG ?AI HwHJL)HH|$8IHDDC(EH+#$Icl$(Ld$A0H\$DLl$ IT$DT$L|$Dt$,0f.D~A9D!E1DDEA@tH &$B#E11LLD$@HDT$HD$@DT$HILHDT$fyDT$HxtwH#$:wH|$@HefEOIB{82V&LH521 H|$@WvPCƒA@u1oH|$@HH"$8J DAuH;!$8u:DT$_DT$tH$H8G f%f=H #$%H L:1DT$H5'DT$3H $8uKH"$dAEI H|$@H@H} $80LDT$wDT$H@A@It1DT$HL$8E1LHT$@HAjkLd$PSXYDT$LiDT$T$l$(DT$Ld$L|$H\$Ll$ Dt$,7H$8#C1DT$0f.no]E1H9EhfHH Hv~ x{CH-HfAHE9~TH9vOHH)HHH H@E1f.H$HH$dH+%(HĨD[]A\A]A^A_ÃjXXHLl$`LLLzWD$mIHH9H$AD+ t@ktHT$HcH=rH1蟓IcH)H,H9INf 0 HN!$H8b识Xf.E1HIcH)HH9HOH9AH5k $H@fHH9sfDAH $H8mH@$A:u#tH5:1_Au;AFu/LcE1HLLLXLH9rH$AD+ IfH9AH5$H@DHH9fDE1EH9ADA: y~H=$ Hc4D!HvJHKH9w7HH9#DHHLF?A0H HwHAVH)H9oH$AHE9H90LE1E11ɺLpuHE@AMnE1HH9 D|$IHLHE3@H=z$@ƺ H!@HvHHKL9rDHI9DHHLF?AH HwHRHznHIAH$AHD9d$AHI9EEDE1H9|EsHd$f.E9WAHH9w?H9EAVE1fAHE9H9H)H9v^fDAAVHH3IHɍHI)/)ȉHI9@8@ywH="$ 7H!HvEHKH9wfHH9DHHLF?AH HwHRL*lHHg$AHE9[H9MDLE1E11ɺLqIH9=E4E13A:6|@y}H=$@ƺ H!@HvFHKH9rHH9DHHLF?AH HwHLkHHW$AHE9KH92=DH9EA6ANE1-fH$AHE9H9!9uSAA)Hf.D+LT$AH$8x:CLT$aH5$Aź HA!EHvIHKI9wPfHI9:9HIH<>?I HwH H$H8G f%f=Hj$%H LH5:1crfDLE1E11ɺL`oIH9pEgE13A:6@y}H=$@ƺ H!@HvFHKH9rs HH9c DHHLF?AH HwH2 LhHYQH$AHE9H92DESE1H9w+FfH$AHH9uE9l< uE1H9TEKADA:y~H=I$ Hc4D!HvJHKH9w HH9 DHHLF?A0H HwHb AVH)H9H$AHE9yH90kE#E1H9w.DH9$AHE9-H9$xAH=$HD@A!D9unfDE]HCH9HH)A6E1HEHHLCHHD9u5DE1H$H8 H9 E>H$ADD A'fDDiD9HH93EtH$D#<DfDADAXEH9wN1HHD\$h}D\$1A9PH$AHE9H9HHF$A9uEH9wN1HHD\$|D\$1A9HD$AHE98H9/HH$ A9uEEuL@H$D,A AE9TH$AHE9H9HyE1HHvH5$HH)H9 At A1C #D$9D$;D$o`8D$nAHAH AH9,DL$$DT$3HAVApAt An1x #t$9t$AE9>H4HH9.H0HD!A8HT$XH1HjE1AH/QHD$hY^qHT$XHHE1jA1HPHD$h_AXfHT$XHHE1jA1HPHt$hXZAHT$XH1HjHE1APHt$hY_HT$XHE1LjA1HoPHt$hAYAZzH$AD+ IfHT$XHHE1jA1HPHt$hA[XAA)H1APC S H$AD+ H$AMVHA)H9wHH9ƒArAA)HC? H$ HC? H$ HKȃ<Ѓ?H$ HD|$$Tm ED$lE1D$H9Hl$D|$$LtaLl$|$Ll$L|$wIIM9AmLHH suAHH9\$D9d$$HT$XHHE1jA1HMHt$hXZIH5:1T$$GT$H$AD+ AA)1{1{eE1{H$AD+ llkSs11{|$lDE1DD$K@@|$JH\$(HDaDd$4HD$D|$LLl$8Hl$@H|$JHD$(H\$8Ld$wML,(IfDIIL9d$AT$I4/LD)Hcdq˅u̓D$4D$4HL$(9D$LH|$(H/H9D$@veD$3"8D$$uX|$K@&.@M1@eH|$(W #D$9D$(Dd$4HH\$(Dd$4iS6181{*1Ax p SCPp AŃ_<A E11HHowE1TE1LE1DE1LxIGL|$HD$ IM@0HD$(+HUH @sHMt"HL)H wI9wDl$ fDH#HcNHEA;wA>mAAŃA u D9H_,HcH=HHH)AH OM\II9 :H5#H=HcH4D Ht$0ESE(AQHHT@HH9D9 uDH_RfDAI9L\$Dd$XL|$HHl$PD$8Dl$_H\$`Lt$hH<$|o|$8L\$L$DH_RH|$HL$NL$HjbH|$ HD$(HAH+4HHHHHDEH)ML9E1H<$nHxD[]A\A]A^A_fAH9rH$H #@)HL,HH!HcI9oHH?H I9uMHw LH@N\fDH#HH8MIHB EA>t; A;A>LI97_EH4$T$8HHHT@HH9v9uof.AEGI0t M8HA0fLA DHD#H5}HcHBH$HHD$8Dd$XE1DW|$DLt$h)AL|$HE׉D$@AA|$<1D$DHl$PDDl$_IH\$`@t_D$@HT$0D|$8AD`HcED+t$DDIfDIIcA9tAAUA;ut1ÃADD|$8D|$ID9|$<AHcD$9HOH.fAUIDH5 #H=DHH4D$8A L߉L$pkH$L$H$Dl$ oHL)H L.@AWAVAUATUSHH|$H$dH%(H$xHHx H$u HAH$H$H|$H$HHG0HHH+GHV8Hdžt8H$H~'fHHH@9|H#Lq$$H$HH$HD$HZHL$SHx H$HL$0uHD$0H@HD$0HL$0HHD$XHD$H@HD$A8@ 9C‰$($D$$,$HE#$H8HGHH$H]hHD$ E1DŽ$D@YD$bH$@H[E1D$HDH]#E1MƄ$HDŽ$AH(D$cH$D$RHD$(IDŽ$HD$hHD$xHDŽ$Ƅ$HD$@HD$8HDŽ$D$dHDŽ$HDŽ$HDŽ$D$THD$LEIfDAEA}I\1L9HDHD$HL$H@HD$ H9)HH5HcH>ID$(HD$@MEH=#1H5P^CyH(DI)HpILGt&LI9rHI9w̄tHM)H #IAi5L9Aƀ|$RIG tIOIwHL$IOHt$(HL$|$RMA?IHr#H8KH#8MHHD$H|$H9|$St 8BA}BA}BHL$ƒATs{HHL$IMDH=~1efDH|$D$HH9tH*#WD$HHxH#0D$HD$H9D$pt|$R*E*Hb#IHI9sLpL IH+#AL ID$HD$ID$HD$ID$HD$(M9A$xH#uH#$DT$pD\$ D\$ DT$p$C|$S;L$SD$bI}AU8bHH9Ht$HT$H9HDED8HHH9LH9L$w@A}JEMAEVH|$8 AHD$HT$HD$8H9PlMHD$Hx@t5H=#H$HH@H0H9tHMC@(HD$0A]H=|A4H=1|H4H|$hIH$#[H0HD$xHt$xH MHt$hLLHD$Ht$Hp0A}A$LL$IHl$fDHD$Il$AIĘH#I$xHD$(ID$HHI9oH#LL$L Hx'HT$H9T$sHHATAE<)(<<+d|$SHIvH&#A|$4;8?dH|$0H$DDT$pD\$ E>ID$8HL$@D\$ DT$piPHAXAT$D=HD$HH8IcD$@HA$|$SF;|$b6;EMME6H9HT$HL$H9HDO>D8HHH93H9L$uHD$XAUH@HDHD$xHD$hHD$0IcT$ HHaID$0Ƅ$D$RHHDD$xHD$xqH$HtwI|$0DT$hD\$ 8D\$ DT$htNIT$8H9$s)HD$xZHHHB1H9HBHT$HB0ID$0HDŽ$HD$xHD$hID$(H$HH@0HD$hID$(H$H#A|$0;8qcLD$0At$(A|$,A9q}у)HIH)HH IHf.IHDHHH9uHD$0A|$@WBID$X@=t A;D$<ID$HA$LL$IHl$N H?#A|$0;8^A|$@ID$XpA9t$<~H|$8HtwHt tE"YA|$l YHxjAT$mH|$HHH9T$aAT$`At$dAL$h"A:T$aa<v_X<t<v1H|$W !9aID$XDEtjAl$<^HT$0AH@HHH|$8H@t5Hl$HD$8PH[^ID$Xt 9uED$A$Ml$PE1LL$Hl$AD$S߀IAĀLA EAwS߃FSHHM=DE1{+{!A FIE AAG#A}HHHHFLIEFL$HDŽ$IEHD$`DQHD$XI9XH$E1Lt$(fDL$0HD$ H$HD$P[fIU@Kd\$0 fB IU@fACLt$(E1E1AD[IEDASHIӋh@AMHAE119I}A3L<EIEDA)BLI}ׅtAMH1DƒAIE\EtAMHA9zCI9\$!AMHHL$h<H9L$H}1E1ACHHHD$ gHcAgHHD$hHD$hH9D$HvP;$ HD$hD8HhIL9L|$E1EL\$xIDD:IELDAMHAG11AύxCH\$IEH9l$vqH|$(EADEusHL$H; G$H$AIUBf4IEHWLH9l$wHL$hL\$xECq+fH a$D$LJT%IHM!HH9@1HH?H H9uH$H=CHt$PH|$8E1E1 =H%H8G % =tLDDHI$H$H=HDŽ$A|fHH@ ׃@1AsAKH$AHD$h$L\$xD$xHT$hH|$?H|$IE(I?H|$IE0?L\$xHT$hIE8D$As@oHD$ Hc|tIcC1IH$ AC2EIE9rafDIE9GBEEd$uIU)DBDIMB9tAuH1B EcIEE9B\EBčCI9\$Lt$(At$ I}EEHIEAuI}IEH&@AOE1{{A5DMEE9:DHAHE9 EIEuD)Bw 3IuDdIUJ|:UHD$PI}DL$x$HH DD$0HDT$(HL$ mDHt$PIEH1H<HL$ IEDL$xDD$0J|8DT$(HL$P$]Lt$hI}HAE DH$IE$ D$PH9$H$HD$`H)HfCI} AELt H|$8HD$XH\$`HHEI}XH\$XH\$pHD$HIU(H)HfC$CHtH$H)HfAELHIEf8uI} HtHD$XH+D$pH' HD$p@8HD$p$ AEhHt$ukf.A;EhwUH@IE@H;@zH ']@HcH>E1@t@{S߀NADE1{{{qAE1{Y{OA@E1{3{)AKʃ߃SE1{AxE1{{AVE1{{A4E1{{AS߀FIt E1LaAE1NE1{A{7AE1{{AE1{{AxS߀F*It E1LALE1{{A*Kʃ߃SE1y{oAE1\S߀F5 It E1L;AE1{#{AE1{{A|E1{{AZE1{{A8Kʃ߃SE1{}Af.E1{[{QAfDHD$@S߃FHH AHD$xHT$h'HD$xHT$h8LD$xHD$h}'LD$xHD$hUHD$xLD$h_'HD$xLD$h HD$xHT$hA'HD$xHT$hIM}(M%AEdLt$ MALL|$@DHIFf8XD$AFHE1Hl$0LMMAH@HA9D9wD)A;T$sIt$D9luӃD$L$vwA#IH9X:FIFHS߃S+AHGS߀IAĀLA EASH€HEAAgSE1{A9SуN E1x{n{dAE1{KKʃ߃Sv}1{'A@AEdI} Z/IEH(D$IEHD$XHDŽ$HD$PABSE1{{|AfSTE1={3{)AHD$XIUH$H=H1 .oDH= 1-E1{Kʃ߃S{A,@StWE1Sуtуt bE1{U{KASE1؀%{{AAE1{S߀NAcSE1H€HACSуtYtTE1{~{tAE1{[S߀NKAStIE1+{!AfDE1{{A~E1{Af{S@@u A/{{AStIE1c{YAfDE1{;{1AE1{AfDoH=$1 +StvE1{A[StaE1{A.fDE1{{AE1{iAE1{QAff.AWIAVAUATUSHHXHG(VH5FH@T$ LtAFdAnHEfD$,IFADhG{8D$(`(#ooKHHD$HHHC HG HD$H\$(@XK#HIG(D|$,H|$@H@H|\$ _LHHHHHD$@HxIv-J<v$LHD$ "H|$@DD$ I)HGHIDu@A9tHA9v9wIvH ΃yu܋ t֋t$ H|$ AH \$ A9uD$ D$8LfD|$81҉t$,HD$ |$81HD$0IHHCDpD)D$<@A^H9A>A9wA9vڋD$x(txILHhIT$xrfLrhf.BFHt;Il$xHE HLD$ D$Wf.1LIT$xff.HIISI)HHAH HH ߃H<L)I9AAMuuDHEELLH8L!I9t[I1KL H H HHH HH!H҃HH[Ht8!@8t[@HHxH9sH9v8!@8uHH9t8!@8uHH9uH[HIISI)HHAH HH ߃H<L)I9AAMfHEEILLLM!M1K<L LI LHL IM!M9t4H1L!H׃HH[Ht8!@8u[@HHxH9sH9v8!@8tHH9t8!@8tHH9uH[UHSHHH $H=Τ$H7PD@HcHDMcFHDD@HDMcFƉHDƉE1)H1HHcHHEH)HRH @HHLHLH4#K8H@HH9w=fDMH9sHHHHHDK8HH9sH[]f.AWAVIAUAATLcD)USH@CHcH(HH-h$HH|$DMHH!H9H $BtHIc;1L=G$DL$IHfD@_vHX[ffDHX[fHfX[fHX[f {HX[@cHX[f KHX[ff[DHX[f HX[f HX[f HDX[HX[fHX[fø[@1H=$8ff.@AWI E1AVAUATUSHHEhDzZdH%(H$1H|$PDbYDŽ$H|$fD$HA*.A4$AIhE1HT$@ADŽ$Ƅ$DŽ$Ƅ$HDŽ$DŽ$fD$fDK CE^AM׸H Ģ$#A-H$8HC$M8EAAnE%HoIu AnaHD$@H$ $L$PAH$Ƅ$C $fAELT$-H@H|$H IH)H4OyHtFD AH$dH+%(APIhHHH ȃL$HL$@AHHtL$ EDC LAH-HEAƄ$DC ? L$PȃDML$PAƄ$C $CC AntHc$AM׸D$-#DuHt$@LEH@F@SE1E1E1A-D$-AnHT$HHt$fDt>@9AEADT8C P@8tAH4LH)II4trH>H9H|2H|HyHH)H)H닉ȃ<- H53HcH>A-)E)A0MqL$PAE1Ƅ$C ?DC H$AAAFD9CE9CfD^@FGE@C E1@HHxHHHL2HLH)H)HuH$LHHDŽ$H)IDL$HDHD$PHL$H$H$HDIDLH)H)H΍ H(1HCfAHCE1EFAH$H H_HE1E1E1fDA-Ie E( H }ſſ D$} }}}EDL$PE1AH$Ƅ$C $}uEH-HE1EmH$H|$HAT$BC D@DC }E1E1E15ȃME1E1E1EAAAHD$@H$DŽ$ſſHD$DfADfAL;@JH+@HcH>A;<H5+HcH>}IEHH7H}Epj@v< HE<L(<(HAn H-Hi}7}+Ew<6HHH }uEƃ@SB@TA<d}ZkEH-H} E1E1E1}z E1E1E1} E1E1E1}E1E1E1E9t2tHLH}$B0ssD$PsEAf$H$HD$@Ƅ$C ;@HZ&@HcH>@AAAAAAwt2ftgȃ &)}%H%AnfDL2LD$P$HD$DADDŽ$AD}\D:}a}W*@;@c;E1E1E1p}1E1E1E1PE1A}LDAA-f}µf}ß@FU@SE1E1E1}t}j=L2fL@}G}=}E1E1E1}-E1E1E1f0IiII1IE}}E1A}LDAA pEE<E1A}LDAAAAA}tfE1E1E1t}tuE1E1E1`}E1E1E1H}tlE1E1E14}E1E1E1E1A}LDAAE1A}LDAAE1A}LDAAE1A}LDAAE1A}LDAAm}t"E1E1E1Y}t1E1E1E1EE1A}LDAA"E1A}LDAA}t"E1E1E1}t1E1E1E1E1A}LDAAE1A}LDAA}t"E1E1E1}}t1E1E1E1iE1A}LDAAFE1A}LDAA#}t"E1E1E1}t1E1E1E1E1A}LDAAE1A}LDAA}t"E1E1E1}t1E1E1E1E1A}LDAAjE1A}LDAAGE1E1E19}tfE1E1E1%}tuE1E1E1}E1E1E1}tlE1E1E1}E1E1E1E1A}LDAAE1A}LDAAE1A}LDAAdE1A}LDAAAE1A}LDAA}t"E1E1E1 }t1E1E1E1E1A}LDAAE1A}LDAA}t"E1E1E1}t1E1E1E1E1A}LDAAeE1A}LDAAB}t"E1E1E1.}t1E1E1E1E1A}LDAAE1A}LDAAE1E1E1}E1E1E1E<#<<m<<E1E1E1tE1A}LDAAQE1A}LDAA$E1A}LDAAE1A}0LDAAE<<E<<&H5 HcH>}}}}i}_p}K}AR}-}#4}}}}}}}}}}}y}o}[}Qb}=}3D}}&}}}}}}}}}}}k}ar}M}CT}/}%6}}}}}}}}}}}{}qxE1A}LDAAKA7EE<E<_<HHcH>E<J<&1HCHcH>}tfE1E1E1J}tuE1E1E16}E1E1E1}tlE1E1E1 }E1E1E1E1Azxλa1ۀH\NW@6$"fDWH=> o1"xn\ZW@ƀADu 7%#W؀WJfW zp^fDoDH= 1WtV8GfD$D$ .fD4LR%*!A<) ЈD$ D$D$ D$@Wl IcT$IAl$L$IHcMFhLIL $D$X D$@~HD$Ht @gA싴$IAAMc; 1L$hLL$`LT$ LD$LD$LT$ LL$`L$h$OALIM. $O@D\$@H|$(HHT$0Ht$PEHEH|$(H9~HH)H)H9HHt$0H|$(H$H$H\$(HH$H$t D$X$=C;|$\0H\$HtD$$$B$@tHD$@Au4HHH+T$(H;T$0HD$(HD$0I98qH$dH+%(CHD$0HĘ[]A\A]A^A_fPHHE1H|$HAD$HH$H$E1H$@H$H$H3D@4N@* ¸H OK%#AED$Al$IMK4@HjL%@ſ H!@HvHI|$H9wN7@HH9=7DHHLF?AH HwH 7LڶIA$MD$H$ EE $t AH$HH)HD$0H96 LL$(HH)I4L9HNHt$(t=H|$1HHHHHHwHH9HHHMHGH L$$AB<*E<4=EMbLT$ L\$赗L\$LT$ EH$HEE<$LIAz-LT$+LL]HM%LT$H$HHcD$A@!$At'IwABH/HvH$LL$Ht$H$H$z-t @(HHt$ 1LD$H@(HLHx0HH0zLD$$MAp.L$Ap8$t-$*$-$H|$(HD$0HH9HH|$($ L$f@7vH'B%F<AA$ HD$0$tHD$$HDŽ$H L$AB<)HHcH>D$VЉHF<&AAtD$$D|$@L$$D|$X‰L$hLL$`H׉LT$ LD${L$hLL$`LT$ LD$WLLT$0yHHD$(kHHD$($HD$H$ LL\$`LT$ HLT$ L\$`MHD$H$LL\$ HL\$ $IMK4@fA,$L$XHT$HLD$hHt$L$DD$xDL$`DD$xDL$`D$hL$Et-H$ LL\$xD$hDL$`DL$`D$hL\$xH$@8jHD$hIL|$L$XLHT$HLEIGIHH9tHIGHD$L$@0$@Ht$1@L$XHT$HL L$rHl$L$XLHT$HHHEH$H(@ % =H$L\$ L\$L$HMIc@MAx=M!AuA@HD\$XHHHG Eu%HHWH)HH9HHNHD$HP(EZMbHp$ $t@HD$A|$'H> H118HML$HE0D$`M⁤$D$@D$XD$AADA|IDt$@*}@4sA$HHHP6u |$* 4 8uJpHAHw4/t.u*H>%Du|$tPPfE H$q@o9HcA|HcQ#H4H$ATA|HTt"@*@4HHHE1$H$DŽ$HD$hL$XHT$HLE1Ht$L\$xDT$pDT$pL\$xD$E~ E<mIcD$Mc|$HD$h@o8A| IcD$GIH$L@CATA|HTt"@*@4HHH1H$D$zZA$$MHD$HH$Ht$l$XD$p%ƒ@E‰HDŽ$$EI߉‹$IH$MDT$xD‹T$ ~L$$H$H$RWLPj$P$PLL$8HT$x~Ht$8H0DT$xHL$HtMINLEEtHD$H$H$%MjHat$,$H$$%=H~HHHL95HMLL)H;D$05H$LT$0HHD$ H9WH|$ht$@ t$X'HD$ HT$(D$XD$`HHD$hL)HHD$ HD$H5Āt'$HD$PHt$0H9HOHD$PA|$CD$p%\$\$D$`H|$D$@HD$ HD$(tD$ptHD$LL$$$ ADA|ITt$@*@4A$HHHJA<)D$A$tHD$HA|$HHD$0ADA|ITt$@*@4A$HHHH$HD$L趁HHH訓I|$0IL$01HH聦uuH|$H H @(l8LT$ L$ҜLT$ L$IIHL`0IHAPID$(0H|$hHHZ $8L\$ 9 HH$LL$L\$ H$fo$`Io8>oHNoP V HP0HV0$fo$p`fo$$h H$HH0IH|$ $ Ht$MD$D$H~~HD$(H$E1L$H|$LH)HHHHH9tLHOH9HH?H?HHHD$hL)HHH)HH9HHLHt$HFL;|$hL$XHT$HLILL$@qLL$@Mt||$tuIoE t \'LκHLL$Ht$H|$(D|$XLL$HHHFH)EHV Hu HFH)HHD$HP(HD$@0MAqkD$`AqD$@HD$ HD$(I׸H 0%#@o0A|QIcD$%IH$D$AH$DŽ$HD$hA$VH|$D$pHDŽ$nAxop $H$Ht-p@o/HcA|W HcPHH$D$`D$@D$XHl$L$XLHT$HHoE0$,HD$H11HH覀MHE0$ 5H|$hH|$AD$IxA|$gILLLT$H$H$LH$~LT$L$HARHl$E1HLH\$ LUH$AD$4H/HwHAIA8uHH$SHAD$IH9vEu$Hl$H\$ I-NHHHI H1H0#LǺii I @..]L|$L$XLL\$HT$HLAG0L\$*AT$;$Hc;$H|$HHH0HL$LZwLD$裍LD$H,HPHLHP II I IA$i$L$XHT$HLHt$.L$$H$E11LHAjHt$(_H$(XZHt$HD$H@LHHH@H IM9 ALǃA$ƒ߀AvFSH HcH>D$AE<D$H|$81HDŽ$HAHDŽ$AD$HH3A|$A|$3H$`LHD$HA|$A|$AT$Ѓ߃S<iA|$]AL$߃FwHHAAAEA$ЃIvHINHMFHH)IVXL)I;#HH9|$0|$@ |$Xt$@E1HH|$ t$`ZH3 %LǺH$H0sL$H$$I…ڻH9$̻$@L9DI9LHAG@ofAT$A|HcuAD$MIF(H@HDHD$$[$!HD$Hx(HD$HhPLxX$t&H|$LH)H/HGI9D$XHt$(Hl$0HH9tHL)H9|hII)L|$($$LT$HtBHD$H$ LH轋LT$$HHD$(뒿8x HIH$o$HD$LLT$HHƉ$H$ HhHD$H$ LLT$H軉HLT$9HD$H$LHLT$$HE1xhND$`E1E1HLT$xL\$hH$H\$Ll$pMŋ$H|$81HDŽ$HHDŽ$HDŽ$H$<HH$@HH$HHD$(H$$+Ѐ $ EHD$HH(D$`AfMIH$MLH$D$ H$P$PRj$P$PHT$xLL$hBH0HAuH|$h@΀<(HHt$HFPHH9HOH$H9HHFXI9LL$8\$\ĀHt$0HT5Ht$PH9HNց$HT$PHt&t $<$Ht$D$`D$`9FhLl$pLT$xH$HuD$@ID$X*@oHD$h|t&IcEtMl M,GE1AEH$`H$ L膆L1MfH$`L$HH$H$$H$PH$H$@H$QH$ LL\$hLT$`詍L\$hLT$`L$XHT$HLL\$hHt$LT$`zL\$hLT$`vE1KwL$LT$@LpLT$@HL$xHL$HpHHT$(HHHPHD$@0mL)1ҿL\$ EH5tE1EIVHL\$ HINMFHH)IFXHL)I;uH9HFI9ICL)IX H5ȑH=(M 1iwINMFL)L eH~ uL l{1H5PH=%A1#wH$H=݉Hx1woH=G 1vH=F o1voH=F 1vQNAT$AЃ߃S<E1E1A|$A;< HHcH>H|$@tAxFt A$H$APA$IHt0At$LI+VhHHI+FhAL$IHHHLT$H$E1LAD$mA@mj$Pjj$P$PH$HT$x"H0LT$DAD$E1<oE1A|$A]E1A|$NE1A|$AE1<E1A|$AE1A|$E1A|$AA|$E1A|$AD$E1MN0MF8 1H5ˋH=? E)kqAD$<<E1A|$A,AD$E1<E1A|$AE1A|$E1A|$AAD$AD$,J<H`HD$@AEHHHXH$@ D$% =Z$H$bH9:L^ IEHX`HCIEH@fIEH\$`H@@H$H95I»E1Lt$(HH$MAHD$PHDŽ$HD$XfD\$0HD$ `IU@Kd\$0 fB IU@fAG;@(H _w@HcH>E1{{AGE1{{A%Kʃ߃SE1t{jAE1{K{AAE1{){AS߀F!It E1LAxE1{{AVE1fDH$H$$_HL$@LD$hHHHIHPHZH9zH;X<HXHH+HHH@L+HHHG80L+qfDKf@$H$_H|$@HHHHqHFH9MH;AHAHHL+IUH$HD$@LD$hHHHkH|$@HW>HD$@LD$hHHHHH8HwEwHH8H5ww߀Au FH rHcH>E1{{vAA9A)cS߀FIULLE14H9T$HDBEE1HD$(Hl$0H\$pI9_XI_XHDŽ$H|$@HHT$xHD$h D= 3IfAG-E1L9|$`.DI}Lt$(AudIt$HTH|$PIEHMIEHADE1Lt$hAE1AEBAID9d$I]J;AN1HzHt7_݃~4Df9Bڃ9f9s9~DDAD)H;D$P%AuHB6D)f9uCAÃHD1Ht7A9~E)E4ANL$0DL$(D$ SIUL$0DL$(D$ LPV1SAWHHH\$ HcHHH$H$H9\$HK;$ H$HXHHD$H9NH$E1۽L$HD$hEHL$(ADEH|$H;= $H$AIUBfMEHIIxHHf9D1HtA9~H|$DEN,Ix7oH9fIEDHD$PHDDtIEEH$LH$T$hI4H9w6LH=IH= D$lEˆD$lANt$F< H$HKhE1H%L TH$TLB@)0HC8HL$8LL$HH)HhHL)L)HH9HGHH)HItHHl$8D$hD$(LIwdHChLL$HBD*HChfBDHShLB<*`<4HJHL$ JHl$ H$LHBTD$*LLt$HH$IdAGD$+`Hkp{H%HLmHD$rHHHShHD$1HShDHShfLLS8IBH9sAD$<<d <'<{MD$L{XHCLC@L+CHMLKI95I1M)1L@HI9LG1AWVH5A W{HL)xHH){HC@8?IHSHHHLKH)HCXHL)H;HSDH9HHFE1EAH9`H)H(IHDѿ1VH5SD R?ARHSHH HHC@HH)HSHCXHH)H;HKH9HGH9HCH)HhfDrHH HSh1HShHD$DHShftHL) HH)Hs81Hx9HC@HsLCHHC@H+CHHCXH9HL)LK0LC8N1H5 H=P E)L|$)HHшL$WD$WGLL)HIL)HL) HH)LK0LC81H5[ H= E)BLL)11ArA 'ǃD$hIWH9(HWG HINCAL$D$hIWH9H$|$WHChD$2HH)H"LK0LC81H5 H= E)uKD$  KHHH%Hc<8H$H$HL$;EtH$H= HS@H8HHHBHH0H v9 9HS@HsHH+CHHCXLCH9H1L)H9HGPWAH5J> H= = 1TJP*4P|$Wƃpr HHc HShHD$1H$HShDHShftHC@LkpHEH$11HHC@HߋD$PDqL$hA[A]h%HC@|$,L$H$HD$`HC@|$W-%D$.HDŽ$HEH$M)1.@wSH|$(Gyb=dfDIċ$Hk@ $ Ѓ`LCHKL 7L)H~ uL LE1҃HcAH=: 1DHf.HC@HKLCHHC@H+CHHCXH9I1M)…H=; H9HGLAP1VH5^? 1H9HuHS@H0H &H,HS@R9i9kHsHH+CHHCXLCH90HL) HH)!IM) HH)*Lt$0`uH%HHkpE1pHHShHH$HShDHShfDlHEHCpHC@LK0LC81H5 H=r E)FH|$(uyb1HSLH+CHLC@HCXHsH9HE1H)@HH9HG@P1AQAWVH58 QHL$XI)V ǃIC|t&ƒQ Lu 1@ƃJH$H$Iċ9 t HChBHChB|JuƃpHk@1H߃$HHH)II)ƃp 'ID$>HC@LH$Hk@HcH$IHSHH+CHHCXLKH9I1M)ȅDT$8@HH9HG@D҉P1VH5! WH}%HHkpH?HShE1HH$HShDkHShfDTHEHCpHC@YHL)LK0LC8/1H5 H= E)xDD$6SGH$HHS1D$. PLK0LC81H52 H= E)DHz%H$HL$ H8M$HL$ H?7HChD$mH|$.t|$,i|$W^HChD$1HHL)HIH)ILK0Eк}1H5 H= E)jCLK0LC8u1H5^ H= E)ECLҾ}LT$ L)LD$IT$LD$LT$ HIHH^%AL$ HHuOH HHt?-E1H0H |IBH9HS@H%AT$HHu$IT$HHS@H HHt}D$WD$-H$DL$HH$HcMsHjHa% H HHtL95HH+CHHCXHS@HSLKH9nI1M)ȅAR@H9HG@H P1VH55 WdIAHSHC@H+CHHCXLKH9v7I1M)ȅDT$8AS@H9HG@D҉P1VH5 W HL)HIH)H)IMMH$L$HAjHE1LH$H$L$A]ZHHHH{HC@H+CHHCXLCH9HL)H9HGH=3 AP1VH5N K@HL)HIH)IT$'HS@<{n|$.D$nD$mD$WZD$ofHL)vHH)WAVL$n߀SDȸL$nL$WDȈL$WǃHS@HEH{LCHC@H+CHHCXH9vH1L)H9HGPVHL)VHH)H$HcH HAHS@H0H 'L)I1L)IA)A HSHIIHHH{H)HCXHH)H;HSH9ILF1@H9HD$H)AHH L< LLEHD$(AQAASHt$(VH)H50 WHR1 HSHH0H`HC@A HH)HSHCXHH)H;HKH9HGH9HCH)HL)I1LK0LC8LѺH5 H= 1E)=LK0E1H5 H= E)g=9xHD$(HtHffycbZLK0E1H5 H= E)=A|$-uI|$H0H 0GHH0H vHsHH+CHH{@HCXLCH9H1L)H9HGH5q AP1WH=5/ H9+ Ld$HIH;\$(:Ht$XLHI+M@L)H AtIu8HALH$q H %H$LHzLK0LC81H5T H= E);:LK0LC81H5/ H= E):LK0LC871H5 H=q E)9H)HT$HHnLK0Eк1H5͛ H=4 E)9L)H|$pH9s;L)H1WAH5 H=8, P19IM)H)WLPIM)H)LLCHKL |'L)H~ uL V=E1҃HcAH=. 1D 9LK0A1H5 H=i E)8LK0LC8LѺH5ܚ H=C 1E)8LK0LC8LѺH5 H= 1E)8~E)ŅHsHC@H+CHHCXLCH9v1H1L)H9HGH5=, AP1WH=* "8HL)HH)LK0LC8LѺ"H5 H=h 1E)7H$Mt%HS8H)HH5Z% H9HOHHsLCHC@H+CHHCXH9vZHL)H9H=&* HGAP1ASH$Z7LK0LC81H5N H= E)571HL)xII)fA$ssIl$&H5 H= 16LK0E1H5 H=R E)6LK0LC8LѺH5Ř H=, 1E)6LK0LC81H5 H= E)6H H5 1H=% h6H5f H= 1N6H%McB@@LK0LC81H5 H= E)6HH5 1H= 5HK@H5 1H= 5H$3H5 1H=d 5HC@H8H?HLL|$pLLl$xHD$pHl$(MIƄ$D$xH$1L$LLL$ AH5%E1H$I HL$(H9 HHL$HL$H)H ƒ߀AtyހHtoJtjۀSt`Fw@H@uH;<5HN HcH>HD$HE1@H[$wvHHuhH$H%% @= @Lt$(LHs8LDH$LE1HHD$(H|$HILsO L\P L5O L1HHT$(H)Hу߀AyFMH5]N Hc H>H|$H1LHAHD$HkHHHAIVHH+D$H1HH|$HHHH)HxtvI9s LGHL)H~O߀FHH@|$xHL$XL)HT$(H|$p>3H|$X43Ll$H߀FSrO߃S_HI9?L|$@Lt$0L+l$ $uMH$LCHKL @ L)H~ uL 61҃H=F' 11H|$p}2H|$Xs2O߃FIILـM+D$ D$(OI9s5HT$(H)HXу߀F`cH5%HEqMLt$0L|$@HD$H߃AHH@H$0H3%H% @= @tMt+H$HHu H %H1Htfss1HrHl$HbހHqwGHHHN߀FmS6W߃S|WtC Wуtуt +W؀WtLʃ߀AFIcL>XW@@-Wtd IWуtـt/t*Wt,Wt뛀WmzpWuWtɀPу߀AFw:Ic L>у߀AFw-H5F Hc H>;IcL>;H 0G HcH>WW {qW߀NaROʃ߃S4*~zWH€HX3Wу'WtW@@@oW߃SWHteHHD$HƃߍNw HHNAAFƒހH8HD$Hƒ߀AހHJۀSwFw@H@[;<HH#E HcH>HD$H@<;E1<HD$H@ƒ ƒA<ARHD$H@ƒDAsE>HEHEH@HEH@HDh0Mt MN$HL`HH@ HH@(H[]A\A]A^A_ff.fATSHHr%L MtzI$HH%HHі%I$HID$HC HtQHfHHS @@ H@0I$LID$H[A\f.+IfD0 (\f.AWAVIAUIATIUSHHHqHQHHHHI|$HtHi0HH)|MHAE11A0HHLL<H9I$LxN, It}IFJDH[]A\A]A^A_DHHiHCHH,HHJ<+Ht$^I?Ht$IHMNHII@011E11HHu1I)MLH= KIHA0L @HH1LHEhDH)HIH=uKHII<Ht$I>Ht$Iu M0MOIIIA@0M1E111GD HMHH҃tFHHu OI@H9L9MLM9sHHH҃uHuOIH@1HEH[]A\A]A^A_fDH]FH91HtHt$IMOHIIA@0t@HI$ H@I$HBHH9HBHBI$I|$Hp HH9HB^ID$@L}DIWH>IHA0L @HIvLH)HH=uKKAI@HWHE@0HL)H0HH)HtjHINHHNH4EtH>HHE1H9uoHHLAHD@HtS0HH)HtCE1Et0HFE1H41H>u8fDHtHQNE1Eu+DEADDHHaHuI:ASHHH[0$Hu[ff.fHV0IHHHB(H~0HHQHuHA(H@0HH@(1ÐDI0HHq(L)H9vHLN H~Hy(MH9w*MuHP0HHB(Au#DHHq(O Tzx(?f.AWAVIAUATUS1H(L-%dH%(HD$1FHD$A|uAFƒHW(HRHDL`I$M|$H@HI/ڃH:H1T$1jHRT$HD$HDŽHAAAFE1A| A~A~|txE/iH|$HxIH|$Hxu11HD$HHw%HL$1H0NH|$fHtHL$AH*H|$HD$dH+%(H(H[]A\A]A^A_H{%HL$H0_AFH|$A|M~E1E1DAADAEA DsD=t=A ƒrA ƒsdAŃ=uAAHD$HAtE@A~H|$fDA11gHHD$Hf1DHHHHD$#HD$HfD1H|$Hx0zH|$H iiHD$HHNH1HHD$H HIoDHx%HL$1DD$H0H|$DD$00HD$HIIHD$HI$HxYIoPAHHL$DD$H#%H0#H|$DD$VH%HL$H0H|$ff.AWAVAUATUHSHHL%|%BA<HE1E1I1H{0Et8EA<tHHK0L1[]A\A]A^A_qf}ufAt͋C( E(C(t1ADtC(EEAMADD !9uH1AAD#c(E!HC0HDc(D2EAfzt.H}It)DA@DLj0D1ff.fAWIAVAUATUHSHHL5z%BA<toHE1EICA<&HLCA<DALm0E(tC(E(H[]A\A]A^A_fDD"Df{sHވT$T$I1{tDD@AE ETCA<u f{H}01HM0LAE(H[]A\A]A^A_ÐE(H}0AHM0E#C(E(HL1[]A\A]A^A_"ff{DHLuDU(EDC(E111fDDt A ߃ڃuA!1EDDDU(EE:f.Lk0IEH@(Hs0HHAHy0HH)HHA(H9HvL HuH}HA9ANHcAOKAG<AAADAD_AGH<oH#H,Ld$G#1H5h' H=ϓ E)O1MO0Aغ 1H5=' H= E)$|$sGL $HT$hLAƇsrI茬HŋD$h`D,$HLLADCHL辊DHLHոAƇsI@IWHI+GHIGXIwH9HE1H)1EAS@H9HGAP1APMWVH5 QL9AƇsHD$@D$D$ 1%MO0MG81H5% H=^ E)L1Ҿc?LIyHH) II)I3oH= 1MGIOL L)H~ uL 1AHcH=0 1II@]/HIGXIwAMGI@I+HHH9vDH1L)H9HGH5( AP1WH= HL)xHH)bHL)x-HH)MO0MG8#1H5$ H= E)MO0MG8"1H5$ H= E)vHt$HHt$HI+HIGXHIwHMGIW@I+WHHAH9H1L)H9HGH5 AP1WH= HHMOHBIG@I+GHIGXHIGHH9HF1A@AaA8H9sLL)E1VH5 AAPAWAQI1UH8HL)xHH)7IM)x/H)ILMO0Aغo 1H52# H= E)MO0ALٺ H5 # H=t 1E)H9sCL)I1QVH5 P1W豃H9s2L)I1ARaVH5 P1W芃IM)xH)MIM)x/H)MMO0ALٺ H5~" H= 1E)cMO0ALٺ H5W" H= 1E)<% =H追HHC1A9<HH9|HHHzHwCuH9rs H蓹HHBAHH@ H=] 1覿 ܈HH"L&HHzH8HIE&H98~;HA&HHK IHHh 3H=Х 1AHH迪I@LιHIUHIEHHLaL9L;`zL`JIEMeHPHZH9}DH;X)HXI,I@I_8DQ:HL躥MeIEIHE(1@!@.Hh%HEH}H@HD$`vT$LAqIdžu$H9&HH;4&uB: t HfD$$pD$8$p$pD$pD$%D$H$pf%fD$, @H\$hAF|1LLAdžIdž8Adž;^I^I^XAHD$`I^HHI^0IF8IFAdžIF`IdžIdžIdžIdž IdžIdž Adž(flIHuI~8I+~0HHIH(芪IF(HH@!IH1HP(~HIF HHL$ IdžIF HH $IF IV f%f D$,f$x tIF(I0HPIF(H@HtIF 1Lǀ$I^@AHIIF(AFxAdžHP IVhHT$\Adž(@ IFpHD$\EEkII o @t"IHqHT$`Ht$hLOzIcIAdžHttIdžIHtXIdžIHtUE5@>NHLt>HHHI<II~ A AADDD N||H|*(46HHHH$NDFA)A8IN(D^LAODIxPJ AL&AAGAAEH1AAE!E01H=E1z1H=H$d1H=sH$NƄ$H$ H$ H$ H$ HD$pIV(H$H:jH$H$H$H$ILDLl$xL $H$H$jjLPjjjLL$@H$H0AHt$L1LL$A#H$ HD$EI}IcEHH@HL$IV JHRxMt*H$H HIHtH$H9$:AM(AɃAHuE3t A%AI}G NH|HDI}LDJ| I}IHtLI} M+ELTH)LJ|(EttA6EI}kIV HDHHJxIUI+U HHQIN IUHAxHPHH9tIV KIM HRxH)LIE@I0MgW~IV(HHt@<wHIF H@xHxHxtEtH$ H$ H$(H9IF HpxHHH|(H~xIv HvxH|H~hIv HvxH| H~pIv HvxH|H~XIv HvxHDHF`IF H9vt @IF HPxHzhC`IF HHxHQhHHz(pIF ]HgIN @D NDD|NDtW*46HHLfIN HfvHHLDLl$xML$H$H$jjLPjjjH$H0$ @)5|a<<@R&vHH>AEEt E^|EA IF 1dL &H &H@H;"&L8AG LuaLH+&L &H &H"&HHL;=]&f.1Ҿ IUH D&HPH)HB;IEcAZIHx H&)#IF(H0E  tIH &H A8uk t9Ht$`BHHD$ $pHH$zd utHE@tHH@tH&H@8tL~L i&H :&H &L$0LLKL$ HD$pAk1I8HPXbH5 L)H$ L'IF(8HhIHLDIV(H$ HRoHoIJoQ R HI0HJ0IV(HJHHIF HDŽ$ hEH1LDL$,DT$ HL$dHL$DT$ DL$,H1]'LDJ|1oH=_ 1AHAADL Q&A# *#4x$H( o/|Hc@(ә|lA`EY1E1uHQpHzpIA9 LcH(EmB|IF @MFIFuL EH5 H= L)HHNH|LN1E1輍Hx KMx(H,A>`uGIF H@x7@&oDH=x] 1a蜁DH& %H5 LRH$ LPIF(8L`>IHMIV(H$ HRHHIV(HJHHIF HDŽ$ +H<$?xD$\HfDHH &1E1dH%(HD$1H<$HE1jVWZYHT$dH+%(uH艀fAWAVEAUMATIUHSHHHT$dH%(HD$xHG@HD$`H1Ht$`@L|$`A?{L}@MH0&HH]ppAHJHUhHE1HUhDHUhfDDHCHEpI$AMUx UxHT$xdH+%( HĈ[]A\A]A^A_HnAF  MH=! LT$LHHHD$GzH5; HxoHD$pLT$HD$Lu0H]8HL|$LT$IGHE0HE@IHBHT$HE8HEHHEHHEP$HrLT$I$HEPLu0HEHLU@H]8AwH AwI<$D$pƒ` AUD1f1Ht$`4>L|$`A?{L}@@Hu81L:vHM@9{HuHH+EHHEXLEH9wRHL)xWHH)DžH9HGH5 AP1WH=%| pHu81LueH1L)LM0LE8A1H5< H=W E)#LYHE8}HL$L]@LHL\$L)HD$ [L\$HL$HIEu:Dž%pEtxAM 1<|$HsLH+CHHCXLCH9HL)(HH)DžH9HGH57 AP1WH=:p }Dhw%H9.-Lc@HDŽ${ HHHHHHHGHD$8HHkpNf<#~*AHH1MII!<\H$?HGH$H$H$H1/Hs8H$H9vPրv INL$EHs8H$H9Lt$HL;|$XIf.ID$HsHC@H+CHHCXLCH9H1L)Mt|$)DEH$HHH$3Hƺ̃HH"T$h)I9(11Lb{HL)IH$D$lDMLt$0L|$@ImHHHH+t$8c8L$J MjHChD<{Hs8H$`L$L$1L$Mt)H$LHLD$(LL$ 8LD$(LL$ M99#M9HLLW8HAH$HC@*D9HT$cH4HSHH=HC@LCH)HCXHL)H;HsDH9HHF1EH9'H1L)WAѿ1VH5Ui `AHSH]A]Ht:HC@H)HSHCXHH)H;~HKH9HGH9HCH)HH%HShHL$fDfD$A$@HChB|Hs81_HC@HSHHqHsLCHC@H)HCXH9RH1L)f.H9HGPWAH5=e H=d 17rHL)HH)DžH9HGH5 AP1WH=d qD1I^MB"MH$L|$@Lt$0DHD$8@ADHHD$ f|$)|$*|$n-|$o-|$-%HChHȀ|$,&t$@.u|$l5E@t$|$@xHChHP*c4ZD(Hkpt'HKhA<*<4 AH i%I9tD$m $H$HC@HA&$Ń Cx DCxL@H 1HShJ|$PL$BHShlHShDlHSh9jf| HShfLH{@HCH$HT$xoHT$xLAD7MH$H9s)HT$p>H)H>wHJLH5): H L]HSHH4H$LKH)HCXHL)H;HSDH9HHFE1EAH9Q+H)HDIHDٿ1VLRASH$8HSHH HH$H)HSHCXHH)H;YHKH9HGH9HCH)H8H1L)H1L)/fD1ƒA  AƒA K L>H%*Cx @Cx5fDAzD$hI9&H$A6INL$@ʉȃ AOA QHChHȃt$|$l3E@t$l@H9k@qHKHHUH\2H)LKHSXHL)H;LCL9MLFE1҅AL9LH)H/IH1DASH5] WAR5HSHH H$Ht:HGH)HSHCXHH)H;~HKH9HGH9HCH)HHHk@LS8g0AD$MD$L<{$E1E1<-uI|$AE1H{@H$H$DL$L$7a$Hs@HCLCHH+KHHKXH96HHF1҃H0H *-H9H-L)WH1PMfMu"H9k0EHAHq&HD$`HH9vEHAHw }\&HSHHEH@LCH)HCXHL)H;oH{DH9ILF1EH9IH1L)AQH5Z A1W3HSHAXAYH$H#@Lc@AUE1E1H$HHjjqP$H$H YHAHC@HHC@@HL)Hu x{HHk@NL$AH}H$DMDAz'Aa} AQwH  HcH>H1%McB@@ƒHAHw }{LCHHMM@HSXL)LKHIM)L;HCDH9ILF1EH99#L)IHHH5pX 1ASAUQ'2:1L$H$H$LPjDqL$Z^_>L$MHSHHH$LKH)HCXHL)H;HSH9HHFE1ۃAH9$H)IH>IHDLVAUAS$1H5U LHSHH H$Ht6H)HSHCXHH)H;~HKH9HGH9HCH)HL$9HDŽ$ HEH$HSH9HHF1ɃH9$H)IM'MLPVAUQ6@H;k8#LCHKL NL)H~ uL yd1҃H5x H=( 11`HCH+kHHkXLCH9vH1L)H=R H9HG1AUVH5 _HkpDKHA%HELmHD$'rHHHShHD$E1HShDHShfDDHC@LkpH$Hkp{H%HLmHD$r HHzHShHD$1H$HShDHShfLHChLkpHC@HU%HHkpE1HHShHH$HShD7HShfDlHEHCpHC@$7DEcID$HsHC@H+CHHCXLCH9H1L)H9HGH5)P AP1WH=P ^CID$HsHC@H+CHHCXLCH9mH1L)H9HGH5}O AP1WH=oP ]H#%HHkpE1HHShHH$HShD'HShfDlHEHCpHC@$ID$11HH$HHC@D$PDqL$A[]L$Hk@#D$ Lk8D$DXL9 A|${ D$(LAD$HH)}D\$0D$8^/IL$HK@IHAT$H%DT$(D\$0HsH+CHHCXLCH9v>H1L)fDH9HGH5+ AP1WH=M ZHL)HH)@HL),HH)q1E1f| HShfDDA9A7H$L$A0t~(AQπ#EH0H ZL$H$H$LHT$xLT$p'TLT$pHT$xtH$H9|H$HLA1HDŽ$ADŽ$Jj+H$H$IHH$H$H$AZA[$@HT$xH0H L$]L$H{HHT$xHt$pHHJ"HLSH)HCXHL)H;IH{H9ILFL\$xE1ۃAH9H)IH"HL$pHK8E1EؿL$D$(H58K AQH1$AUD$ASL$DL$AHSHH HRH$H E?H9Hg%McB@@RRAI w"IAτ o  H%McB@@DhH L[HXL$ IT$LHH{@nLK0LC8O1H5D H=% E)+WH@ H-%HLkpuHUHSh1L$ JHBHShDHShftIELLHCpFLWHHLkpHHShJ1BHShD=HShfLIEL$ LHCpfDL?HCx :Cx/HL) HH)fHC1LCH)HCXIM)L;HKH9HHF1҅H9s H)HMLWA1VH50J #HSHXYHHC@HH)HSHCXHH)H;HKH9HGH9HCH)HoDƒA AE4LK0LC8H1H5 H=k# E)TLK0LC81H5ܶ H=C# E)TAHChH@HCht$4HȀ|$lE@t$]DHHHH1HIHxHHHv~HvoHp/v`H{vQHjHhHv7H8/v(HH?HH.fDHa%H83HMH$KD)D$Ef.LSHL<HHChAfF\LK0LC81H5ܴ H=C! E)RHE1H)H)HLK0A1H5 H=! E)RfLK0LC8+1H5t H= E)[RMHǃHˆT$WD$-jA 1A D$ HLkpEHT%AD\$tHHShD\$1JL$BHShD\HShfLIEHCpHChB,HC@1|$)H$HC|$-wH<$1L$8 Ht$H$8HH/L12!H$8/H$8H$GR0HH9yHGH<bMO0MG8L(H5 H=j 1E)C#8II(Au/H<$H$ppAIALDAIƹ1҃Dl$PAH%&LH8#HHCI9H$@H9$`H3$HHAtMH $&IcA/uA.t AEh.IFHAF DA/HG&HLL$8H8LL$8uCA/-tHstyH|$tBLA,H}&IcDtLH$8H1E1IIAA!Eh.bA6ŀPp$HH`*L|$HIHH$0EB4AH9*HAEHH9rLIL|$H1H$(H$LH$0H$HHu(HxHHDŽ$8IH$ HD$8AAGl/mD$AL)H9HHFHHHA8u HIH9wH)IHMAHH&LMgpDD$ApqHHIGhH<$JBIGhDIGhfDIGh$B IWh$H>0HCIGpDD$D$R0HH)GHKHuUHH$1ALdH1AH$I$MH)@H$11AJA$$zH&H@LMgpHAReJHtTIGhLHBIGhDIGhfDIGhF4IhHHYCM_hM LLD$@H$1L)LLHIGphD$*VDL) 11HH$IM@11LH$9@$IWh:$t+BAƄ$))BDIWhABH$H DH$h5LAIAGx HI9 1IgH&IcƋ%@EAA.AIIIHI1iIICVIx0CI0I I IIIjHvDIIA+iIHvIHKA-@A-]A+H&LA3H85H HEAA3H<$L'HD$0E1`AA-&A+Lٺ)H5{ H=" e;DH\$xHE1IWIwAH)H9DFHI+GHIGXH9vlHE1H)AQ@H9HG@DAP1APWVH5 QL$Dv&=L%H5ܜ 1H= :@HH)^II)L$HD$难Iw8Io@1I@AH$8H$PD$PDL$hL$@C?^_IwIG@I+GHIGXMGAH9H1L)H9HGAP1WH$HH=, 9LHuH ;&Hc‹%@=@t L$оI_t|$XIwHIO@'HMOAH)IwIGXH9IE1M)ȅS@H9HG@H5 P1ARW:HL)HH)&L$8MIWHHIG@MOH)IGXHL)I;IWH9HHFE1AAH9H)HIPD1VH5p+ RLAT$P!IWHH Ht:IG@H)IWIGXHH)I;~IOH9HGH9HCH)IL$I$WMO0MG8'1H5? H= E)&8MO0MG8'1H5 H= E)8L)I1&Iw8Io@1I@AH$8H$PD$PDL$hL$@-ZYuvIwIG@I+GHIGXMGAH9bHL)-MO0MG8'1H5o H= E)V7MO0(H5P 1H= E)57L$8MIWHHIG@MOH)IGXHL)I;IWH9HHFE1AAH9H)HMO0MG8'1H5 H= E)6HL)III)H HMOH)IGXIM)M;IOH9HHFE1AAH9H)MMAS1VH5 QDAT IWHH H'IG@H)IWIGXHH)I;IOH9HGH9HCH)IMO0MG8'1H5 H= E)5MO0MG8Lٺ'H5 H= 1E)h5L)I16'H5Y H= 1A5MO0MG8Lٺ%H54 H= 1E)5MO0MG8)1H5 H=t E)4L)H)H5 H= 14 (H5Ж H=w 14IWHIO@HHMGH)IGXIM)M;IOH9HHF1AH9HH)MLVAH5] 1WIWHAYAZHt:IG@H)IWIGXHH)I;~IOH9HGH9HCH)IH$II9/B)H5Ε H=u 13AD$83D$8MO0MG8LٺB)H5 H= 1E)q3L)1L)H1S)H5X H= B3MO0MG8L (H55 H= 1E)3H$8HH'1H=1! IQ8H$H5 HH1 LLHIH$8HE1AH$HjHL$Io@L$HXZIH)HHx%HH(H5] 1H= E2MO0(H5? 1H= E)$2MO0MG8LٺS)H5 H=~ 1E)1HŻ& HcD:!IICH9w"@HH9DIHLF ?GH Iw_HL)H w* H2(1HI$2(H1HH9IWHIO@HHMGH)IGXIM)M;IOH9HHF1AH9HH)M?LVAH5 WIyHHD$HT$H95H,WH$E1ALH$8Uj&A\XL$8H$IG@L$DLH0HbH= HcH>LMuL)H$8HH$MO0MG8)1H5 H=\ E)/HD$@闸H)E1sAD$DHH 6> HcH>MO0MG8Lٺ)H5 H= 1E)|/yL)1)H5f H=  1N/IHx11L*1D$('ˉJL)I1MO0MG8(1H5 H=c E).IO@(H5ݐ 1H= .E1AHDŽ$ A 駳HDŽ$ A 鐳AZHDŽ$ A nA 8HDŽ$ A LHDŽ$A5AIG@H$0H$8H$(8/ujEIG@Et%IW8H)HH5o& H9HOHIwMGIG@I+GHIGXH9H1L)Eq$(L$8H$IG@HIG@MIWHHMOH)IGXHL)I;IWH9HHFE1AAH9cH)H2IPD1VH5 RLAT$P/IWHH Ht:IG@H)IWIGXHH)I;~IOH9HGH9HCH)I$AaAAu.ALJ%ApAtADIo@MG8L9IWHI+GHIGXAMOH9I1M)ȅAVE@H9HG@DP1VH5 WM_@IWAIwICIG@I+GHIGXH9 IE1I)A E@H9HG@DP1APAWVH5" MHL) HIH)RU{<ЃHAHAt!LH)HH &H9HOHIWMOIG@I+GHIGXH9DIE1M)1UE@H9H5 HG‰DP1ARWH$A1H= L$/AE1HH|$Ƅ$0IHDŽ$8A1҃AjPE1H$@PH$PPH$plH HI$HHHH$HIG@AD$ t ALJIWI+GHIGXIwAH9@HE1H)M$MD$@MZET$ @SAAH9HF1RDAQAWVH5< QLSH$8H|$lL$IWHIHFH-LMGH)IwXIM)M;IGH9HHF1AH9H)HMWAH5 Q1LIWHAZA[Ht9LH)IWIGXHH)I;~IOH9HGH9HCH)IH$8dH>} H$PH|$`H5. H|$`HL$P$@Mg@A"L'H5 1H= 'A$H$P:D$(H$IwMGAHIG@I+GHIGXH9vCIM)ÅH== H9HGH5I AP1QLj'H$L`IM)zHH)믉$H$D$H$8QHH$8HI0HHtH<&HHH@HEHUH@E %DE H˭&8tELHHvAHH5 1aLYLLHt!dIŋ@ % =uIEHP #LHHIH&8tE11ɺt1Hm-뒋$H$D$H$L`RMO0MG8Lٺ'H5Ƈ H=- 1E)%HD$0`AHL)x!III)HH)x,II)MO0&H5l 1H= E)Q%MO0MG8'1H5E H= E),%MO0MG8Lٺ'H5 H= 1E)%L)ILIwMGMg@H)IGXAH9vRIM)ÅH=x H9HGH5 AP1QL$H|$`H5 JNIM)x[HH)I0LH)H $0toH$H$H$PtB1HbHl$@ MO0MG8Lٺ 'H5 H=| 1E)#HHtHMHQHtI0HH)Ht}D$ Y H5 6H&LI@Hx Ht_jLe E11jALҹ$AXLB AYHLHU|$ H<E@|$ LǾ tH@Hx L¾}HL$H)D$L$EHH$HEHteH &HIG@0H4DDt@^SIo@H9tH)IHD%D=Dt1cIWAIG@I+GHIGXMOH9/I1M)ȅAU@H9HG@DډP1VH5 WHIWI+GHIGXAMOH9I1M)ȅAT@H9HG@DډP1VH5 WHDŽ$A鮦AxIG@|$XHxH$8H$HDŽ$AI@ADŽ$8JQ1jsH$H$IG@HIG@^_HEEt%IW8H)HAH5& H9HOHIwMGIG@I+GHIGXH9H1L)1EH9HGAH5 P1WH=J H$8I@1H$HDŽ$ADŽ$8JAPAjH$IW@H$HIW@AYAZHH$$8@IO8H9H$H$H0H <$mIHH$H$H$HLBLIoH)IGXII)M;#IH9ILFE1AAL$H9cH)IMbE1EL$L$IDHPH5 1$L$ARATL$EIWHH H}IG@H:1MO0MG8'1H5Ā H=+ E)L)I1HH)x/III)MO0&H5 1H= E)gMO0MG8&1H5[ H= E)BI HL$HIG@04DDtzHL)nHIH)H$8H$Mg@APD$|1LPHl$@DL$hI肑AYAZE@* I$8Io@IGHHHMGH)IOXIM)M;IGH9HHF1AH9!L)H1VAH5 P1IWH^Io@_Ht9HH)IWIGXHH)I;~IOH9HGH9HCH)IH$Hl$@H$鹠r&H5~ H=Z A$uD$T D$(uH|$tc|$XIWHHEIwMGIG@H)IGXAH9vmH1L)H9HGH5% AP1WH= }-tI|$H$H)!Hc$LHIo@IHL)HH)HHMGH)IOXIM)M;IGH9HHF1AH9H)MxTLVAH5 P1YIWHXYHRtMO0MG8&1H59} H= E) MO0MG8Lٺ&H5} H=z 1E)L)H1z&H5| H= 1IwHI+GHIGXMGAH9vwH1L)H9HGH5 AP1WH=6 MGIOL  L)H~ uL  1H5t H==| A1;HL)x,HH)끈$L$#H)Mx-LMO0MG8o&1H5{ H=b E)MO0MG8Lٺr&H5{ H=< 1E)1HL)x7HH)A!vMO0&H5{ 1H= E)tMO0MG8'1H5h{ H= E)OA%AHDŽ$A.HL)xVHIH)*HL)x~HH)eH)E1IMO0AȺ'LH5z H=F 1E)MO0&H5z 1H=# E)L'H5z 1H=C MO0MG8'1H5zz H= E)aAWIAVIAUATUSHt$ $dH%(H$D$(D$,HG@H=6| HD$ 'Hŋ@ % $=HxHH9v_IwIG@I+GHIGXAMGH9HL)OHH)DžH9HGH5{ AP1WH=% pL$AUIG@I_8H9|$rD$8 *?3 A 9AD$8A=PASAAl$8EL.EHD$@EuAIHtHcT$8HH8uHT$@HIH# HcT$8HIH HcH\$ 0D$Pf.HEH@ KHE D$D$8D$HD$@$Hl$hLHADhDIHD$hƒ`RAH$dH+%(j@HL[]A\A]A^A_f.x(>H9EIwI+GHIGXAMGH9vAH1L)fH9HGH5vy AP1WH= HL)HH)@IG@8||$:D$H|$H|$?AD$hLd$@ AI@?|N"HD$0D$D$HLIDH\$tT$9M‰D$D1LH'HHDHLH"HuhH A<(V 1H5Du H= E)+H1L)fDD$8 AIG@8|_HD$0D$LD$|$H" OHH Ai>IGhHB<($HD$0AL4$EH-&EHHD$@HcCHs@։DD||Ndt"@*%@4HHI@( @TD1Lhfo!L$8HexistentupH$AupHe to groE)$fo!DŽ$ grof$Ƅ$H$fD$Ƅ$Ll$Mo@)$+IGM+oHMoXMGI9H1L)f.1EH= I9LGA1AUVH5S fDD$hƒA |$A^ Ld$@ AI@?|(D$D$IUIW@I}MeFH5L)IW(AIEHRHt@DHDIG(APH@LdA(LDD$^@DD$u A U\LDD$T$ZLIIGhBA $HIGh@,LLJfAƇtA E1@SHH(LcIWhHD$0D$Hf\AIOhSfTD$D$TLL)rHL)P1T$AEtPH &D$MMg@I93T$|w.H  HcH>A$H1HDID$HD$HT$AD$pD$xIW@:^U"D$Au!AAu1AD,IW@H9!Hl$pHD$xHE1D$HD$0Lt$@IHAOx@OwL @IcH1H)HIWIwHI+GHIGXIO@AH9!IE1I)LD$ARI@L)H9HG@P1AQAWVH5 ASRMo@I@1?-u HI@HT$pHt$xH\$pb1HT$xHHD$pT$8IG@@tۉ\$88),IwI+GHIGXAMGH9,H1L)H9HGH5n AP1WH=i @IIGMGMg@M+gHMgXI9TH1L)1EH=+ I9LGA1ATVH5~n ]Hym 1LLIHD$;A$LI_@HIG@H9tI;G8s ;T$X3IWI+GHIGXAMOH9I1M)ȃ|$>'A<ASDEх@H9HG@D҉P1VH5 WaL脾Ht H@D$8IG@IW8H9s 8)TIwI+GHIGXEMGH9#H1L)1EH9HGAH5V P1WH= HHALt$@ L$`4D$puL$xA D$xtD$x!D% A::k+LE1誼AHD$XA‰D$(T$u %Au.ALJ%ApAtAeL%&&M,$M3IEI$H&HH-&IEH IEHEXH-3HHR&HUXIEHIEH@IEH@IEH@IEH@ AE IE% @AE HHxH#&H;H;8MH&HL,I$AM HD$Hy2HI$H&HH HD$HHPHEXH'2HHUXHT$HHHH@HH@HH@HH@ B HBD$% @B HHxHJ&H;H;8F4Hφ&H\$HHK I_8I;_@4IG@HD$ Ht$ LHD$`ZI@H9D$Í@D$,HD$0IEL`D-X AI@tH r&I_8HI@H9=AtH@&HI@H9?IwHI+GHIGXAMGH91H1L)H9HGH56i AP1WH= 0I92A<$)2A A ALJAD$8A9 A9T$8IG@IwAMGHIG@I+GHIGXH9"H1L)L$H9HGLAP1WH=% pAAD$:D$WALJGA$H1HIIGXIwMg@M+gHLMGH94H1L)1EH9HGAH5-g P1WH= AqIGHLHCMGH)IOXIM)M;IGH9HHF1EH9,H)HMjCLVAH5 1WRIWHA[[Ht:IG@H)IWIGXHH)I;~IOH9HGH9HCH)II_8WA ${/"1҄t+Et!HL)H-IH5w& H9HOLM_IoHI+wHIwXIW@L9ME1I)1EAU@H)L9IGHщVH5 AQAWUAPI1CIWLI+GHIGXMOH9zI1M)1EAV@H9HG‰P1VH5 WT$(H5e 1LIHNHCA,$I9s@?%@*$@<7@'-IM)I~&H5fe LDT$DT$~5@R_/@H1H4EtM 0H&(I9INLIwMGIG@I+GHIGXH9'$H1L)1EH9HGAH5 P1WH= A$р<>%=;I1҄t.Et$HL)Hp4H5Z& H9HOI,IwM_HI+WHIWXIo@H9BIE1M)1EH@H9HGH5% RAP)A1WAS)1I0AHt9Ic(;B}-HHBIW0IHH)IG@H)I9EKMGIOL #L)AG@:H~ uL  1H5 H=_ A1fLHT$0I+whDHLA|$< sE1D$a;k;/ H-&MgpLuLd$0HiIGhJE1BIGhDIGhfD\ID$IGpIGhHIIH#L"D$s tuYH-&MgpLuLd$0H޻IWhJLBIWhDIWh1flHGIGpIGhbH-&A&LMgpLd$0HuIWhJLBIWhDl땋D$:uEH-f&MgpLLd$0H*IWhJLBIWhD=G;D$!,M@IE1Ҿ7HAHDFIMg@I9A$)M:EtH &IEEL4$EIGhHD$8p@΀|(t%@oB|HcPHHt$0@~tuH)HƒHrUHl$@LH蒸IGhLH&MgpHݶIWhE1DJHLBIWhD=IWhfDLID$LIGp̿I@|LL)HL)D${{&LL)L)I9v"L)H1WAH= 1VH5 LL)L)LԬD$A9}AD$,Ld$@AHL)| HH)KAfB1۾WHL) H)H9s"L)H1VDH5Z H= P1HL)i H)M)1P:9wH  HcH>D$D\$IG@Et$HH)Hm0H5Z& H9HOHIWIOIG@I+GHIGXIH9LF1E@MM ED H9! H)1AQ1AAPMVH5 WQLRMtITxMARKGIG@H9t H8IWI+GHIGXIwH9 IE1I)1EL@H9HGDP1APAWVH5 蠷MO0Aغ 1H5V H= E)IGM+gHMgXMGI9HIF1EEI9L)H1VAH5X H= P1FH9^-M)2ALJ  kIcIHLIcI4IcIIIcD$ IHD$sIGhH9‰MO0AH5U 1H= E)aI9 MO0Aغ 1H5#U H= E) T$8FLiHD$0IH8HcT$8Ht$0H4A9ALJIGh A&H-|&MgpL!Ld$0HٱIWhJLBIWhE1DHIWhfDdHGIGpIGhAƇsHD$0D$LD$XMO0Aغr 1H5"T H= E) MO0Aغu 1H5S H=e E)LL)PL)qI9v"L)H1VAH5Q H=b P1LL)9L)Հ|$,!HD$0H HcH>HD$XIcH9,:HT$XHH)H:1HLEH:H@ 9HD$XH)H1At$1LHc H`9H8G Q9% =0H|$Aj`L91`HD$h@ r1LIH@ ]1A-TA&Ht$hHL$h1Hu9uLHHtppIELd$hIUHHHiH9eH;hHhL$$UE1E1PHD$hPjjLL^qH HIo@IEHT$XL`DMcI9 L1LH8G ~ % =jH|$`HD$HHx*HT$XIcH9xHT$XH)HH|$Hŋ@ % =4HuHD$X4uHD$XHy HD$XLaHD$`@ IG@I@IwHI+GHIGXAMGH9*H1L)H9HGH5` AP1WH= EIG8Mg@HI9s A|$?/HD$XHcH9x_1HLIH,4H8G 3HD$XH)H 4u1LHcH3H@ 3H|$XHT$HHHRHHLaL9L;`g.L`EJI@HI_8HD$X1IcL\HtH8G !HIEHPMeHjH9 H;hhHhII@I_8QMO0A1H5M H=_ E)AD$&HH@ ^MO0Aغ 1H5M H=$ E)MO0Aغ 1H5M H= E)L4$AƇtE1A f@I+GhHHIGpHL) HIH)KIG@IO8H9r$f.HIG@H9t H0H vIwI+GHIGXAMGH9v5H1L)L$H9HGLAP1WH=: IM) HLH)HH) III)hA+Ht$hHL$h1HfPLEID$IG@zHIG@I9tI;G8s @8(IWI+GHIGXAMOH9I1M)@>'A<ATDEх@H9HG@D҉P1VH5) WˤIMg@I9IGXM+gHIwMGLH9 H1L)1EH9HGAH5% P1WH=B IH5Q LD$D\$D$D\${AdI9o@d1L)IAN,HIw@HH)MwhLH5^ HMAFIG(IWhH@BT*HlIGhBIGhB\(HL)a+HIH)bMO0AȺLH5}B H= 1E)bHڸ-HAfHH)H+H5n&H9HO@IMO0Aغ1H59 H= E)\$S\$SAL<wLI|H5 < LD\$DT$DT$D\$MD$bH5; LD\$DT$vDT$D\$tD\$H5; DT$Ht$hHL$hHeRHLŽMeIEMO0AغK1H58 H= E)tIHHKH HMGAH)IGXIM)M;IOH9HHFH9P H)IM LWH5 1AQAIOH[A^HIG@HPH)IOIWXHH)I;IwIH9HGIw8H9HCH)IHL)HH)!% =?bH!LHH4ppI@I_8s`1HHMO0AH57 1eH=h E)HLIUIEJ臼AHHDff.fUHSHHH~01dH%(HD$1)KH$HHZ'<tqHE11HH<$HtwvhwS(HC0t# CHD$dH+%(uCH[]DtCHHŠH${@蓻HcLDMt#ApNApIT$HzfDHuI|$HL[]A\A]A^A_wLcN|A/~IT$HzHcH|CIT$HzLcINHɰH2J'H=l!H賰HdC'H=H蝰H.J'HH[]@HC  ̦kH@HcH&H<fHcHҀ&Hff.fHJ'HAWIAVAUIHATUSHHH$T$DL$8H$HD$ H$DD$pT$0L$PDD$hDL$DL$HD$XdH%(H$81HDŽ$\ HH$ML$D\$D$1D\$E1D$`L FJ'11ɃAE1IH$D$SD<-DD<=V<:SH<~DE1AA HI9vZAT HAց@@u{HAHH<_C2AvL9HAI9wfL\$D\$D$H|$D$(I ˆT$Ht$A}utf8HD$D$HD$(|$SItHIHAL9r6SHMDL9AHAƁDDtр{@ǀ_@% @!= @!qՁ@@ D$w AAAAF1HH)H H H( HH Lf9cc f9ag ye D$015 @KE1Hf.DIwAFI<H9 KA| : AD[:A:DLLH$D HAAf.H@HA@EEvDD"d$t IGH9DHAE1A~FDAA:perlA AD$(E1I9D$0\$(E1D$@AHAL\$D\$AFDA=AE1D$D$`1AE1HD$H$D$HD$D$(D$0D$L9 DL$D$ IDd$PA%_'-EHL9s1EDsHLIAIwD AAHL9rDd$PA A H\$LH)Hv A|ILAD\$L$讬L$D\$DE(1EyAٻA|$8t4AhDȃ=QAeDDDD $D\$LT$苋HH$H@'11H5 HHxHD $HI t'H$1ʆH貑H$HbH$H$8dH+%(*5HH[]A\A]A^A_ÐL%QD'DGADADu E3EEFC"/u(H9v#|$0DD$ Dt$ H@HEDd$E;\$(t<;\$t6H9t1CADH0H wAD5H0H f.DAA_HAA eDDTDD\$HiW LT$H'HciA)D $ؤLD1IH5 1̨D\$LT$D $A:nameL׾H$D$L$L$L$L$D$L B'D$xH$A:nameH9'AH$L ЃHAHwRDAFA SI9~ D)'fDHADt$pAL9V ATyDHEH|$H@?HV"H5Z HBDd$DH$|$pH5 L5 H1MLDH5c H"LHǘ1fA}::3l$IAHD$D$(&D$0D$I9D$ {IDd$`H^L;$PL$M?L$LT$(LD\$0LH1HHHuD\$HL1ҋt$H=D H1H$ILHH $L$LH$I1}D\$L$ILD\$L$谓LL$D\$DE7f.I9KAT5+CHH9wJATHƍAHÀ0t_uATH0H w H9rЍYHƉL9AT5CAADH8G % =IE1E1 LH5O IwH=E HLp1cH{yHI HEH|$(H@H9G`"HX~H|$0LH;$IHD$H@H軛H@AzspacAze{sHH9CH1LLD\$(LT$yLT$D\$(HHD$PHfined prfo!AtyDŽ$(operH$ H"'fD$,H$HƄ$.HD$HD$X)$H$'D$H |$8D\$(H H=j HD\$DLLH|$ID$DYLLt$ HHD$`A 誌\$Ld$ > tl辚H AфI$It$E1E1ɹ PH!'H8諒IH`H8W uHHH@ fA}::HǹH$H5"IvH$fxri|xcrkDd$HEHEHxuY"H5t HuDd$DszEI9CADA% @= @H57 HuD$xA 1ҿ 褖IH<$HPL'HBt$LҹL$H= lxeH<IۋL$D\$HHHD\$H}L$D\$HHHD$ HHL$H5' HHL$L$D\$H9HOHwHT$ H4HHH) L$D\$QN+H5Lk HlHEHxH$HlDd$DwH5 Hl|$xLT$ '_H4$H|$8HD$H 1E1E1H$H$H 'hh]HHD$XZD$HLT$ D$tgDt$Ll$ L|$(ILLtLHI茗H<$K'LILvRurHD$HD$L8MuLl$ L|$(H$pH$pH$H+H5i HqkDd$D*fDT$IHT$8Mt$L҃HT$8HIHLsI9HD$8v?LsHL$8ILH)I9rL@LLLLD$8H踕LD$8BL H$L$PLD$0HWLRUt$hjD$DL$0(H H$1HH$`wv>wsv#sHHX HLh 1H|{HH@H$HGHD$0H~ HD$8H H H$H L57 H$H LF H$HD$8L Lh7 H5C H H$(H$H H?: H$ H Lo H$PH5G H= H$`Hh HO, H$hH@ L% H$pH- H$xH7 H$HE H$H H$H H$H H$H H$H H$H L$@L5 H$H L$L$L$H$H$H$L$H$L$HH$0L$8H$H H$H9 L$ L H$H L$(L H$H L$8L H$H L$@L H$H L$PL H$H L$XL H$H{ L$`L H$HD$8L$hL } L$pL H$H L$xLO H$H=F L$L4 H$H=6 H$H L$L$0L$HL$H$H$H$H$H$H$H L$L$H$HfIH$HLH$vH$D$ HD$XH$H$H$`HD$hH$HD$xL$H$L$L|$HD$XLd$hL(D$ D$PH$l$P@HH9$tsILLH@]pI4$LQpH3LFpIIvMLHPHHKtHcH$H3tH$D$wD$뀃D$PIL9d$xZD$ LD$ HD$X=(L$L$H$HCy HDŽ$HD$8HD$0LFu`]1HIYH$x]HL$`H$HHAv5Avss+]HL$`H$IH΄AvAvH$H$H$1YH$wwD$wD$gbjAE11PH '1Ht$0H8ۉ^_L;d$0LD\$hHT$PVD\$hHT$PND\$01ҿ D\$.H<$ID\$H?HPHBH|$H$L|$hLl$XHD$PLMvHHl$xIHHUH $MHt$PH|$L(HoH\${ HuH@HImH$MuHxL HUHJ#LH)H9  0ZHD$PL<$L LrIHfHXI9x uH<$ H)HTrHX{ 1{ 'Il$H9D$E1L$GML苈IIOIHrLnL9=L;jLjN4H9DC{sAуKAAD EADAAD DAЉAAD  D$ ‰AԉH AH9D$McL$H$LLvnMuH$D$wImD$H$11GnMuH$ImE1H XHD$PHLl$XL|$hHl$xH_|HH5 ^MLH5, H1]AD$ H|$8HAD$ tQu}tID$@tHH@t1LVtH5 HA^H$H'^2^H$I$HtH@HwHtID$80I$Hx |L;d$0oLQI$Hx oI$HH@HOHID$808uL;d$0(eL=QI$Hx LLD\$0:oD\$0IZHEHxMZneHnLnLnHEHxtH5X H\MH '8LI$HH@HHID$80 HD$ D\$0Hx6D\$0D\$HyH=Z f( L$jL$'L$aL$IHL$H5} [L$IH5[ H[$vHEHxH5v H|[Dd$D5I9L5 HL9IW1LHtHEHuIH|$HPHHAtH$HH jH$D$wD$l)H5 HZ9|$L$2HD$ H8HD$ L0IInHrLfL9}GL;b-LbN|MuImLLgIOILLgInIJ|HtwwHt'L MI$HH'HL5'I$H ID$IFXHtvHIVXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ HD$ L >k( 5hq^I=JH$wwH$HwH$H L$H$MkH$H$HH$HfAuLQRIHAH$HH8RH $H H\$$]H$HYD$PM|$(B0FD$(3$D$t ALJ|$D$P?\$p A.H<%E1ibL$H$MtlH HH$L dH$HHBHtR0HH9 w wHDŽ$H$HB0KHHxm H$1,HHxN H$HHHBHv#IL$PGHx H$i0$ $HD$0 E1L$6D$(BD$TID$H0HH $|$XH G&IcDIwLI+GHIGXAMGH9 H1L)H9HGH5@ AP1WH=BY f1H$LL|$hH$8HDE1HAÅH$H$8Ht!HHzxH$I9W@w H9-IG@H|$IO@H|$x1IWHHH)H9C|$X1HMGAH)IWIGXH9 HE1L)Hc@HH9HG@P1AQAWAPQL$HH5E e(AH&HLMgptJ,IH$IGhE1$BIGhDl(IGhfD\(AHIGpIGhBH9H$ICL$H$i_H$HD=L$HI9v,H$>H)H>wHHHH5* H H{MIWHH+IG@MOH)IGXHL)I;IWH9HHFE1AAH9+H)H+IPDٿ1VHRASH$'IWHH Ht:IG@H)IWIGXHH)I;~IOH9HGH9HCH)IA/@t |$T|$X]H|$Q D$EIt$$H$IL9 ID$H^HEH^I_vjIv H'Hw If'L &LIyLL$9H$LL$Hx'IL9H|$8LLVAL$Io@HD$8HD${HL)#MHI)H|$8CAsDىHDŽ$8D$pPH$H1@d$P$H$D$pHD$Io@HL) II)L$EAH=L&H4D\$H$H$DmH)1rLC'B0 A.%LU0 BEAL &I4GrBhBU^B|$(fHD$01ҾcLAc ID$pu |$(|$H&L -&HDŽ$0A"HDŽ$8HD$HH$ HD$Lt$XL|$8LL$hA L|$HH\$hDDD$(1D$TA"]H\$HLt$E1Ht^At4D$PuI>HD$DH04At0AAuD9d$T$yH$ Lt$벃IHoAA?H$8Lt$XL|$8Htw=wH$0HtwwDd$P$T$ E! H$@HwL$`LH)H=ZI`AH|$@8HH$I9HIFHBHH$11E1HdVH)H$$L$11LL8V$D$A8^A$))ډ@@8vƹ@@8v8D$AEAA D$HD$0 TA+L|$IEAu?H IoI_@I+_HI_XMoEH9aIE1M)11D$BD$1LHH=E EMH9HFA1UAVSHL) HH)At DIL$M_@$Ѓ0L9$It*IH&LH8A/1H$H$H$8H H9$yA$H$Hl$@Io@H$fHE1H)xMO0MG8/&1H5Ƴ H=- E)Q8=v.=%H&H<$1H$0H0,MH$0HHBHtR0HH9H$8Htw;$HL`HPHEH[H]A\HHPHH'HHPHE[]HA\HW t t3yMJIIuHhH HcH>HH@ HGf.Ht$8LL$81LD$0HL$(HT$ Ht$H|$6ZYH 'AT$ HсIH R'99ID$AT$ H'LcHHH'HHH$dH+%(Hĸ[]A\A]A^A_@t$8CHT$Ht$1H<$5MfDHL$HT$1Ht$H<$5(fLD$ HL$1HT$Ht$H<$5@LL$(LD$ 1HL$HT$Ht$H<$d5H<$1M5Ht$H<$105HL TMM9s\fDIM9r*I?G tOtHC'H' H.'H5'HHLp)H5 1,H=ȭ 19H= 1+AfDff.ff.ff.H(dH%(HD$1HD$0HD$HD$dH+%(u1H(AfOH5'DDHND@u|t<*t<4tHHILÐGHHATUHS.E1E1 HV'HAH;BHtH@ <tt []A\DH;D[HE1]E1DA\AwvwÐ7ff.PXH= 1HH5'KDSIuMHW8HHL)H~A9(uAy?uAy#thL9L9f.HIHW8H9q@v uI9tIAIAy)HO8II9uLGHOL /9 L)H~ uL O 1҃H5* H= 1JLa'II)A43I9|6u(xubHqr@vXwM#t9fx HHt6HH9rIHW8H9@I9t+MoHxuھ[IMHW8:ff.HW@HG8H9s[t9HH)H~N2L\'A40HH9Hw@HM1HG@fDHBHG@Hw@1DHff.@-w!HR @HcH>f1@]Dff.f.f.f.AUATUHSHLg@Hw8L9H'HB8L9A$ʄ}H='TML-'AD ILE@I9r9DH'LE@AADILE@I9AyHHHZL)HmAPуZ? DA $H$'@@OIHuLELe@L+eHLeXI9v:H1L)f1҅I9LGAH5@ 1ATWH=: gGLL)HL)@1ҁ LLt;HHHt7j11E1jE1HIHZYHtH@HtH[]A\A]fDHuHE@H+EHHEXLEH9HL)HH)DžH9HGH5 AP1WH=!9 lF@MI( H'I%@=@LE@LI9rM)IcHHWHL)H~+A|$uʃ? @@DL1>Le@f1L0t!Hu8Rf1L>Hu@L)Hc,fLM0LE8 1H5d H= E)KEDž1NL)HcA $Hl'M@@EApLM0LE8 1H5ܦ H=C E)DH1L)!fDLx3u$Le@DM)Ic?DHu8LE@qM) Ic,H=V QDAWAVAֺAUEL-`} ATI1USHH=Z2 HyII@H'HH;'H@(1@t HHh Ht@ L3M<AF H|$D$>< E1Mt'fAD$ u A|$"'AD$!@Md$ tIF@tHH@@H7E CHUB5HHB%LFH&HHH7HD$L0MfHH;\$|$>Lt$M8AF D$>H< %(ILjIMtAD$!@5E1IFHD$ MHu1H=  H+/HH;\$lD|$?t E@DHD$XdH+%(HHhH[]A\A]A^A_ÐAF IFP HH AH@I9F uoP MHH@xHɩ' LHp %II9OHFP AF t4u xLcAW cIGsD tfDAF 7IFP MIHE %=Ht$H1HbL|$HHD$PAF t E O1LHEt,HD$H0BHHHBHUHRHHPA~ IHP HzX|LIEHh@]HD$0HD$L0IEMpAI~VAQ9|NҸN9~f9HcIyT$(HLL$ LL$ T$(IAAQIEpH|$1Ʌf.A~ IuHRL0HcHHPIc@LDHHI@EHLILHrHpHrHpHRHIDփBHPIE9HBfAF tIFx  HAF <Et1IHPHD$HH0AHHHAHPfDLE1 'LAF H'LpH'LpL"LcAF I%MtAD$!@Md$HI9?J< HHD$ ME1H\$(LL|$ DHIHL9t*1HLKHuH'HIHL9uH\$(H={G HHDH@E10LL$@HT$0H|$(Y^H}DAWE1~5DIcHIGHxHtwwAE9oAG+HELxHEL|$H%fIHJHRH9v Iv<uELD%P=uHtپL HEHIHPTfDHD$L0IcGIP~@EoD9|7EDND9~ ED9IcH$EoIGHIcG1HtHUHRHHIWLdIWHDAGAD$!@e.Md$AF A,H' JLHp3HBP ItLpAV &H=' 1"E1&H|$HT$HHt$P4HT$HHt$PHR M 1H= ' HHH;\$(xPHL$H0IEp/sHMMfDAVAUIATIUHSHHL&tgI$H;h!-ID$HHHHCHJHiL4H9H;j-HjIM.L[]A\A]A^H'HH=HHHX'HL5'HH HCIFXHHIVXL4HHHH@HH@HH@HH@ C HC% @C I$ID$H;j+H;jIHjIIf.II>HwLwM.[]A\A]A^HHHCHfH'L MI$HH''HL5'I$H ID$IFXHHIVXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ @II>HwwfHLID$I$( HI(  PfD $*ATI1UHSHw@HHE@LE8L9rhHUH+EHHEXLMH9HL)III)1H5I @HH9HG‰LP1ARWZf.8)t 1H[]A\@H'HEpHHD$HuHD$HMh1HHMhHD"H $LHAH+QHHQXH9HLQHF@@H9,L)E1HHLA1WH=v Y HHD$A]A^LXI$IT$HHHiH9H;hHhH,ꀼ$H]|$J$vH$HXH $LHAH+QHDHQXH9HLQHF1E@H9sH)L)IH+HLA1WH= x HHD$AYAZLXI$IT$HHHYH9H;XHXHڀ|$KH+rfDNXL'A 8DH!AHcHvGH}H9w@HH9DLHLG ?AH HwHJ`EEHܓ'H_AH99]LT$@Dt$LD$<:<;D$JD$J$E HD$@HHH|$ tH$HXHtAH$dH+%( HĘD[]A\A]A^A_Ãl$LIL;T$Ps#AH5'HЋ @ @D$JD$K23Hl$@)HD$8xdigL)E1HA17IuHD$8wordM1HT$`HtL:AH|$ tH$HXHtD$<]V<:<;D$JD$JD$KI$E1H)L)IH9H$1H5d H=W LH0L@81E)DHl$1>N$I<$H&wwD\$(E1A1LT$H$HHjHt$H$AXAYD\$(LT$Ht$LLSIWIN4I>HwXwL)E1HUHE1HD$HЋZD$JƄ$D$KLQH|$ H$HXH $HD$HPHAH+QHDHQXH9HLQHF1E@H9dL)E1HHAL1WH= HHD$^_LXI$IT$HHHiH9H;hyHhH,H]HT$@HBHwN:]uI|$L D$LPH`]u+LT$@T$LD$JD$KHD$@DD$JD$KLLIVIN$I<$HwwLLRIWIN4I>HwwLLIWIN4I>Hw w$EH|$ H$HXCH $LHAH+QHDHQXH9HLQHF1E@H9H)L)IHHLA1WH= HHD$AYAZLXI$IT$HHHiH9?H;hyHhH,|$JH]CH$HX>H $LHAH+QHDHQXH9HLQHF1E@H9 H)L)IH HLA1WH= HHD$A]A^LXI$IT$HHHYH9; H;XHXHH+|$K H$HX H $LHAH+QHDHQXH9HLQHF1E@H9 H)HIL)s HHAL1WH= HHD$^_LXI$IT$HHHYH9 H;X HXHH+H$HXHB GHH@HH$ H$HT$ AHXHyH)L)IH{H$H5^ H=c LH0L@81E)fLLIVIJN$I<$HAw/w*H'HH&HHH9'HLL}IUIEH1HUz]H$H $HqHQ@H+QHHQXLQH9wIE1M)хD@H9DHG@H5' 1RDAPAWAR蜾H~'HHHHHd'HL5!'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C H'HHzH8Hʀ'H;8 HR}'HHH$K HXL)E1HUH 'HЋ-H)L)IHH$BH5\ H= LH0L@81E)kL)E1HD$JHD$8alphnM׸HD$8spacPM׸HD$8grap2M׸dH|'HHHHH'HL5V~'HH HCIFXHOHIVXHHHH@HH@HH@HH@ C HC% @C H؅'HHyH8H~'H;8H{'HHH$K HXH|'H(HHUHH'HL5m}'HEH HEIFXHHIVXHEHHEH@HEH@HEH@HEH@ E HE% @E H'HHzH8H~'H;8}Hwv8wH$H5Y H= LH0L@81E)@ fDL)E1Hc=H'( HbHD$`MHtL$H4$$L HVL~@H LDLH+FHHFXHvH9 HE1H)LL$M@M)H9@HGLP1APMCWVH5 QWiH$H5~X H= LH0L@81E)[HL5z'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C H['HHzH8H{'H;8}%Hx'HHH$K HXkHѺ( FHlx'HHHHH }'HL5y'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C HJ'HHzH8Hqz'H;8tHv'HHH$K HXHH0HLIT$I$HLgIT$I$HHH;H@wv4w-H$!H5V H=w LH0L@81E)xL)E1HHv'HH;HHHz{'HL57x'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C H'H0H~H8Hx'H;8}bHlu'HHH$K HXaHLIT$I$H,H}HwvwH2( )HHH;Hwv8wH$!H5GT H= LH0L@81E)$@fDL)E1HEH u'HHHHHy'HL5gv'HH HCIFXHtHIVXHHHH@HH@HH@HH@ C HC% @C H}'HHyH8Hw'H;8Hs'HHH$K HXH|$ AhHH;Hwv;wH$ !H5R H=A LH0L@81E);zfDL)E1HHs'HH}HHH:x'HL5t'HH HCIFXH*HIVXHHHH@HH@HH@HH@ C HC% @C Hy|'HHzH8Hu'H;8H(r'HHH$K HX|$J$H|$ rHLIT$I$nHL|IT$I$)H( ssH=( MHH|$KH|$ H,H}Hwv;wH$ !H5P H= LH0L@81E)wufDL)E1H H[q'HHCHHHu'HL5r'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C H9z'HHyH8H`s'H;8}tHo'HHH$K HX|$JH|$ uD( #HHH낺( GHH( nZHH)xII)HH$*!H5N H= LH0L@81E)HL)xPIII)|HD$`HtHH|$ CH$AHXHtH$H5"N H= LH0L@81E)H)L)IHH$!H5M H=N LH0L@81E)@KHn'L M6I$HH]s'HL5p'I$H ID$IFXHHIVXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ Hw'HHyH8Hp'H;8}ZHCm'HL$H$AL$ LXJH$H5L H=$ LH0L@81E)f.kH뜺( IH_m'L M@I$HHq'HL5n'I$H ID$IFXHHIVXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ H0v'HHzH8HWo'H;8}dHk'HL$H$AL$ LX{H$YH5]K H=ķ LH0L@81E):f.H뒺( NIH)L)IHH$oH5J H=E LH0L@81E)Hk'HHHHH`p'HL5m'HH HCIFXH,HIVXHHHH@HH@HH@HH@ C HC% @C Ht'HHyH8Hm'H;8HNj'HHH$K HX6HD$8asciM׸HD$8blanM׸HLIT$I$nH,H}HewvLwRHD$Hz( qHHfHD$8cntr#M׸UHD$8alnuM׸7HD$8loweH$M}HD$`HtDLAHD$8digitC8print.8puncM׸ AfM׸ M׸HD$`HtSL8AHD$8uppe)H$MuHD$`Ht!LCATAoAd>x4LLIVIN$I<$HwwH$,H5ZG H= LH0L@81E)7MqH0h'HHHHHl'HL5i'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C Hq'H0H~H8H5j'H;89Hf'HHH$K HXHHg'HH1HHHk'HL5h'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C H&p'HHzH8HMi'H;8}bHe'HHH$K HX( ^H(HH딺( FHff.AWAAVAUIATUSHHHW(HzHT$HD'G4 {ff.ATE1SH9.?{%HGHIH9bH=ri'HPH9H0H4HHtH0H H9JE1E1H=i'HH94HHt܀,E1H9M1E1 HH99H֋HHtH9@}HL MjIMHMPE.MaMXIX D[A\HH0H HH9wII,HFH9H=h'fDLXL9t7LH֋HHtH0H A@PH0H w%Lf.H0H wdHH9wE1[DA\PHH0H @H3IIH)MHAMP H=0g'HAWAWI@ I@VI)I.HHE1E1WHb'<t f.ff.AVAUATUSHH0dH%(HD$(1@ H@k0vN@sdH;HHD$(dH+%(H0[]A\A]A^@K@StDDID$H  Lt$Dt@@u H;xxHvfDD@Lt$Ht$1DLIH=vH;HHHLHt$ LGIH{HEHHM@HLMH)HMXIM)L;LEL9LHFE1ۅAL9I)MMMHDDٿPH5] 1ATASrHUHH HyHE@H)HUHEXHH)H;WHMH9HGH9HCH)H6fDH;趿HH衿HfH;*!*!~HfDH;+!+!^HfDDD@ELt$nDt$ wDI11@EHL9iHT$4vH;HHѐH;HվHM)CLM0LE8LѺz$H57 H=] 1E)z$H57 H= AWIAVAUATUHSH(Ht$HL$LD$HL%X'I$HHI$H6]'HL5Y'HH HCIFXHHIVXHHHH@HH@HH@HH@ C HC% @C Ht,EHLsHxHx>H@I.HD$Ht2@HHkHxHx H@HD$HEHD$Ht2@HHkHx/HxH@HD$HEI,$HHEI$H['HHELHEHEH5> HHEc M H]IG(IH@HlHD$DpH([]A\A]A^A_DVH]'<u MIG(H@HD E1HPAހ<sHDLhAEIEHx~11L2H@H@8u`HtH01HޱtJ1ҾLH|$@H@8u&HL$H H01H蛱HI9#IG(H@6fDLPfD1H螹LsHfH胹HkHHcHkHH}Hww@I>H>ww'DH}HKww4@HA( 4NӰHXHHUHBHJ0HH)HUHH4HHT$(dH+%(H8[]A\A]A^A_f.HGHHhHIEHL`MHLh y@HLp E@HLx @Hx(Ht'ҷH}HEHx(|$ fI$Hx(Ht#获I|$I$Hx(|$$跡fH5M 1RdHAWAVAUATUSH(L%T(dH%(HD$1I$HkL3LkHtE #HH@H@HxHlADžAF % =-Ht$"LۚIL5T(Ih HP(8 T$LD YHO(HCIM,$H=f.Hh1 C HO(HHCHoT(M,$HHHT$dH+%(H([]A\A]A^A_f.HEHH@H;RHO(HHCIM,$HIMFH@HD$HYY(Hc1LD$H4NLD$?ff.@AVAUL-R(ATUSI]H;LsG % =UHLcMtAD$ v{LH@H@HxHt=X诱HN(x>HCHS(Mu[H]A\A]HA^fDL/ 蓿 HM(HID$HwH@HeHHh B@AWAVAUATUSHH $H8L%sR(dH%(H$(HQ(HI$HPHYO(LkHL4D$H;LCH>G .HGH!LxMMOMMtA@ QLǾL$MOL$H@HhLL$HT$HD$ HHD$BADžH}t H<$1辙H5I DߛHUDH5I HEH$ěH$HB(HEƀsH}HEHHx(T$Ht$LAF@H"P(LsL(I$H2f- 薽 HK(HHCHO(L(I$HH$(dH+%(H8[]A\A]A^A_I@HHhHHEHx(HuH}s)Hx(HtұH}WHEHx(HD;L薾fDAWAVAUATUSHHO(L%O(HI$HPHL(LsH;HH,ЋG % =-ILkMtAE L)H@H@L@ML茻DBHcE H։H?HP(:HuE H3N(HkL0I$HH[]A\A]A^A_fDIEH]H@HPL@MeL+ l HI(HHCHM(L0I$HH[]A\A]A^A_HLx @HIAWAVAUATUSHHL5?N(dH%(HD$8HRM(L(Ih ffMeI]H;G % =HD$H{L{G % =hHD$LkMtAE LJH@H@HxH谹AfbfGAD$ % =BHt$01LDL$莵DL$HHD$0D$,ADIEH% =Ht$ LHI}H赚HH(I<$HJ(MEHG f%fA@ % =1LǺ"1躊I<$IG f%f=HL(%L(HHB  mf-fH} D,HR D4H8 D$H>(HLA@ % =LHt$H}IG f%f=H?G(%L4HT$HvH1LHDLE訷"H9(Hx0 pDE1AA/1HC(ADHD$dH+%('H\9(Hx0H([]A\A]A^A_oDpHHT$dH+%(H([]A\A]A^A_DfDHD$莪LL$MLH H5_ 1I7H8(HxnsIMxH@HD$KHD$dH+%(0He8(Hx@HEP#@"L%48(HE<(S膨IfDH}G f%RHEP#@"t_L`(HC(H;HH)H~dHWHLgHuH;(H7(HHHEfuHHz7(HHEfL`(+HjH;HE놐L%A7(d迪ff.@ATL% <(?USI$Z ffwH  <B"uH:(HH@  U1.vI$fHPH8(HH,f f!fu:H8(ffHH*Hd@(H*HX\^j DE@FHH+,6(HHE tGItHE@HH@1Hc[H]A\lfuH68(ffHH*H?(H*Hh\^ X; mH[]A\DHa?(HHp0uHEHx fI$P#@"t@tHh(H19(H@(H;HH)HHHWHHo[H]A\DuH8(HH(I$fHEHH@HtHHE80^f.H 7(ffHH*Hr>(H*HH\^x +fDHA4([]A\Hx|j@P#@"tCH-4(H;-4(#fDHЦH7(H3(HHI$HÞH;I$AT?USHt8(HB f%f-f wH  <B"uHl7(HH@  um1覅NH A ff%f w0H6 HcH>DH =(h葪9H2([]A\Hx0%iDkjHt[]A\ÐH<(@tA#A"La(H-6(Hm>(H}HH)HHGHELgHi<(@fDHQ<(h9HHP#@"L`(H-*6(H=(H}HH)HHWHULgH@H;(Hx0H;(@%=H;(@%= H;(@%=`}Hi;(@%=]HI;(@%=@=qH);(@%=QH ;(@:f.H0([]A\Hxg@uH4(H0(HHH HDL%0(H觛H}H H4(Hm0(HHHsL%X0(:H^H}HBfATUSH5(H@"uH14(HH@  uB1kH9(@%=t5H/([]A\Hx0fflVgHt[]A\@HP#@"tXutL%/(H-3(Hg;(H}HH)H~VHWLgHU[H]A\@HY/([]A\Hxe@uHU3(H6/(HHHL`(H-H}H@ATUSH H3(dH%(HD$1H@"H-2(HEL AT$  1%=UtI|$G < % =Ht$1L9yAT$ Ht$HŁ H)HtP LHtoEH0H wa1Ht$H肧tNH|$Hw@H-(Hx03d+(H@"@#<H/(L MH.(HHC  HCHHXL-((AH0(AEfDHH{H;H{辖DžL%/(LuAEAD$%=@ HE*(HP ff-vP#@"L%%(H/)(H0(H;HH)HJHWHLgHCI|$W  U%=AD$ hH@HfDЃ 1+@L-I'(H*/(AEfDH{/HfH{荂H{IaIŸI9LOLML螅f蛕 H$(dH+%(YfH9wFfDHH93;yf1tuMIHt@81RtE&D< MK11'tH+(D}8t"H/(B@軆HfBx`fDD[HH{臌ƃlH'(HP#@"|H&(H"(HHHu'(HDH1+(H5 HHXH#IH t1HуHt$| uH5n+(H 1諊H "(HxHXSH舃HFH&(HB f%f=- B#B"Lb(H%(H}-(H;HH)HHGHLgHI$I\$H@HD$?fH{ע fL`(!H9+(H&(SH@P ff-8pH%(H (HHH%(HMDH$(dH+%(H (Hx0fH@HHKH9HH# tHɍAHHL؆ H> (Hx}V膐I3H9r%@HH9?yf苑L(H^+H?1HH|$^~H|$HHj"(H@*(f0)MNILH 1H5 7lH"(H)(f8H&(HxeUpƒ PIHDHHWH9HH#tHҍBHH{L%( H迉H#(H;HH蠉Hq#(H;HYkI|$W H= ou鍨鈨ff.fAWAVAUATUSHH#(L%0"(HI,$B#<H)(H8HGLh MH)(HH)HE1E1 H5 LʒH H8LmG % =W"1KhIHY(8tH5 1{LiHU(HELHI,$HH[]A\A]A^A_LuL}Mz"AF VtMnAU % =L 1IzgLI'E1E1 H5 L虑HHF(8HV(HH0HEHI,$HLw1LvIHvH(8AE w`IEHtWH@HtNHHz0HtjpDžx7JuH(xAHE_H0HLP + Hv(H0HxHt肌fD H@Lh RL.HH0H?Ѓ Mf %=t{AF DIMvL1fLgAF 1L H5v g$ HO(8H5 1xƒ v2H5 1xL gMnAU ;H5v 1xff.AUATUSHH+ (L%(L-(HMEHHH Hc(HU'(H(HH(I$HHHHx HʁLRS HƉ%uIH(8t=HsS H<%(HH)H~1I$H]HImHH[]A\A]H萞fDHH(HAVAUATUH-(SH(LmHI}HPH(HL$ЋG % =tr1~cIH(8ugLHcAD$ H։H?u[H(:tOIt$AD$ MeHLm[H]A\A]A^H)(Lw8tH5 1vL舝fDAWAVAUATUSHH(L%(HI$HPH(LsH;HH,ЋG % ="1bIH{G % =1"[bIHi(8LL荜HcE H։H?H(:tsHuE HR(HkL0I$HH[]A\A]A^A_DLoYH(L8tH5` 1nuafH8fDAWAVAUATUSHH(L%(H(HI$HH;HHLsDx G H,A% ="1%aIH{G % =1"`IH (8LLA6tebHcE HH?HK(:HuE H(HkL0I$HH[]A\A]A^A_@{HcfDHy(LG8hH (Ic1LD$H4sLD$DLoH踚sAVAUATUSHH $HH-(L%6(I$dH%(H$1HEHPH(HL,H(H@(H;G % ="1_HILHHxILLj~AE@ucL+HEI$HH$dH+%(uLH[]A\A]A^fHQ(HHHEI$HDHvL衇AWAVAUAATUSHH(dH%(HD$H(HHH(HHHH,@#t/H;HHt#G % =WIEH;W  H":^L$$IE1Iv C|'/H/(8>DL3HcE H։H?-Hv(:HuE H+EH(HH(HHHT$dH+%(H[]A\A]A^A_DC|'/upLIL$$Iu HMuU1IAf$fHLL`L$$@LP\HL@ @賌HB'LLAIH(8H5 1pDHPffDAWAVAUATUSHL-(dH%(HD$H(HIEHPH(H;HH,ЋG % =H"6\L$$IE1Iv C|'/H+(8*LbkHcE H։H?Hu(: HuE H+EH(HIEHHT$dH+%(H[]A\A]A^A_f.C|'/u`LIL$$Iu HMuE1IAf(fHLL`L$$@LP]ÊHB'LLA IH(8H5 1nDH`vfDAWAVAUATUSHH(HH;LkG % ="1nZILsMtAF L$H@L`I|$I,$H}(H}0Ht 蓋I,$LqHE0HtnH/(HCH<(L(H (HHH[]A\A]A^A_DIFHjL`MrXfL,ku H(HxIFH= H@8HLEIHp 1ˍff.AWAVAUATUSHHw(L-H(L0IED`"Au/Hg(HHcA(H4@HHqHD`AM>InMtAG L蕄H@HXHHx0Hu)T@LL}|gHEAuuHLHx0sHHx1ψIHuHa(8HQ(HH)HHHnxHfIHV(L8IEHH[]A\A]A^A_DIGHHXH!fIEAtH (H (HHHUH)HH[]A\A]A^A_E11ɺt1L\'y,AApLA~t*At,H` (HIHj(L0IEH HL(H(IEHff.fAVL5#(AUL-(ATUSIEM&HPH (I,$HHHt E vpHkH@H@HHx0HtwrS сH (9HCS I$IEM&[H]A\A]A^DHEHtH@HzHHx0HufDH?|u H (HI$IEM&[H]A\A]A^DHHUlAVAUATL%(USI$H;LkG % =蕇IHkHt E vUH0H@H@HHx0Ht\LaHe (HCHJ(M,$[H]A\A]HA^HEHtH@HtHHx0Huf.H>{u H (Hf.HLp 2@ATL% (USI$H+Ht E vIHLH@H@HHx0HtHyH (HHj(I$[H]A\HHEHtH@HtHHx0HufH=zu H( (Hf.AUATUSHL- (I]H+Ht E vcHH@L`I$Hx0Hta I$H@0xTH(HH (I]HHH[]A\A]fDHEHtL`MtI$Hx0HuH<zu HH(Hf.AWAVAUATUSH(dH%(H$H# (H(H (HHPH (HL$H(HH)HL$1Ll$zdL`LLpL})lByIƅH (H(HHt!@HHH=uA1LL$ tpL$ AH (1Љ1‰1H0( 1Hc1‰1ЉAD$ H7 (:It$AD$ LeH (L8H (HHH$dH+%(H([]A\A]A^A_D1LL$ oL$ AyHQ(HHEH ( +HH (:IvAF H(HL$LsHIHHT$dH+%(ufH([]A\A]A^A_f.HH(gfHHh @HL` v@L訇quff.AWAVAUATUSHxHT(dH%(H$hH (Hl$ L8H}(HHHpH2HcH(HHLlHPH(HL$M9sBnfD1HL[LAV Ht$ Hǁ IIEM9r9MuAV % =uIHpHt$ I~DH (H-(HH؀}HD$1Hl$0L$]H|$(HD$~HsLH1jcr8 :g+eAŃtۅT$Hl$L$0L H$HHD$ q8j1HD t1LIiL< Ht$- D$L- (AEOƉ¹EJ~ % H'E1Lt$ 0H2 (HcHD$xe@DH|$(H)LWHAAvً|$(0PApT$ HHu'AEAD$ 3Hj(:#It$AD$ H (HH)HH(LcHHH(HHH$hdH+%(gHx[]A\A]A^A_fDLpKAV *H (HAD$ H(:wID$AD$ H (HH)HdL$LcHk1L6gH(H(H(HH#f.|$,NCf1LfL Ht$ L- (AE@|$(ONE2H'Hc08|$('N|$,N4fH-'HHD$}fDk}}H5 1[HHߺgHL>HL*HHߺgH1Le|$Ht(Dd$Dl$,HAA@"@uzHt$LH)Ht.EDL1-WoDH= 1SMI?c1E1ɹL (HǺ3DDH0HD$EDLHxHpm-늋|$(L:ff.fAWAVAUATUSHH(H'H(L5" (L8HM&HHH Hc(HHHPHe'IHL,H4'8S1WH@"@LL)HLE11L1,AE I.HS(:IuAE H(HH)HH'LmHH(HHH[]A\A]A^A_f.I?CbHNj@ % =tA15EH11/GI|$It$E11L+'Hf.HH0eHGLhKzIM9r+I<$G % =t "1DH!(8tM&H'I8[H5 1 XHff.ATUH-j'SHEHPHj'HHfwS Hc%ulH'8t`HsS L%G'H(I<$HH)H~!HGH_I$HE[]HA\fHdI<$DH@~ff.AU1ATUSHL%'H'L-'I$HImHHH@#t2LEHMt%A@ % =tuLǾHuHDKeS Hc%uYH'8tMHsS H(HH)H~AI$H]HImHH[]A\A]IHx HH}fDHHbHff.AWE1AVAUATUSHH'H'H-'HHLeHH@#L,<H>(HL)H'IE1H!'8DD%THcAE H։H?Hg':IuAE M,$HLeHH[]A\A]A^A_fDI<$IHu[I<$E1HkG % =tlsIHp'8OH5q 1T5DG % =ta7sIH@#DHLp @LL0aILh{HDx )@AWAVAUATUSHH'H-'HLuHPH'MfI>HL<ЋG % =}srII~G % =tmSrHDxNAW Hc%uUH'8tIIwAW M~HLeHH[]A\A]A^A_ÐHLh HHx LXzfDAWAVAUATUSHH'L%'HI$HPH'H;HH,ЋG % =wqHH{ALsG % =LqIH{G % =(qH':DD{[HcE H։H?H^':HuE H'HkL0I$HH[]A\A]A^A_HHP (@H'H:H@ iH5 1HD$RHD$L@HLx @HxpAT1UH-8'SHEHPH8'HHDyHƋC Ht't_HxZHsC L% 'H'I<$HH)H~HGH_I$HE[]HA\H]I<$DHffDAVAUATUSH@H'dH%(HD$81HJ'H+HH)HoH|$LmASL% 'ffH*D$I* $^D$&_D$HEH_L5'IB"u)H'HHcA(xH4@HHqH@<t,L+HHT$8dH+%(H@[]A\A]A^DffLm I* $H*D$^D$^D$HEH>_ffI* $H*D$ ^D$J^D$HEH_ffI* $H*D$(^D$^D$HE H^I&f.HH[HySdAVAUL- ATUSH`H'L%'dH%(HD$X1HI,$B f%f=NH LEB#H}HHG % =_= % f(fTf.sf.D${RLD$H59 8=D$f.D$H|$ ufH*D$ D$ f/f/ -HHt$ H|$@ f%f=N&MIMHB"u)H'HHcA(xH4@HHqH@<H 'HH)HLmMEH'HRHH5q HH1_H$>IGI~IGIcnZQHIo IGHg1Mcf>QIG HLO1MvMu"T@LL}IhHELI>Ht,HH)HHHNI>HfIMIH'L8HHT$dH+%(H[]A\A]A^A_fPI_IGIMt;dIFH8t%LKIFIcVLH0YDHI'HIEHnf.4H A'%,DI?G % =_IIEMgG % =HPH4$HDMHEII?MgG % =1OH5MI}I6H<Hq']fDHL@ G@LL MIHHHpH4$I@HxZUf.AWAVAUATUSHL-'L5'IEI.D` AAgAhS@HHHC'HH)HIUB"u-Hg'HHcA(H4@HHqH@<u}Ht^H;1>\H:HEH{HELccMLHEH-DcH] MHE HLH-IUI.HH[]A\A]A^A_DML}HEHHtAgH3:IEM>HH[]A\A]A^A_D32Hy'%DH}G % =\HH}L}G % ='LHljLVHWfH}L}G % =1MHA9LHfDH' fDHHX `@s,HHXJHHHx P@Hf.AWAVAUATUSHL%'L-'I$ImX jRk)IH'HH)HI$B"u-H'HHcA(H4@HHqH@<uiMtFI>1H]YH8HEI~HEMcvDKLHEHHR+I$ImHH[]A\A]A^A_ KL}HEHMtjI6W8I$M}HH[]A\A]A^A_DH}L}G % =taZHULI@H}L}G % =ti1JH@LIf.HHx IcvW*KfHH0HHaHf.AWAVAUATUSHL%'L-'I$ImX mn.NIH'HH)H'I$B"u-H'HHcA(H4@HHqH@<MtbI>1vWH5HEI~HEA^fIH] HEH,)I~11WH5I$HE HImHH[]A\A]A^A_HL}HEHMtm'I66I$M}HH[]A\A]A^A_DH}G % =1HIH}L}G % =}GHfMt 1A>LDLLSIcH}G % =1]HIH}L}G % =13HHMt 1A>LDLLaIfDLw-Avf'fHHpEHHHx @LwMHgATUSH!'H+H}G % =tkVHL%'I$P ffrtcw1fptJfquNH'HEI$H+[H]A\@fsuT\fHHx {&f]fUSHH7'H@ ff%f w"Hw HcH>fDKQH-!'H'H}HH)HHGHEH'HGHHH[]Pf&f?f{SfDnfDD^fDDNfDHcCH}Sf.AWAVAUATUSHL%'L-0'I$ImDp fAfAy9fAz1fAxWH'HH)HHI$B"u-H'HHcA(H4@HHqH@<~H\H;1RH#11HEKHI 1HEHH;IljT$ $T$ AHtHpHtL1AF  L='A?*DsDHELH6DsCHE HL6H'Lp0Lr>LHE(a>1HE0LsMt L*8HƺL*[A?HE8H{ 1QH01HE@Ls(Mt L7HƺLH]HZA?HEHI$HImHH[]A\A]A^A_ CL}HEHHtfAxH3W0I$M}HH[]A\A]A^A_DH}L}G % =tqRH4LH@H}L}G % =tI1BHEZLHsf.JH\HHx Hf.s4,HsLt/HH ?HE11ɺt1L|[E11ɺt1H\[+E11ɺt1H<[WAWAVAUATUSHL%O'L-p'I$ImX }b~,IH'HH)HI$B"u-H#'HHcA(H4@HHqH@<uyMt]I>1H] NHn-1HEI~NHW-HEE~@LHEHk3I~2 I$HE HImHH[]A\A]A^A_Ð[@L}HEHMt}I6-I$M}HH[]A\A]A^A_DH}L}G % =ta7?HoHLI@H}L}G % =ti1-@H5"LI|f.HHx Avg2KfHH=HQHf.ATUH-*'SHJ'HEH;HPH 'HL$H'HH)H~W$HHt"LT$8LL$LLE \LL$IHt:@8t41LL$>LL$u1~>LL$uDD$8LL$LLυEwLL$HA(H@"u80@#t-HT$8LL$0;HT$8LL$0L;(0HNNNI2F(B8HH+FHHljF(LzHI@`HB0BPH(H0Hr@t$c@2H5(AGH6"N#fJL$dwI7N`H~HN`~3IHD$HHT$@q`LL$8H|$0dCHD$HHT$@LL$8H|$0IL=>(|$cHcq`HOH HHIIH5(H H6H~H(HzXHVHtAHJ(L1LHHD$8LL$02L(LL$0HZ(I HcQ H4RH4HQHHD$HHH(z;8HD$8};DLL$8HT$0(LL$8HT$0L(H!(L=R( .HJ@HHtHIHzHIJPHH`HBHwwIJ8H(VfHL$@LL$8PHL$@LL$8L(AF M2AF |$cs1LHyLLL$01L(LL$0IHcB H @H HBHH(HL$HHH(z98EYrLL$gEl*XLL$OL%H (HrXH HIHy(Hq(HBXHtw8wIH9H@H#OH41HD$8LL$0HT$V HD$8LL$0L(HT$J4H (HD$ HHHL$LHHLHq8H(H"H",Dl$cLD$d; ]GL6(LL$8IIIFLpMYLL$jLL$HD$HdLL$0LL$PE#LL$HHAH7HOL^ L9(L)L_HHNLL$0HT$&7LL$0HT$Le()LL$LLEti[ LL$@LL$1mJLL$"8Ht$x1HHG1HH= 1LL$RLL$HD$8LL$0HT$t6HD$8LL$0L(HT$?ZAf.SHHHt G vwHAH@HPHCH@8HHDHzHHH H(H8G tWf%f=tuH~(%HH5. H1[%DHGHtHPHurff%f=t>H'(%HH5 DHL$:HL$HHL$:HL$Hff.@ATUSHtgH?Ht^1H=7 NH-j IHL#H3LH-H;uL[]A\fDH([]A\Hx0w1AUATUSHHH-(L-(HEI}L @"u\HHE@#u7HL[]A\A]fAD$ ff%fwAD$#tM$$MuHL[]A\A]DH (HH)H~HWH_IUH4I}HEېtKtuYG % =tD A@G %=uHt HH@HHGDG % =tD AuG %9= tD Aff.AVAUATUSHL5k(L-<(dH%(HD$1IIUH(E B#EE1HE@HH@H|$\$LIHH&CIH@ LH+(HH\AD$ tID$@tHH@t1LIEP#@"tL`(H(I>HH)HHWLgIL f.HD$dH+%(HL[]A\A]A^@ HE DI$Hx [fLI{IL IElfI$HtH@H HtID$80@L;%A(두HsH61I>IE9DAWAVAUATUSHH(H(dH%(H$H(HHHHLHHw(H;HH)H~aHoHGHH.HUHrHBH)HvHHrH}8A}HEtE11ɺt1HJk@H3/H;fDH(H<(@uH(HHHH(HHH$dH+%(H[]A\A]A^A_f.HtuuL!4t*‰E֍q@~ Ɓ H N(Hu(AUH(HLgHDHL("HefDy,L-(@ŃA}H5 1:!H(H`HLLZ@{BH-(HHe(11LHHEy,fILLHPH(LL{HHPH(HH,H(HHp0HL(Lt$A HLH|$uH(H8HGH8H(E uKt(LN(E11LHYH|$.H== >HH2HEH5 HH8T=IHH9(HHx0Ht HHx H 15H{H (HHx$:H^IH|(HL)HI$HA(HI$H;H (L*IH+HIoMI_IFM}Hx!IEHPIUH8 HH H5 HH1/H@QHE RLD$>LD$ELLLD$#LD$Iff.AWIIAVAUATUSDHL%(L5t(H|$DI$dH%(HD$H1HFHRHDƉ|$ IHH2B HHz(L-B(f H2H-(L(H6H+EHFIuHLH6HFIxH}IH@HH4I2I0MEEHvI$IPHH)HHI>H9H(H8HWHH'(H;IH+EHHA HI>t$ LWHGMET7hH|$ށM>HHEII$HxHIEH7H (HH@HFHEHHRLLHL$ IuHRI<$HHBHDI=Hi(HHHT$HdH+%(eHĈ[]A\A]A^A_DAH$\$AHD$8HD$PDD$00EHD$@/fDƒHT$@D$0IH:HPHxIt%At*D$0/vHT$8HBHD$8fD{Au֋\$5L=t(L9H=" 9IpIHIwLT$LLD$:9LD$LT$MM,DHcHH)LH)HH9L$H}H)LI48JD%ItHLD$(DL$$HL$L\$LD$(DL$$HL$L\$DLLD$DL$:H^LD$DL$S DL$$HL$L\$.DL$$HL$HI$L\$HBHPI+@LD$(DL$$HL$L\$w9LD$(DL$$HL$L\$HHHHI.}')AWAVAUATUSH8H(L-(dH%(HD$(H˷(LHHHH HcH4(HLIEHPH(IM{MsHH,AG < tЃ %=IGL`Mt&I$I$Hx0vAD$%M9IGH8HG % =Ht$ "LL$HT$ LL$HM)1MFLIH L(H1H2(Hc0E sH(:cHuE HCH5~(HkHIEHHT$(dH+%(H8[]A\A]A^A_DI{MsG % =$HHwHPHT$ 0qLL\$LL$))LL$L\$HHHl(M)IHHHD$(dH+%(H8LA L[1]A\A]A^A_H(IMHCH^(HjHH=e(HHSHHfL1LL$'LL$H@H8Hx6H= 1LL$L\$HD$LL$HL$HL\$H H=(H5L 1;$IGH=@ H@8HLEIHp 1/AVAUATUSHHa(L-(HIm@#LeHMAD$ vBLeH$(t"HEHHImHH[]A\A]A^H0fID$HtLpMtAFtqL'HHtHj(HHHLHE1[A]1A\A]A^Hy(L HW(HH)H~4M)AD$ T@H9(L @HH@HH=? 1HD$8HL$HHJ@AWAVAUATUSHL5(dH%(HD$1M&I\$M,$M|$HtC qHD%H@HhH}t 1HMtAE L%H@HXH{t 1LH<$H5[ |$H5N HEL+yIE(HEHUHP(HH@(HCHEƀH}Ht HHx(Hí(1f<$HHx(H#H(HID$Ht(M>HHHT$dH+%(uqH[]A\A]A^A_@IEHHXHHCHHhHp^fD|$_} ff.fAVAUATUSHL%(Hʮ(H-۰(I$HH]HHL,@#tBHHt P v^H(HHI$H]HH[]A\A]A^Ha(HHHH]HH[]A\A]A^f.H@HtLpMtAFIHx0HuWI~Hl%AU Hc%uBHC(8t6IuAU L+I$H]HH[]A\A]A^fL1fDqL"HHdH- (HHt#HHsLE1[A]1A\A]A^H=P 1HD$^HL$HHff.fAVH (AUL-(ATL%(USI$HImHHL4@#H}HHG % ='Hl.H{(8AF މH԰(:IvAF H9(HH)HI$LuHIm[H]A\A]A^fD-Ãq-H(8jH5$ 1vWHHx 3@L8/kHHHfAWAVAUATUSH8H-(dH%(HD$(1Hh(H]HB#L#uvE1L3MtAF L  H((HHH (H]HHHT$(dH+%( H8[]A\A]A^A_DHf.HѨ(HHHH]HDIFHiLxM\LSAGMoM@LU1HD$ Mt/AD$ % =Ht$ L"Ht$ ILOLLAIDdtXIHx(HtI;tLD<t0HEH(HPHHEH¬(HHH(HEHI$Md$HpHt$ RfqLLT$LT$HHH(E1MAHHt HLALAT1ZYH=6 1LT$DL$HD$3HL$LT$HDL$HsAWAVAUATUSHHH(H (H٪(HH+HPHH E(HcL9HIHD$MoMgAU ƒ sHD$qL5 w.сD$qL5{  fHIL)IHD$II1 HH6LHD$(D)H|$(HHD$  &L (H+IH@H"H@ HHH(L۬(b HH="(I2HL](H+/HBHHH6HnHrH7H:HHH (HHIHҩ(HI2HH59(H,HD$ HH+HH;HHL$H)H0HIH)H9|H|$t1fITHTHI9uJlLL\$(LL$ LT$H+ LT$LL$ L\$(IHHJH(HH=](I2HH6H+HHFHBHH2HHvH4I3H2IHvI HHxt*t$L8HL9mT$E11L )U H ޯ(HD$HHhHHH(HHHH[]A\A]A^A_@%LL5 uAE D$P% @AE fDIWB < 'HHx/HLH=| 1DD$PL5 4@ IEH@H1D$qIL5g @IExHyLIELh@DIEHp0H1AU ~fAE 1]HHLL\$0LL$(LT$ L\$0LL$(LT$ HP@Hy(HP01Ҿ LL$ LL$ H+IHPHB1fHHLL\$8LL$0LT$(3 L\$8LL$0LT$(H@ Iw11IH "LLH=z 1@L\$0LL$(LT$ %L\$0LL$(H C(LT$ HAfD1Ҿ LL$(LL$(H+IHPHBH= #HL\$8LL$0LT$($L\$8LL$0H (LT$(H1 Hk(L0MIHH (HHIIFH(HPxHHH (Hz HHAxH1H)HHǂHI H=b KHd(AN HD$H:OHD$H@H@ Ht@IHIH@@<IFIELpIEH@I HH=vy 1H=| 1HP<~"H@ HHD$ HT$ LH= y 1| tH@ HD$ H@ H@HD$ @AWAVAUATUSH(Hw(L3I.MnE ЍJS ubHUAqzHy~uTDHE < H(L3IEHԡ(HHH([]A\A]A^A_AqtDHIHtH@ H#HHHtHHL$H8Ho1H5z HL$HHt x A>HPH5x +1~"fJHEHhHXE DAPDBBHUHr0H%1E D1H DH1FHH@ dfHX!H H@L@MH(HHHH(H;H(L+*ID(IG HIH(HL)HALD$IDhLIHL3H|$uL+Mu@H(IH(L3HHH(HLD$HL$T HLD$HL$ELLLD$HL$SLD$HL$I2LD$H|$bLD$H|$HL$ff.H(ATUSHH+E ЍJ u@HUAqzHyu2H(HHHx([]HA\HDAqtAHHtH@ HuH1HJodHEHhHsE HDAPQDH1螧HH=@ .f.AW H=w AVAUATUSH(H(HHHL0HhH@HL$HD$%1HIXHH5xv HIIHwL=(H (IHIH;H (HH+HH(HH)H HD$LmHEAF % =LHEHEHAF u H(Lp0Lu ID$H H+Hx,H+H}`IH (HUHIH;ZH Ӥ(HH+HHD$LmHE$1HEHLuID$H+HxH+H}Hě(H+HHH([]A\A]A^A_@H=9u H+qLH+H5t IHBH=t 1{BHEHJDLt$PLHuE11ɺPLKIH@ V@[fDHHHHT$&HT$H=Ut H+:AWAVE1AUE1ATUSH4t HdH%(H$H(Ld$hH(H_(HHPHa(HHHD$N|5AG O<4 t:-kIHz]  I@A9DLIIuH]DD$,DC E1LT$`LL$@Dl$Hl$MDLd$ MM<1AG tIHJHIDHH uDl$LL$HME1HL$XHT$PH\$HB<LLL$Hl$Ld$ LL$AMt#K4H(HAG A;G$AG HH4@H4IGHHNNNPHD( HH+H(H (HHcHHXHPHĕ(HH+HP,H(P(H(HHPH^(H HH H (H H IQ(P8HH+QHH։Q(HhHH (Hՙ(Lh0HL`PHPXHHP@1fPHUEB`H@XHt@HEHcp`~HxHHEHcp`H@HLH@HHHPH(HHEH@(H[]A\A]A^A_fDHEL5(@\ dHT$HT$HCT$L$T$L$AG M>AG @f.z,PAWAVAUATE1USHH̒(HՏ(L-(HHImHHx#LuHL fDH=f 1HL$DD$@HL$DD$HH(Hz,t,AAHtE1ALH1CAAHtE1ALH1Hs(HH)H>MQMATUH-J(SHj(HEH;@#teH7HH;HthF wkHFHtbHPHtYHLbhMID$Hx0HtzHE[]HA\{H(HH)H~6H(H0HuHHPHH(H0HPHE[]HA\fH뻐I}L11HHHH=e 1AWAVAUATUSHHdH%(HD$8HY(HHcB H @H HBL4H(M~PIWLjHZ fM@ff$@OIMLa(M>H(LAHHH2L;F HD(INL%(HHI$Hψ(A~;:+I~XH|$H|$IFXwwIV@H (HHtHRI~HH 4(IFHHHj`wnwH1(AN8I<$HHא(J(H u(Icv,HH H)H4H (H1Av(H O(1IvH b(H1IvH (H1Iv H (Mv0j H1Hf<$@MIUHj(HH;HBHHH+A HBHH謪$I$HPI$H)(H0HPH (HHHD$8dH+%(HHL[]A\A]A^A_fDHa(H;%HyXetHHxHD$HH|$HD$ H@HD$EMHl$HD$EpH $LD$(HHDI@HxKL H)[HuH $LD$(Mx5Hy8~.H= LH@H8wIMHA@HAHIEH@8Hs(HHIEIEHhXHEHx0HHD$8dH+%(H(LHHH[]A\A]A^A_-DHi(@I$HPI$Hm(HHP?fDI}t<Lc Lc HHHB HHBHHPHAIEI$HPI$H́(HPH$fD{fDk8fDH5_` 1H;!DHyPHt?1HHPHz0IUHBXIMLAHYfDHy`IH=_ Hp 1H1HIHH@Hx0 IEHD$AF % =CHt$0L"gH|$0HHHt$H|$0HT$0Ht$HJH|$HGPIEHxP@IEHP@HPHHm(HHcB H @H HBL4vH<HHH|$ H+D$LHGH|$_H;Ht$HHpHHIUHHRHH)P IMLAH|H=^ ~HMuto@f@pIFPIEHxPIIvHxIHL$Hp LvLHPHHT$HT$LHHL$HA`H11IHcLH=Z 1fAWAVAUATUSHH(L=(HHHH H O(HcIHHHB"@uL@HhL-(IUMtA@ E1H9udHE(HH)H^IEHPIUHC~(H0HPfDI|$LD$LD$t @L_ H}(HH5{(HHCIHSIUHH[]A\A]A^A_I@H7L`H92MtAD$}I$Lp(MLIuHUHHD$H)HH|$L趣QI$H.}(?H(HLfDqLLD$FLD$HI`H~(MMHHH9t~Hw(I)HIHHHLLH[A ]1A\A]A^A_<Lc] vfDL *efH1(HL)HHlI)LHHH=IQH}HHEIELHMM&@HHLD$LD$H=Z 1LL$LL$HHLLϺH2(MMHLH5(H=2 1AWAVAUAATUSHH-I(dH%(HD$H\(HHE@# t/H;HHt#G % =IEH;W  IH{LsL{W  H"}H$HE1EDLstQIFH@HH@ Hz(HCH~(L8HEHHT$dH+%(uVH[]A\A]A^A_HAz(HHL` I@HHwHPH$f@HL@ AWAVAUATUSHH $HH(H5a(L>dH%(H$xH}(L(HHHH HcH{(HIHD$0Ht~(HIwI_HHt$HHH P fHL$PfHF wIoE IMgG % =HD$H|$ 1HD$HM9H|$G HGHH@HD$ HHxHAHD$ HxD$DL5(I@8vHG}(HH f%f= f= E 9 Ht$hHIċE E ID$@@8u HHD$hHD$HD$XH|(H@ f%f=XH?E t,H(H@8uHD$hH9HUHRH)HA1Hl$E1DE1IIϐHD$ HxHL$H|$D$(HIt=HPAH9pHD$HX1HHII9|$@IH\$H{(H@ f%f=yt$(HT$|$(LHHH3LH+CHЋL$DHFHHsH@C %_DC fH~(H@8RI\I9d@u&LL)LH9r7MIE1L99AEH (E1D<LLH9sHLI1L)H)HD$HL$H+XIH|$W HD$H Hz(H5](L|$0HL>I_Hu(H5y(HHIWHH$xdH+%(JHĈ[]A\A]A^A_fH|$tIoE )11HkfDHH@ HD$+I G % =tH&HHX @E Ht$hHIċE D$@ L5|(D$@I@8DH|$HT$8yHT$8H1HHII9FMH<1I)L|$@2HD$HLhH|v(HHHHH{(HL-w(HHHCIEHHfHIU@HH(HCHHyH8Hx(H;8H@u(HHHD$H߁K HpItfHD$ HT$LHxHHHD$(HD$ HxkHT$(nHD$ H>>H|$>S *DHD$XI9H9T$L)HD$HD$H+XI^fDHD$H@HwL`MjAD$^qLIHELH)H{(HHHH$xdH+%( HĈALL[L]A A\1A]A^A_钹fD$@Hl$IՅE @HD$ HuHr(8Hf(H|$PH\$0HG oHx(:_LoG HD$PHCHu(HHHev(HHfEHD$D$dHpE HEH9pHuH\$Lt$pDLL$dMHH7H9HUDD$DHOHBHEHUH@E %_E}DE @HD$ HuHq(8$LLt$PT$dH(~(H\$0LHXLHHD$hHH9HHHHMLeHIHL$h-H9H1HH:HkHULeHRHT$h; HA$HsLǃ@t.H=}( f.HHsL)HBHtHtHsHD$H D E |H+HH|$PLHD$H HsLBHJHʃIUHHT$8dH+%(8HH[]A\A]A^A_fIFHzL`|$MAD$IEM}HD$eHI|$H3I$<MAƅAW % ="Ht$(L%AW HD$ I|$Ht(H@8RHT$0Ht$(HD$0H|$ عi|$RH|$H9<$HT$(1Ht$ DHt$ H Sy(HIL{HhHt$V с_H q(9OHFV HD$IEH}o(L8HKp(HH#<L#L fDqLkHHHH$HI9H$Hs(L)HHIHHD$8dH+%(HHHLL[A ]1A\A]A^A_!Ho(H8G f%f=#Ht(%H4H=F 1fDIH@HD$(IGH)o(HfI}ImG % =IMDH9,$HI} G % =>HHD$(HH9kH)LL9HFI}ImG % =e[IH9,$I} G % =CHt$0LL$0IHT$(Ht$ DD \fDHHH9HL9IG&fHt(H<$HL7H)HLIH$HXLHH$HxصHl(H$HDHHp @HT$(Ht$ DDfDHLx \@H=^G 1H$nL $HHRH|$HfDHLx HLHLL$0LGHH$dIEM}HD$rHM@H=F 1͸HD$(I9IF1HHxl(H8G f%f=t>Hq(%H4H= 1HH= 1aHfAWAVAUATUSHL-k(H k(IEH;@#tcH/LgHUj(AH(HCE vwHHf(t\ID$IEIL#HH[]A\A]A^A_fHqr(HH)HZx"Hi(IE1H(fDH0fHEH|LpMoAF+IE@#Vx"LI~AIt/HEHx(HGaHH@HH]1H#|HHe(fDHe(H Q ցt;Hh(HH~e(HHH;HH[]A\A]A^A_f.҃ wHAIAHh8Hh(H(IDH3HIEqLCHDHD$H-m(HL$HHHHLALSA1 ZYfIEL@HHIL=j E1E11LHH@ I^HUL2MtdLLAF@NLAH H@Hx(H=$1HL$HHLHT$*HT$Hff.fAWAVAUATUSHL-h(He(L5g(IEHI.HHH@#LeHMtxHf(L AD$ LS с8H yi(9(HCS H]IEHI.HH[]A\A]A^A_DHn(HH)HH+f(L MiZu C Hh(:HCC iID$HLxMAGqL}HHHj(HHtrHLHE1[A]1A\A]A^A_jf.HHEHHHHHH=@ 1HD$HL$HHgDAWAVAUATUSHL-we(I]H;G % =}#IH{LsG % =EIHkHmd(H(Ht E vYL=e(DLHI@ f%f=?H H=A HWfHEHtLxMtAGtqLLD$LD$HnLHD$IcHL-h(HL$IIHATLHsAUA1胧ZY H_(HHCIMuHH[]A\A]A^A_HL@ @HL` @˃H_(uH0f.HHH=> 1HL$IH>ff.AWAVAUATUSHL-Wc(ImH}LuG % =IL%c(HLEI$x"A@ tIxW H V% =-LǺ 1NIH\_(8LL`HY^(HEI$MuHH[]A\A]A^A_Ѓ `I@HtkHHHtbH^(8gHyHtIH|$H|$xHy=L1HcAF t!IHPL:?AF@HH$AE H`(:ImAE H^(HL$LkHI$HHT$(dH+%(H8[]A\A]A^A_IGHlHHHtZfIM~HpHt$ HHh @L1uHcDL; [ HY(HHCH](H\$HI$H) H5|: LDAE@LA@IqLHL$LL$BLL$HL$IILHf% =tTLHL$HL$HIfH=ac(HcHL$D$H41RHL$D$@IHP HL$LxI<$G f%f=tHe(%H4H=4 1~Hff.@AWAVAUATUSHL%](L-0\(I$I]HPHZ(LsH;HH,ЋG % =IH{Ht G vb9 `1 U %H](8HuU HkI$MuHH[]A\A]A^A_DHGHtH@HtL@MtLLD$H|$VD蜿HcHH?eDHLx -@H`pff.AWAVAUATUSHHZ(HH;G % =IH{G % =pIH{L{G % =RHHH{HtG H|$H|$H@LpI~t1RHV(8ZDDKŅxH5S QM&H5S IF1@H$HD$(H9HD$HD$xHD$HD$(LcLkL9IpIG@ttHH@th1L:Ht$趮Ht$HHti@  HDX EE1D9ufMl$IM9vXM|$I4$Ml$AG uF tHF@tHH@xfL8E1AD9tILd$0ILMM9M9/LILPM9uHT$0H9T$(z HD$LHD$L)HH8 L9IBHfHHHRtHpL@HpL@HH9rHCIRL)HLpIH9ӺLBHBJ 7IHL$HL$HDHD$I9M9MLM9 LfH{H3G / HG@! HH@ 1ɺ:Ht$ H|$軬H|$Ht$ H P  HDP E 1f.9 HL9kMIM9II7G  HG@ HH@ 1ɺ:Ht$ H|$H|$Ht$ H P w HDH E 1f9pLM9@MH|$IL9H|$II9{HL$0H9L$( LL9t$(}H$HD$E1HDŽ$D$dH$H$H$HL$xH$H$HHCH~(L$dHHL#HH)HSHL$dT$dHL HCD$dHD$HLcHCa L$dȃHĐHD$XȃHĘHD$P@HD$HHL$XH\$PHHD$HH4HHD$0HHt$hHHH)H)HHHT$8HD$pHL$@H9 H9 Ht$HT$@HD$L HD$H(E FHE@8HH@(H1ɺ:L֩HH2@ Hx 6H\$HD$8ALd$HD$L{L9|$31AI<$I7G HG@HH@1ɺ:Ht$(H|$ 3H|$ Ht$(HP HH fHI9Dl$ZfHE@tHH@tsH1ɺ:LȨHH|@ HP fMI9v}LI,$H)HHHH?HHL,MuE wAF t IF@tHH@lfDLH5|D9D$}I]I9wHD$H|$0HI9DHL9rH\$LH)HKHHI9HHBHHH\$H\$0HI9ϹHBHL$HDHD$0HHHAHD$HL$H9L$8vHL$H9L$@THL$H9L$8HL$H9L$@'HD$0HT$PHL$XH\$hH)Hȃl$dHt'Hl$HHD$HHL$PH@H+ HT$XyHD$xH$H9tH菫H$ dH+%( H []A\A]A^A_H$pHH$HD$x@)E11ĤF t"HF@tHH@Kzt6A95HK6LHLOKH;D$I)Vu 1fD111D).u 11 1fAD$ t ID$@tHH@DLHy<؅H\$HD$@E1Ld$HD$L{L9|$IߐHD$HhL9>L|$@ Haff/ff.1% =ff/f.1w_1Of1YHt$HL9rH\$LH)HKHHI9HHBHHH\$H\$0HI9ϹHBHL$HDHD$0HHHAHD$sI<$HpG tjHG@t`HH@tT1ɺ:Ht$(H|$ ƣH|$ Ht$(HtOP Hp (DI_I@F tHF@tHH@u@cwA9D)莫1ozf.H@(H@(=9}L9M9MH|$M#F tHF@tHH@vtV؅F tHF@tHH@7[v1ۅd@)膪A1E1D$]D$ HEff/[1f.ƺEQIBI9 @IHIHINHPI9r)11şH|$0Ht$HD$8HH9wHT$8HL$HBH)HHH9ʺHHBHD$0% =hff/Zf.J{LMHL$HD$MuHAH)u1b11T% =4ff/E1f.ADEH@(iLxHpAG IG@t|HH@tp1L:LT$ Ht$Ht$LT$ HHte@ 9HD@ EE1HD$(D9HDLDLDAE;F tHF@tHH@pLLT$sLT$E1A뒁 vH讓ff/l1f.ǸEZH@(H|$0HD$@HHH9wHD$@HL$0HH+D$HHDHD$0 <H$ff/.ff.zt1SHD$hHD$HD$8HD$D$duHCG11H@(HT$xIH$J<"J,!HHHHH)H)HL,L)HHHHEI9ŸHB聦H]L+9H@(Ld$pH\$HI)LT$E1LT$1LT$H@(Ht$xJH$H<H,HH)HL,IH)HIHHHEI9ŸHB迥LmHCHH@H1ɺ:LHH@ HX 1HH@urAE% =tsLT$LT$ff/E1f.ǸADEHD$)1贤11蕚%H\$HH@(@@% =t;iff/!E1f.AADH@()KfAWAVAUATUSH H$dH%(H$ 1HHHH=`HH萚HD$xH$pH$H$H(HL`H\$ E tHE@pAD$ tID$@HL1'x@H$HD$ H9qHD$xIHD$HD$HD$ Ml$Mt$L9HuIG@tvHH@tj1L;H4$臚H4$HHtk@ G H1DZ E~9uaMuIL9vLM}IuMuAG uF tHF@tHH@vL#w9tL4$H\$Ll$(MfDH$M$II9M9?LMLPL;$uHT$(H9T$  LHD$L)HH; MHM9vvIBHHHHRtHpL@HpL@HL9rIFIRML)HHXHI9HBHL$HI9ֺHBHDHD$L94$L;$$HD$xH$H9tHnH$ dH+%(H []A\A]A^A_H$pHH$HD$x(MHMfHL$(H9L$  H\$L9d$ xH$HD$E1HDŽ$D$\H$H$H$HL$xH$H$H HCH~&L$\HHL#HH)HSHL$\T$\H HCD$\HD$@LcHC L$\ȃHĐHD$PȃHĘHD$H@HD$@HL$PH|$HHH$HH4HHD$(HHt$`HHH)H)HHHHD$hH\$0HL$8H9 H9v Ht$H\$fHD$L HD$H(E ^HE@PHH@@H1ɺ;L視HHJ@ Hx HH\$HD$8E1Hl$H$L{L9<$KE1AfDHG@HH@t{1ɺ;Ht$ H|$H|$Ht$ HtyP HH IK6LILOKH;$IH}I7G kF tHF@tHH@erA9|HI9D$$hfDIE@HH@tzL1ɺ;L LIM9vuIBHfHHHRtHpL@HpL@HI9wIEIRLL)HLpII9LBHL$II9պHBHDHD$L;l$H;l$fHD$xH$H9tHyH$ dH+%(H []A\A]A^A_H$pHH$HD$x)E1+}1 sMLMfHL$0H9L$( HLt$ŃH9\$(2H$HD$E1HDŽ$D$dH$H$H$HL$xH$H$HHCH~/L$df.HHL#HH)HSHL$dT$dH HCD$dHD$HLcHCe L$dȃHĐHD$XȃHĘHD$P@HD$HHL$XHt$PHHD$HH<HHD$0HH|$hHHH)H)HHHHD$pH\$8HL$@H9n H9e H|$H\$HD$L HD$H(E HE@HH@H1ɺ:LrHH@ Hx H\$HD$@E1Ld$HD$L{L9|$1ADHG@HH@t|1ɺ:Ht$(H|$ HrH|$ Ht$(HtyP }HH HK6LHLOKH;D$&II<$I7G jF tHF@tHH@dfEA9|HI9Dl$bfHE@|HH@tpH1ɺ:LdqHHt|@ HP 2fI]I9vyLI,$H)HHHH?HHL,MuE vAF tIF@tHH@oDLHD\9D$|MI9wHD$H|$0HI9HL9rH\$LH)HKHHI9HHBHHH\$H\$0HI9ϹHBHL$HDHD$0HHHAHD$HL$H9L$8vHL$H9L$@HL$H9L$8HL$H9L$@HD$0HT$PHL$XH\$hH)Hȃl$dH|Hl$HHD$HHL$PH@HHT$XD)wu 11m1f.)wu 11m1~f.AD$ t ID$@tHH@5DLH CLLH\$HD$8ALd$HD$L{L9|$IIHD$HhL9>L|$@ Hbff/kf.1@% =bff/f.pj1]fm1aD17Ht$HL9rH\$LH)HKHHI9HHBHHH\$H\$0HI9ϹHBHL$HDHD$0HHHAHD$SI<$HpG trHG@thHH@t\1ɺ:Ht$(H|$ FmH|$ Ht$(HtWP ~Hp _u 1A9RI_I[@F tHF@tHH@u@@u)ut1k)t1jf.H@(H@(%MnHG@toHH@tc1ɺ:Ht$ H|$t9tM)rA1Et1D$[hD$|H|$0Ht$HD$8HH9wHT$8HL$HBH)HHH9ʺHHBHD$0% =P]ff/LMaIFHD$IHD$Hh% =]fE1f/fgH@(LxHpAG t{IG@tqHH@te1L:LT$ Ht$hHt$LT$ HHtZ@  HE1D@ E~AHD$(D9LDLDLDF tHF@tHH@{LLT${W HI<$II9tI|HuHII9uLMLl$HL|$@Hl$PI|JII)I>H(LL$8HD$(H+(D$0H(H8NH(LL$8L(HƀILpMHAF Ht$IF(IH=(H @IHH@H(IHHHH+H|$cHAHJHHH=(H@HHHM2H@HHHX(H2|$d&H=d(LL$8Z^L5(LK^H= 7LL$8Ht@H (H= LL$8Hh7LL$8Ht@IH(1LL$8H8!TI>1TH(HHHbIHHbHx]H(LL$8HH@HHt@ILL$8Hxq]ILL$8L"(H@HHt@H{(M2HAF A;F$ AF HH@HIFL5(HЋD$0f2H54(BHH (H+HHHBH(HHBH(HH+H|$B,H(B(H(HHBIHB H (HID\$dEQ H*-1LLLL$0(LT$(HNj@ lfHGI9|%H|Gv/HDHI9}L4.LL =LH= I}JLXZIELpAE % @AE H (HD$ HHL$HR=D" 1LT$hH|$( H|$(LT$hW M1DH|/HDHI9}L1Y-LL.<@Mt7HL9HL|HLL>IAG@tLqHMuL4/fu-%=t! LT$hH|$(DH|$(LT$hW DD$\E%=D$\DD$[AALLϨDT$\EL$8LL$/E!LL$H}HT$xE1E1H$THEI[DM|HD$xH0HF H~(HcPL@LL  q#IHBH@1DHEu3LxMt'AG 8IHP0@\HLH|$xoHB\uĀDHB8HD$xHJH= 1$@LPLcHD$IH8@@ LT$hH|$(lPH|$(LT$hW *f.HHp>HA(HHD$H(H]DDD$8LL$EE`?DLL$4DHDl$cH@(D$dIH9% ="1LH8$x$xDD'fDLD$I}IMHQ1DH4HIHHrI9uJ IGvL5y(IH@81LL$>LL$t/L9vvIBLfHHHREtHpHxHpHxHH9rHEIRHL)HL`IH9LBHL$MH9պHBHDHD$H;,$H;$f.HD$hHL$xH9tH9QH$ dH+%(vHĸ []A\A]A^A_H$`IHD$xHD$hDMMIfHL$H9L$iL$$EIAH9\$ HL$pHD$E1HDŽ$D$TH$H$H$HL$hH$H$HHCH~+L$TfDHHL#HH)HSHL$TT$TH\HCD$THD$8LcHCWL$TȃHĀHD$HȃHĈHD$@@HD$8HL$HH|$@HH$HHHHD$HH\$XHHH)H)HHHHD$`Ht$ HL$(H9H9H\$Ht$f.H\$Hl$H3H}*FHD$(E1H$L{L9<$E1A)DIK6LILOKH;$II7H}EA9|HI9wJI]L9s9LH}H)HHHH?HHL,Iu{EA9|ML9rHD$H|$HH9HHL9rH|$LH)HwHHI9H HBH1HH|$H|$HI9Ht$HBHDHD$HHHFHD$HL$H9L$ vHL$H9L$(HL$H9L$ HL$H9L$(HD$HT$@HL$HH|$XH)Hȃl$TH?Hl$8HD$8HL$@H@H8HT$HIDH$HHL9HL$0L<$HD$ Hl$AH\$H$fHt$HL9rH|$LH)HwHHI9H HBH1HH|$H|$HI9Ht$HBHDHD$HHHFHD$fDHpH}CD9@I_L|$0@L HL9vgH}HuJCD9tL9vHL9MMMHIBH90@HHHHHKHPH9r H,$$f.I}IwBD9u MMmI9rLH|$Ht$HD$ HH9wH|$ HL$HGH)HHH9ϹHHBHD$LM=ID$HD$I$H$HXHpHxLT$ )BLT$ D9HD$HDLDLDH|$HD$(HfDHH9wHD$(HL$HH+D$HHDHD$HD$XHD$HD$ HD$D$TVHC4Ht$hIHL$pJ<&J,!HHHH)H)HHL,L)HHHHEI9ŸHB&NH]L+FLd$`H\$8IHt$hJHL$pH<H,HH)HL,IH)HIHHHEI9ŸHBMLmHC[HD$H\$87=Kff.AWAVAUATUSH H|$pdH%(H$ 1HIH HH=p ILCHD$hH$`HD$xLL|$pE1IwI?LH\$3*AI9 HD$hMEHD$H$HD$I]ImH9v4IDHkHI9vH{H3Hk)D9tEL$$H,$MH\$LH$LHI9L9@LILPL;$uH|$H9|$MHD$I)MM$EHML9vvIBLfHHHREtHpHxHpHxHH9rHEIRHL)HL`IH9LBHL$MH9պHBHDHD$H;,$H;$f.HD$hHL$xH9tHiGH$ dH+%(vHĸ []A\A]A^A_H$`IHD$xHD$hDMMIfHL$H9L$iL$$EIAH9\$ HL$pHD$E1HDŽ$D$TH$H$H$HL$hH$H$HHCH~+L$TfDHHL#HH)HSHL$TT$TH\HCD$THD$8LcHCWL$TȃHĀHD$HȃHĈHD$@@HD$8HL$HH|$@HH$HHHHD$HH\$XHHH)H)HHHHD$`Ht$ HL$(H9H9H\$Ht$f.H\$Hl$H3H}&HD$(E1H$L{L9<$E1A)DIK6LILOKH;$II7H}8&A9|HI9wJI]L9s9LH}H)HHHH?HHL,Iu%A9|ML9rHD$H|$HH9HHL9rH|$LH)HwHHI9H HBH1HH|$H|$HI9Ht$HBHDHD$HHHFHD$HL$H9L$ vHL$H9L$(HL$H9L$ HL$H9L$(HD$HT$@HL$HH|$XH)Hȃl$TH?Hl$8HD$8HL$@H@H8HT$HIDH$HHL9HL$0L<$HD$ Hl$AH\$H$fHt$HL9rH|$LH)HwHHI9H HBH1HH|$H|$HI9Ht$HBHDHD$HHHFHD$fDHpH}#D9@I_L|$0@L HL9vgH}Hu#D9tL9vHL9MMMHIBH90@HHHHHKHPH9r H,$$f.I}IwC#D9u MMmI9rLH|$Ht$HD$ HH9wH|$ HL$HGH)HHH9ϹHHBHD$LM=ID$HD$I$H$HXHpHxLT$ "LT$ D9HD$HDLDLDH|$HD$(HfDHH9wHD$(HL$HH+D$HHDHD$HD$XHD$HD$ HD$D$TVHC4Ht$hIHL$pJ<&J,!HHHH)H)HHL,L)HHHHEI9ŸHBVDH]L+FLd$`H\$8IHt$hJHL$pH<H,HH)HL,IH)HIHHHEI9ŸHBCLmHC[HD$H\$8g3{ff.AWAVAUATUSH H|$pdH%(H$ 1HIHHH= IL9HD$hH$`HD$xLL|$pE1IwI?LH\$%؅AI9! HD$H\$hEMIFInH$HD$H9vAIfDLeHI9v%H}HuLeu%؅D9tL$$Hl$MDM@H$M$II9M97LMLPL;$uHt$H9t$MHD$M)IL3MLM9vvIBLHHHRtHpHxHpHxHL9rIGIRML)HHXHI9HBH|$LI9׺HBHDHD$L;<$L;$$HD$hH|$xH9tH=H$ dH+%(Hĸ []A\A]A^A_H$`IHD$xHD$hDMIMf.HL$H9L$AMAL9d$H|$pHD$E1HDŽ$D$TH$H$H$H|$hH$H$HHCH~'L$TfHHL#HH)HSHL$TT$TH|HCD$THD$8LcHCw|$THĀHD$HHĈHD$@@HD$8HL$HHt$@HH$HHHHD$HH\$XHHH)H)HHHHD$`H|$ HL$(H9H9H\$H|$fH\$Hl$H3H}E"؅HD$(E1H$L{L9<$E1A*fDIK6LILOKH;$II7H}!A9|HI9wRfI]L9s@LH}H)HHHH?HкHL,Iu!A9|ML9rHD$H|$HH9AHL9rHL$LH)HqHHI9HHBH|$HHHHL$1I9HBHL$HDHD$HHHAHD$HL$H9L$ vHL$H9L$(wHL$H9L$ Ht$H9t$(HD$HT$@Ht$HHL$XH)Hl$TH7Hl$8HD$8Ht$@H@HPHT$HIDH$L@M9LD$0L<$HD$ Hl$AH\$H$fHt$HL9rHL$LH)HqHHI9HHBH|$HHHHL$1I9HBHL$HDHD$HHHAHD$fDHpH}A99I_L|$0DM IM9vqII7N؅9tM9vMM9MMI:IBI9"I$HIHIL$HPI9rL<$(I~Iu؅9u MMvM9rMtH|$Ht$HD$ DHH9wH|$ Ht$HGH)HHH9HHBHD$LM&HCHD$HH$L`HpHxLT$ LT$ ؅9HD$LDLDLDH|$HD$(DHH9wHD$(H|$HH+D$HHDHD$HD$XHD$HD$ HD$D$T6HCHL$hIHt$pJG gAG t IWBtHHB`fD% =vHAG % =LHT$MHT$H99D$CMHI9LM4$H)HHHH?HHH,AF LmIVBvHHBfL1ɺ:L,HH @ HP >fDH]I9cHD$ H|$0HI9-DHL9rH\$ LH)HKHHI9HHBHt$0HHHI9ϹHBHL$(H\$ HDHD$0HHHAHD$(Ht$ H9t$8vHt$(H9t$@I|$I4$Ml$uͿ)#A1Et1$$A9tL,$Ld$DII߉H$MII9iM9@LMLHL; $uH|$H9|$MHD$M)ILUMLM9vtIALHHHRtHpHxHpHxHI9wID$IQML)HHhHI9HB1LI9HBHL$HDHD$L;$$L;<$DHD$hHL$xH9tH1H$ dH+%( Hĸ []A\A]A^A_H$`HHD$xHD$hfMIMfHL$H9L$LAAH9\$HL$pHD$1HDŽ$D$TH$H$H$HL$hH$H$H0HCH~&L$THHH+HH)HSHL$TT$TH{HCD$THD$8HkHCL$TȃHĀHD$HȃHĈHD$@@HD$8HL$HH|$@HH$HHHHD$ HH\$XHHH)H)HHHHD$`Ht$0HL$(H9H9H\$Ht$fHD$H0HD$H8rH\$HD$(E1Ld$H$L{L9<$A1Dl$MILI.9l$}ZIHMIHOIDH;$IIuI<$Ńu)1Mt129l$|@LMDl$HfI9vHLI<$H)HHHH?HHL4I6Ń5A9I^I9wHD$H|$ HI9DHL9rHT$LH)HrHHI9H HBH|$ HHHHT$1I9Ht$HBHDHD$ HHHFHD$HL$H9L$0vHL$H9L$(/HL$H9L$0HL$H9L$(HD$ HT$@HL$HHt$XH)Hȃl$THHl$8HD$8HL$@H@H!HT$HPM)11H$Dl$HhL9w^L<$D)ft 1KH\$HD$0ALd$H$L{L9<${H$IHhL9vHpI<$A9|I_IfHt$HL9rHT$LH)HrHHI9H HBH|$ HHHHT$1I9HBHDH|$HD$ HHHGHD$+fDM9uGIM9I|$I4$uԿ)2A1Et1D$ D$ 9tM9vHM9!MIMoIAI9W@IHIHIOHPI9r3L$$f9uEMIM9s9I}IuKuֿ)A1Et1D$ gD$ 9tMH|$ Ht$HD$0HH9wH|$0HL$HGH)HHH9HHBHD$ )A1E1D$D$LMHEHD$HEH$LxHpHxLL$ ^LL$  E1AHD$D9LDLDLDH|$ HD$(HΐHH9wHD$(HL$ HH+D$HHDHD$ 4D$T7HCHD$XHD$HD$0HD$Ht$hHHL$pH<.L$)HHHH)H)HLL,H)HHHID$I9ŸHBI$L+ Hl$`H\$8H)LL$ E1LL$ 1`LL$ Ht$hHHL$pH<L$HH)LL,HH)HHHHID$I9ŸHB?M,$HC)E1G1;HD$zH\$8-@軠ff.AWAVAUATUSH H$dH%(H$ 1HHHH= HH HD$xH$pH$H$H8HHhH\$(G % = GHËE % = H$1H9H$HD$(@H9 HD$HD$xHD$HD$(LkLsL9H\$IEfINjC % =tXHL99uRMuIM9vEI}I]MuG % =uHLx C % =uHH@ L99tH\$Lt$ILl$0AHHL$HHD$ IH9L9RLMLHL;L$uHt$0H9t$( HD$MHD$I)ILE'M9IALfHHHREtHpHxHpHxHL9rIFIQLL)HL`II9ֺLBHBK "HL$HL$HDHD$L;t$H;l$DHD$xH$H9tHH$ dH+%( H []A\A]A^A_H$pHH$HD$x@MLT$MM9LT$LL;t$\HL$0H9L$(HDH9\$(zH$HD$E1HDŽ$D$dH$H$H$HL$xH$H$H HCH~%L$dHHL#HH)HSHL$dT$dHdHCD$dHD$HLcHCwL$dȃHĐHD$XȃHĘHD$P@HD$HHL$XH\$PHHD$HH<HHD$0HH|$hHHH)H)HHHHD$pHt$8HL$@H9H9H|$ Ht$(HD$(H(HD$ H8G % =HËE % =HH9H\$ HD$8D$Ld$(HD$L{L9|$Ld$1AlDnIAD$ % =tzLML99D$&HK6LHLOKH;D$IHD$M'H8G % ={HLh |I$H@ fDH\$(HD$@D$Ld$ HD$L{L9|$HD$IHhL9wI<$L@G % =LD$fLD$HA@ % =L=H99D$ I_IfLd$HI9w D9D$|{IL9s|LI<$H)HHHH?HHH,ËG Lu% =hIAV  5LxL9wH]L9rHD$ H|$0HI9pHL9rH\$ LH)HsHHI9H HBH1HH\$ H\$0HI9Ht$(HBHDHD$0HHHFHD$(HL$ H9L$8vHL$(H9L$@HL$ H9L$8HL$(H9L$@HD$0HT$PHL$XHt$hH)Hȃl$dH_Hl$HHD$HHL$PH@HHT$XIH@ @HLh @HD$Ld$HhL9L|$HHX E % =!HEH@ !Ht$(HL9rH\$(LH)HsHHI9H HBH1HH\$(H\$0HI9Ht$ HBHDHD$0HHHFHD$ fDIINHAD$ % =tJL-H9A9uEIM9I~M&G % =uHHX I$H@ H9A9tM9vfL9ZMLT$L|$ IH@ qHHX DIAH9DHUHHHHMHPH9rLt$ H\$Hl$ =fDNIċE % =tSH/L9A9uNMII9sBI~I.G % =uHL` E % =uHEH@ L9A9tHl$ H|$0Ht$ HD$8f.HH9wHt$8HL$ HFH)HHH9ιHHBHD$0LL|$ aHL$HD$HAHHD$HhHxHXG % =LL$ LL$ I‹C % =HLT$8LL$ LT$8LL$ L9D9HD$(LDLDLDH|$0HD$@HHH9wHD$@HL$0HH+D$(HHDHD$0HD$hHD$ HD$8HD$(D$d6HC2HH@ bHLP "Ht$xIH$J<&J,!HHHH)H)HHL,L)HHHHEI9ŸHBH]L+#Ld$pH\$HIHt$xJH$H<H,HH)HL,IH)HIHHHEI9ŸHBSLmHC;HEH@ %HHX HD$H\$Hyےff.AWAVAUATUSH H$dH%(H$ 1HHHH= HH@HD$xH$pH$H$H8HHhH\$ G % = gHËE % = HDE1H9ظH$AANAHD$ H9 HD$xEHD$HD$HCLcHD$HD$ L9H\$IZDINjC % =tlHL9OA9Il$IM9I|$I$Il$G % =uHLx C % =uHH@ HD$xH$H9tH=H$ dH+%( H []A\A]A^A_H$pHH$HD$xGfH\$Hl$Ld$(DII݉fDHD$MII9M9LMLHL;L$uHL$(H9L$  HD$MHD$M)ILM9IALHHHRtHpHxHpHxHL9rID$IQML)ȾHHhHI9HBHBI *HL$HL$HDHD$L;d$t9L;l$<@MLT$MM9VLT$ML;d$uDHL$(H9L$ LAAH9\$ oH$HD$1HDŽ$D$dH$H$H$Ht$xH$H$H HCH~+L$dfDHHH+HH)HSHL$dT$dH+HCD$dHD$HHkHCWL$dȃHĐHD$XȃHĘHD$P@HD$HHL$XH\$PHHD$HH<HHD$0HH|$hHHH)H)HHHHD$pHt$8HL$@H9H9H|$ Ht$(HD$(H(HD$ H8G % =UHËE % =%HH9HD$8D$Ld$(H\$ HD$L{L9|$1A@I<$MG % =FLD$WLD$IA@ % = L.L9HI9w!9D$}zI^L9syLI<$H)HHHH?HHL4ËG I.% =IŋU  HL9zML9rHD$ H|$0HI9@HL9rH\$ LH)HsHHI9H HBH1HH\$ H\$0HI9Ht$(HBHDHD$0HHHFHD$(HL$ H9L$8vHL$(H9L$@HL$ H9L$8Ht$(H9t$@HD$0HT$PHL$XHt$hH)Hȃl$dHPHl$HHD$HHL$PH@HHT$X9D$;HK6LHLOKH;D$sRIf.IH@ @HLh @HEH@ pHLh ?IߐHD$HhL9L|$R@HD$@D$Ld$ H\$(HD$HEH@ HHX @Ht$(HL9rH\$(LH)HsHHI9H HBH1HH\$(H\$0HI9Ht$ HBHDHD$0HHHFHD$ fDI<$L@G % =!LD$LD$HA@ % =LH99D$I_Is@Ll$0MRfDvHAE % =t^LVH9O9uFIM9I|$M,$G % =uHHh AE % =uIEH@ Ll$0M9vbM9FMLT$MIH@ HHX IAI9TIUHIHIMHPI9r0Hl$KvIAE % =tcLVL9O9MII9I~M.G % =uHL` AE % =uIEH@ H|$0Ht$ HD$8HH9wHt$8HL$ HFH)HHH9ξHHBHD$0LMHL$HD$HAHHD$LhLl$0MHxLpG % =LL$0@LL$0IAF % =LLT$8LL$0 LT$8LL$0L9йO9HD$ LDLDLD\H|$0HD$@HH9wHD$@HL$0HH+D$(HHDHD$0D$dHHCeHD$hHD$ HD$8HD$(IH@ ^HLP Ht$xHH$H<.L$)HHHH)H)HLL,H)HHHID$I9ŸHBI$L+BHl$pH\$HHHt$xHH$H<L$HH)LL,HH)HHHHID$I9ŸHBqM,$HCSHEH@ #HHX HD$H\$HfDAWAVAUATUSH H$dH%(H$ 1HHHH=hHH`HD$xH$pH$H$H(HL`H\$ E tHE@?AD$ tID$@HL1؅@H$HD$ H9XHD$xIHD$HD$HD$ Ml$Mt$L9HM}IuMuAG  IG@HH@1L;H4$8H4$HH@  HDX E1f.9uMuIL9kL4$H\$Ll$(Mf.H$M$II9P M9LMHT$(LPH9T$ u L;$ LHD$L)HH;A MHM9vvIBHHHHRtHpL@HpL@HL9rIFIRML)HHXHI9HBHL$HI9ֺHBHDHD$L94$L;$$HD$xH$H9tH^H$ dH+%(H []A\A]A^A_H$pHH$HD$xHhF tHF@tHH@LS؅$@MHMfHL$(H9L$  H\$L9d$ JH$HD$E1HDŽ$D$\H$H$H$HL$xH$H$H@HCH~&L$\HHL#HH)HSHL$\T$\H HCD$\HD$@LcHC# L$\ȃHĐHD$PȃHĘHD$H@HD$@HL$PH|$HHH$HH4HHD$(HHt$`HHH)H)HHHHD$hH\$0HL$8H9 H9 Ht$H\$fHD$L HD$H(E fHE@XHH@HH1ɺ;LFHHR@ Hx RH\$HD$0AHl$H$L{L9<$OE1AH}I7G oHG@aHH@Q1ɺ;Ht$ H|$H|$Ht$ HHP  HH HI9D$$cIE@HH@txL1ɺ;L0000t| H=IL$8LHIAvL$8AvAE % =HLL$8L$8MHH$HT:u @H:tH9s1fH0HIH#<)0BH9uфAF E1% =1"L3H fDH>0tL7Hl$LHl$@H|$@H]HEH\$H$1L9Lt$8Hl$Lt$pL9@M7H=1)fH$MI97 Hl$8!Hct$@HHD$HxHL|$M~HL$(ƃ@HHsHL$(I@Hl$Hl$I?qHDHHH!D$(WMH|$LLL$@H說LL$@HD$HH$f.HDŽ$A7}fDIH@H$IvT$ H|$`LcT$ H$LIGHt$@HD$ݫHt$@IGHL|$fIGHD$貫HIGH‹L|$M$IGHD$Ht$@vHt$@IGHEL|$IGt$@HD$FHct$@IGHUL|$H$IGHD$Ht$@ Ht$@IGHܝL|$fH$ӾHHEHD$肗HEHl$p@H$IGHD$Ht$@襪Ht$@IGHtL|$f.$IGHD$Ht$@eHt$@IGH4L|$f.軱HHEHD$ږHEHl$/@$IGHD$Ht$@Ht$@IGH͜L|$H$IGHD$Ht$@ĩHt$@IGHӉL|$fHc$IGHD$Ht$@腩Ht$@IGH蔉L|$Tf.IGHt$@HD$MHt$@IGH\L|$fIGt$@HD$Hct$@IGH-L|$}H$H=i1*f.DfɃ*fDLl$趨HIEHI]E1耛Hl$@H|$@H\$^Lt$8H$Lt$pHl$dDIEMH@H$Iu^@H|$HFHD$MIMMA$H\$8HL+cL`HF*HH+D$HHD$H\$8HXH\$HhC$Hl$E1HȃfHH H*Xf.HȃfHH H*XfHȃfHH H*XML+L$0DD$ LLH$ DD$ Ht$`HH$%DD$ Ht$`LH$DD$ Ht$@LH$lHT$pHt$`AعH$H$JDD$ Ht$`H$HH$DD$ Ht$`HH$HT$pHt$`AعH$DD$ Ht$`HH$DD$ Ht$`LH$DD$ Ht$`H$H`H$DD$ Ht$`LH$4#DD$ Ht$`H$H$DD$ Ht$`HH$DD$ HT$`H$Ht$@DD$ Ht$@H$LH$DD$ Ht$`LH$o/DD$ Ht$`HH$KDD$ Ht$`HH$'$Hl$H\$xHt H$HHZ;*HD*H(HH+HH+D$PH$(dH+%(H8[]A\A]A^A_$B$$HH$HHH9u$)HH$HHL9uHH$fDHHH9uHH$fDHHH9u$HH$HHH9u$P$HH$@HHL9uH$HH$fDHHL9ukHH$fDHHH9uHH$fDHHH9uHH$fDHHH9uH$oHH$fD1HH@2L9uHH$DHHL9ui$P$HH$@HHH9uHH$fDHHH9uH$HH$fDHHL9u%HH$fDHHL9uRH=8*M\$Lt$@H/fo$fo$fo$!H$$H\$fo$HC@;ck s0Hl$MaM1D$ ƒ|$\IM  HL\HLL$8L$8MCL譥HՌH D|$ bHD$8HhMVDl$[I1H$7I98bLH‰HI0ML9AuH$EuHPH$AF L$% =Ivf.H$E1LLH$Hj,AZA[ H$1>HyHD$8|$[tHD$8H HD$@$@ H=*HH+D$He H|$8Lt${InH$IFI~JIHBH 93*LHHt:HT$(H$D@HNLH9uHT$(HM$Hl$MH$L9|$[ HPH$|$ bIT$HL$(M5*DA Hc!AHPHOI9wVfDHI9CDLHLG?AH HwHH)H$HH$LH$MI@HfH*X$$HrH$IL9D$kLD$[vfDHDŽ$ALH$H$MxH$Il$Ht$Ht$ID$HI賊mfDHD$(]HƒfHH H*X5H$E1E1LH$Hjl~AXAYtaL$H$H$HD$0H9!L*8*LH@8A<8HHIDHDH9rH9DH=\ 1EDM=H\$IiMH$HHPH$D(ǖHHL虉HsHD$J,{LHD$Iu HH@@IuHLD$0L@8HM~%I9v L:7*I9vEAHIuI9H)|$ ZHH/HH9w HH9t}uHH)V|$\HD$81HH+$I9HHD$0IH9LD$0QH$H$ML9<MI9LI6*IHMfI9]LH)AH9vL$H=T 1]DH|$jE1H3*HH+D$HH9H3*H8H,*HH98HHl$HI9p)CHHH)H9CHH;]4,Ao<$Aol$H$HL$0Aot$ Aod$0HID$@)$)$H$)$)$cAD$$HL$0D$]!/B$HL$0H= grHL$0I$M%H$t61H|$~!HD$(HL$0H8n$HL$0H1ZHHL$0H$DŽ$oHyHL$0HŋD$AAAD$0%=S?H HcH>H9E  .HHt$`"HL$0,jHL$0HNjE H|$h .H'*H@8.|$Xa;HD$ @ >Lt$`|$8IFHDI|$ZIHuHqILD$`I9^?HU?H,*MHHH~0MLL$`42HLII9wI9Q=|$X=HL)Ã|$ZH\$`u HCHD$`|$8LHHEH+D$H)H9Z@HL$ HHH;B_>DD$HL$`LLH|$hAԺ?L|$`H+\$`-Ll$Ml$8|$XtlD$ubH3<M9s%Ht H+*M9vAEIHuM9`<H-M9v8LLH+t$L)DLHL)H)HA,Dfo$|$]fo$H$fo$A<$fo$ID$@Al$At$ Ad$0:0AD$ D$_|$8Ll$t MHX9H7t$HҬH@ *HHH Ht7U % =+"Ht$`HHL$0TgU HL$0IHD$`E1ہ MtT$0t4H$*Hr8<\$^ E։T$0DAۃ|$8HDHHQHHIHHT$@HHLH+T$|$XtH>=H46HH)H9=H\$ HH;H;W3H9HO|$B1HX1HٻHt<Ld$EI(M9,IAt-@LKM9t>LEuAEItIڃ̀AuӀ|$Xy-LKA/I1M9uLd$M1H@Hك|$X1AIIA IIIH|$8z0HT$@1H)L<iLH+D$H\$ AHHBJLiH Ld$8\$XDd$/@1цfD$xuQA.fAIIr]HH=$DIHNj@ %=uHH@ fD$xtL$0LH|$x`IIsLd$8LH+D$H\$ AHHB~LiH" Dt$\$XLd$Ld$!1ȉD$xuDAIIrTHH!D膩HNj@ %=uHH@ ȉD$xtLH|$x1ɾ蟨IIsH\$ ALH+D$Ld$HLd$HBLiHc Ld$8\$XEDt$6fD1AD$xuVIwA-AIIHH D质HNj@ %=uHH@ D$xtL$0LH|$x̧IH3E  k'"Ht$`HHL$0cHT$`HL$0IƋE E1% ID$0t7Ho *H@89t$^ @EljD$0DA|$8HDHQHH?HHHD$@HHLH+D$|$XtH>9HHHH)H99H|$ HHH;B-Eu HD$`H9HOȃ|$H/LQE1H7Ld$MDT$X)I9w(IAtEAHEL9tTHEuAIЃHAHx' IA AuE6)HEE/IE1L9uMLd$M,LH?LH|$X3E/I|$8",HT$@H)L<1/eH\$ ALH+D$HHBLiH Dt$\$XLd$Ld$"HH@ fD$xu?fAIIHHDH@ u1ْfD$xtLH|$x1ɾILiH Ld$8\$XDd$/HH@ fD$xuLA3)fAIIzHHDfH@ u1FfD$xtL$0LH|$x膤ILiHuDt$\$XLd$Ld$&HH@ ffD$xuCfAIIHHzDԤH@ u1贑ffD$xtLH|$x1ɾILiHLd$8\$XEDt$0HH@ D$xuMIwA'AIIMHHD9H@ u1D$xtL$0LH|$xZILiHIDt$\$XLd$Ld$"f1)D$xuFAIIzHHuD謣HNj@ %=uHH@ D$xtLH|$x1ɾǢILiH\$0Ld$MMIHl$\$\$XAH*fZD$xIuAo&AEIILMG % =舂f/ w- f/vH!*fWMO ZD$xvL$LH|$xաIIwHl$MH\$ ALH+D$Ld$HHBLiHLd$8Dd$H\$\$X41q~HD$xuWIOA%IIIHHDHNj@ %=uHH@ HD$xtL$0LH|$xIAD$$IT$I\$@HYAD$4Il$AIT$Et$0AD#l$E0D AD$$HH|$ L\$(Dl$IDDt$XI߃Eu\AT$$DW LLM,$HL$HDT$H|$H|$DT$ID3W A t+lAD$$HM- IA딃GAD$$HMlDt$XDl$L\$(HT$HAH+T$(HA!HT$D$Hb+AD$$H\$ AHD$XLH+D$HBH$HYHDŽ$HD$8HpLd$Dl$XMIH\$H$EIL$A"%A$II~HHuHmHD$(HH8HHD$(H$fHYHD$8)$HLd$@L$MI\$Xf~1D$D$ۼ$AEfAE+IL$A"fo$A<$IIHHuHD$HzHHD$HD$(H8HHD$(lH(HHVUUUUUUUHH?HHH)L,@LI?+E  W(Ht$`"H%YHL$`IƋE Lt$x #H*H@8#IHHD$HD$`HHHQHHHDH1HHLH+T$H|$XH4tH>/H4HH)H9/HD$ HHH;PW'H$0HLd$0AkDHt$H$H|$xAuHx/HLH躗II)؀|$XLuTLLHIHL$`L)HL$`tVL9IOIEuHt$xHHkLt$xII)؀|$XLt1LLHHL$`IL)HL$`uLd$0LH+D$H\$ AHHB2LiH~Ld$8Dd$XH\$@\$2HH@ HD$xEuNIOAx!IIIAHH.H@ u1HD$xEtL$0LH|$xMIH:D$XAD$$~H|$ L1ID$8$H$W|$X)HCL;|$w*L9|$*AGIHH)HLH+D$H)H9%HL$ HHH;BmHL1IRH\$ ALH+D$HHBLiH|Ld$8Dd$XH\$@\$2HH@ HD$xEuNIOAIIIHHe ВH@ u1HD$xEtL$0LH|$xIHɸHDȀ|$X&LH+t$HHHHH9!I)H\$IL$8LH)HI9LHJ8H9s HB8HR@HuH\$ H$AHHBLiHTLd$8Dd$H\$\$X6D11nHD$xuWIOA?IIIHH D裑HNj@ %=uHH@ HD$xtL$0LH|$x躐IHAHLd$PLt$ Hl$0HHD$0IHDt$L$AD$ I$@(ff/g#AD$  {= f/@  % fTf.v;H,ftk H*f(fT\~ fUfVf(-Z f(^ YfTf.v;H,f5k H*f(fT\! fUf(fVL$5 =j H$0Mff( YfTf.v3H,fH*f(fT\ fUf(fVf(I9@f(f(fIY\,Ȁf/A$y$M)|$XH?I9P!IKt-H\$I7HXH9r'AILL+|$LxHD$IILxL1LL?IHH\$ ALH+D$Ld$PHHB`1ft$H= P1HHL$DHT$XLH DEE@1Lm:fHD$HHHD$HD$(H8HHD$(%=s1LFjL$MIʀHA$u퀤$M)|$XlIHL$K/HHH9r.AILLL+|$Lx蟌HD$IILxK/LLLIKHHD$0IH HD$HHHD$HD$(L HHD$(% =Ht$pL GHt$pIL^HË@ % =1HGHA$Ht81<.;< t<+qAD$IuHHLl$xH)HHH|$pvLd$pHD$8IDC % =HߺLFHHE11LGLJBD@AAE΃0AABuHHIAȀH)HPE$rM^DPЀ 1@HfDHH@HD$xH{VHML$H@AD$HD$pHL$8L,dM)̀|$XH?I9;IKt-HL$I7HHH9r1AILL+|$LL$@LxLL$@IHD$ILxL1LL IsIރAvH= 1y@H|$H$HD$H9HNu511LcHD$xL$0LH|$xtIID$MMLd$8LH+D$ H5 1L\$6GL\$AS LLLL$ۈLL$IIELxHPMH)Hx0AIHt$K /HpH9r8AILLL+|$LL$@LxzLL$@IHD$ILxK /LLLHL$@}L|$@H|$80yssH@(4HD$H-HHD$HD$(H8HHD$(HHD$(HH8HHD$(HD$H HHD$HD$(H8HHD$(sHD$HHHD$HD$(H8HHD$(.MHD$(IH8HHD$(cMHD$(IH8HHD$(hHD$H}HHD$HD$(H8HHD$(3HD$HPHHD$HD$(H8HHD$(UHD$HcHHD$HD$(H8HHD$('MHD$(IH8HHD$(HD$HHHD$HD$(H8HHD$(nHD$HFHHD$HD$(H8HHD$(HD$HHHD$HD$(H8HHD$(M1HD$(IH8HHD$(HD$HYHHD$HD$(H8HHD$(HD$HHHD$HD$(H8HHD$(HD$HOHHD$HD$(H8HHD$(HD$HHHD$HD$(H8HHD$(DHD$HHHD$HD$(H8HHD$(AIEM)LLt$8LxL(IF8Me$LL$0H$IELxH@IDMHD$mI$H@ AL9\$HDl$AD$$Dt$XL\$(HW)L`0I$HpHt$pMd$9H0)LX0WICHLLL$LL$IIELxHPMbHHD$xf0HH@2H9uHsLt$ HL$0L轃HL$0HHD$IHXIH)Hx0H)Hx0 Hr)Hx0Hb)Hx0HR)Hx0qHB)Hx01H2)Hx0mH")Hx0H)Hx0H)Hx0H)Hx0ZH)Hx0FH)Hx0H)Hx0}H)Hx0H)Hx0uH)Hx0H)Hx0Hr)Hx0Hb)Hx0HR)Hx0MH\$Ld$LH+D$MLd$@LH+D$kL$0H|$8LKI*L$0H|$8L,I-A-F1oHHt$ Lt$LiH$HLp|$XIFLDHLd$8IH\$0\$@1^|$XIM9rLAI$LIu H+D$HBHL)H90I$HHRH9HD$LtL11LCsIIHH:ӁHNj@ %=UH|$XLH XH|$01L1rH+D$0IHII9wGAJ4(I $LHH+T$H)HQH9gI$HLpL9 Lt$H|$0L1L|I4H)LH+t$HE|$ AU HD$ HH@ID$8EHULuHRHT$`H|$LHL$dHL$1HHELmH@HD$`+HUH}HRH|$hHT$` =Lt$`|$XL |$8 IH9X HLH+D$L)H9FH\$ LHH;B& HT$`Ht$hLLsL|$`H+\$`1|$ALH@I>HG)8'H)8H|$ E11ɺt1pvHHD$HGHHD$HD$(H8HHD$(A AAE H=t) Hc4!HIUI9w @HI9y DHHLF?A0H HwHH L)HHT$pHz Iըl=@AH=) Hc4!HINH9r- DHH9 DHHLF?A0H HwH L)HHHT$pH I։H=vA HD$pAIHHHAHB A LH|$x1ɾ@l$x1|I/LH|$x1ɾDl$xE1|I\LLL$y|LL$IHD$I$HPLx?HL)Hx0aHD$pAE_LLL$&|LL$IHD$I$LpLxHHI{HHD$IHHInH$dH+%(HD$(H[]A\A]A^A_HHL$xDHHL9usHHL$xfHHL9uAGD$yAHD$8HH$0HH@2H9uH|$HHD$x0HH@2H9uH|$@HHD$x0HH@2H9uHHL$xHHL9uAGD$yA1HHD$x0HH@2H9uCH|$HHD$x0HH@2H9uHHL$xHHL9uH|$@HHD$x@0HH@2H9uHHL$xHHL9uSH|$@HHD$x@0HH@2H9ubHD$8HH$0HH@2H9uH|$HHD$x0HH@2H9uI1H= 1iHD$10HUHLsIރ`LTZHHCLHIHID\$_HL$PxD\$_HHD$IHHIHL$PAH Ld$LP1E M9IAt*LKM9tLff.AWAVAUATUSHHH)H-x)dH%(HD$8H)L8HHHH HcH)HL0HEHPHF)II~HL$ЋG % =Ht$(""LT$(IM11LLT$"BHT$LLAd$ INMG5AD$ um@HS)HH)LcHHHEHHT$8dH+%(-HH[]A\A]A^A_@HLoLPLT$(U% =PHt$01L "LD$0HMLHIHIHIH4H L ЃHH)H9Hu@IAA?yI9sNL5)L1fH9v:LHA<>HwHuqL)HtsII9rL9t,dfHLD$HL$7HL$LD$HH#AD$ yI9rIL9tA?yP@H~J41ҹL{NI$IL$L@LD$0LHHIIWH9qHI#tHҍBHIA? 1LHL$LD$Ht$-4HL$LD$Ht$HHPXH=Ћ 1HH5b)TDAWIHAVAUATUSH(H)H-R)H)L%T)HDmL3M<$H@HP(B@,HLHMH@HBLHBHHH)HH)HH2)M<$L=)IH8G % =ZQIH)HID9mL3H(D[]A\A]A^A_Hx HrH9t#H)HLHpHHzHx?HL$LD$HT$GHT$LD$HL$H2HFH2HBHF HfHL` M@H|$HHT$Ht$)+HT$HL$LD$B % B DD+AWAVAUATUSH H|$pdH%(H$ 1HIH HH=p ILMHD$hH$`HD$xLL|$pE1IwI?LH\$IAI9 HD$hMEHD$H$HD$I]ImH9v4IDHkHI9vH{H3HkcID9tEL$$H,$MH\$LH$LHI9L9@LILPL;$uH|$H9|$MHD$I)MM$EHMr? H H5HD1H*LI@H8Ht+:(LDHLT$nDLT$L1HH@H8Dff.AVAUATUH-^*SH}L'MAL$ L- *IE@"u/H/*HHcB(H4@HHrH@ÀH}L'HAD$ H'*H}L#tIT$B H\*HH)HMLgHGHE4HEHHHEH[]A\A]A^DHy*HL ZDЃ m[]A\A]A^@ nH@ID$@HH@H*LIHpKIHtKIE@"@HEHXLHt8C@urIUHEB"@t_HHEIE[]A\HA]A^LAL$ fDH+:H}fz,XHHAHPH*HHW@uFHHXHHHmE1}LI'IHEHPL@HUI9|7HJHcHff.AWAVAUATUSH8dH%(HD$(Hi*HHcB H @H HBH,]6L}8@H*Hx#HH@|$H $H HAE1I)LUPLmHMLUPI7MNAEIEN D$t ME 4M AA =1%AAAA I?MHtwAwIIL94$9r9L]PLmHHD$ AC  LHt$ "L\$L\$IAC t1H*H@8u  LLT$NFLT$HD$ AE FIEHL$ H9H3MMHI#CHLLLT$*5LT$I}LI@y1LIIL94$DH*HHH H9JH *HHrH1H *HJHfDPLUPMLUPIL;UHH *HN D$t ME1E I?L9L<4I?G@ >DHUHH9UPMMHI#AHAA Ɓ IQAA HH9HEHvLϾ#ICL7PAEUIEL;PMiHh*HHHH H?*H0HPH *HHHH9PaHT$(dH+%(H8[]A\A]A^A_fDL;Un@IMSHRHT$ HLHT$HT$HH9HHEPZD1LT$L\$R6LT$H*L\$H@8HE8LxMH*I?HIHw3fDL}8HLL$HT$N=LL$HT$IAqAqLL\$LT$!L\$LT$IAsAs>M1LLJIfIH=R1kGLLT$kDLT$HI9AEU1LLLT$.5LT$HI:L2DH*LHhHI?Htw7wLLL$IALT$L\$f.LM|$H1IHL$0HLO$"Ll$8Ll$0Lt$MLT$@L\$HYI{ H@HD$(M$HuH@H@ L9hLAjLLL$ HT$EHPAYAZHHH;D$ |$SAEIH@|$SLHL)t'M9tLLHL$`HT$(t&HL$`HT$(IHT$xH1Ht$@LHL$(:HL$(Lt$xHD$0@\$SރHAEI)I,\$SM9}]H^M~LLHL\$%L\$MA$LIL)HPH*HH*HD$(H&*H)IM)M~"LLLL\$LT${%L\$LT$LLL\$LT$HT$xLT$L\$HH*H|LLl$8Lt$L\$HL9t,IL+l$(HLI+FL\$LHBIU$L\$HC*HA# %WHuHWH)%I~AF H|$(E11ɺt1;L\$LLL\$8L\$Ld$xc(^LHL\$8H*L\$Hf.AVAUATUH-*SHEL AD$ BLH+x*HHNAD$ uCtID$@HH@1LJf.HEI$HHHRHHlID$80fHmFH *L%U*HI $HcBHc2xHzHH;tHHmL%*HŹ*HL-*HA*IMH9_HHcI$HH9E7r3H=۷*VHHcI$H,ЋE ufH*%E HHBH8HtwwHBEH(Hķ*[]HA\A]A^H@0@cZfDH[HHHcI$H,ЋE IEoDHEL% *H*HmfDI$Hx oL LH+.*HH@L;%*9fL-*IEDp"Au/H*HHcB(H @HHJHDpAHHPHHqpHHP+pHI$Hc@HAHEIUAt:[H]A\A]A^fD;HH@uHE|HcB# tWH 0*HHHHE !*HpHuHHz,AA<HcIUHHEj@H ٲ*HzH HK ρu'H=*?tHsK HHHXHMH5HEIUL%*H*f.AWAVAUATUSH8H*Ht$HX*L\L92H4*H-*HD$(HHH*H|$(H}H98`L5*L|$Ll$(IMMMHHLIfHLeAD$ A9T$(IM&AD$ >I0IHH9wL9#%AD$ IuHD$HL$(LMIHHD$IH H9vofDH)HH 2*Ht$H1H90HHEH|Htwg wH9~H8[]A\A]A^A_fDHH9w)HB u HB HCHHSH9vIHEbfAD$ 0I<LL$ LD$L$aL$LD$LL$ IIIHIH3H4HSL+AD$ <e ,IuIuID$Ht@IEAu HM.I}?I)AD$ <6H*L(M IUHH*HIEIEfD+IHE5* AD$IHAD$ IHIHsH4LcI+fDIE"IEAD$AEHAM I+AD$ OLLLL$ LD$L$LD$LL$H}*LL$ I8H986H*IefHI#T$IHfDIt$% IufDLH+*HHL;%*~fH*H-*HHEHL9L5W*IHI>L$LD$(L$LD$LL$ LD$L$ LL$ LD$L$ILLL$ LD$L$!LL$ LD$L$I(LL$ LD$L$I)ILD$(LGHҶ*HL)H~%H*H*I@HHIPILLǺL$H*L$LfDAVAUATUHSH@uHH#GHu G@;LbII9IMIH*HHQHHH<*HL-*HH HCIEXH'HIUXHHHH@HH@HH@HH@ C HC% @C HI9N$L#1HHHx HIFH{HBLC % C HM*HHu[u]A\A]A^@HBHHGHJ H9tH)HOHHBE [% E ]A\A]A^{H( W[H]A\A]A^xATUH-*SHUHcB H @H HBHH*HKSHH<ȀHZ*H8Hx*{;8 L%*HC@Hڲ*HHtH@H{HSPI$HP`HCHwYwHES8P(HR*HcK,LC0HH H*H K(H/* HKHB*H HKHܯ*H HK H*h LH []A\H1H*{;8 H*HSXHH@Hx(HP(HCXHtwwL%*I$H8H@H#GHt1HH@HHGHJ H9H)HOHHBDE1[]LA\D[fDKifDH@\tH5g1H11H5gHH1fAWAVAUATUSH8L*dH%(HD$(1IH8H|$H3W % =.LwAF < H*D(IHx0P\Ѓ` H-k*HE@#@IL%*HI$IIA\uoHJH5ܲ*I $HcHHIH9r%G M98IIHtG tؾ L*IHNj@ @Lc"%HY*HZ*HHD,&HELĨ*X#@"d!%=HE@"@H*IcHHIII)IH9u4It&H{HHtGt HIuH*H;rHEI@"HR0u/H*HHcA(H4@HHqH@LҀLϧ* HEH=HEH*@"L:u%IcG(KH @MOHI@AG A;G$\AG HH4@H4IGLHH@LhM"C L%D$2KML8*E1,HCJHIIHJHBIM9|$t1LH L*HHts tSHt$ ^H|$Ht$ IHr*H@#W Lρ Lr*IHHpHt$ LOH=*H5wX1SLHL1*HdHLh H=kXL*H@LpMLbL˞*LpHD$AF H H HH H==\HF1fUHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$111HH$HPH4*D$0HH$HD$HD$ HD$5DATIUSG }ua<w UwP 0MAT$ Ѐ@AD$ r OL[]A\I$HztI|$I$HBI$H@ xH8*HHLHHHן*HH-*HH HCHE`HHHU`HHHH@HH@HH@S %_C  C HH@HCI\$fLfDHa*HHHHH*HH-*HH HCHEXHkHHUXHHHH@HH@HH@HH@ C HC% @C I\$@H*HHHH HP*HHH@ID$AD$ u [L]A\fLAD$ \@L AD$ |fDH8C Y |H H"fD( ,|WHuHWH)%I|$AD$ AUATUSHH*H-*HH*H}HHSL$H*M,$HH)H~uHGLoHEC" ts#@x0u-HH[]A\A]@@uLs#@HE@H8IHELHH[]A\A]HcH}uf.AWAAVAUATUSH(H1*L-*HL0HhIED`#@" u E1AE < t5Lޔ*MxHHPHLxIEHH([]A\A]A^A_fDED$DDT$LH@AD$1E1jE!1jA Y^HDT$*LxEtQMhLI*IPI9TE3IE@#0HL_I5MEAG LDE1҅IEAD`#@PHDT$ DT$HtiH@ HeH@HL8MH5 LDT$DT$HH5R LDT$HDT$E111jHALj_AXHDT$D$Pf.|$ FIH*HHyH8Hȗ*H;8GHP*HL@IULLD$HD$r" HD$LD$H=*L1@AW1E1AVAUATL%(SUSHH*L-\*HHX0H+I]HH $IcL>@LCLsI@H8H0L HNjG I< t?%=u v H5j Z?HHGLp MfDH0H HHGHsHI]@@Vj1E11jLAHt$3A^ZHH4$iHxH*HH9QHHHfLCLsI@H8HL{HNjG {I< t?%=u v H59 2>HHGLp(MfDH0H wfHHHKH@@HκLH $H $Ht H8HH=*H1H0H{HSHGLM.HAP ^ I]L HXH0ujH{HSHGH0HH f.MH֑*H;EzLH*HHH[]A\A]A^A_11fH{HHGLp Mg H@Lp PHA*HSHHL4H0H :f.H*HSHHH46DH*HSHHHQLpAF '@IHB&LpAF HHAR I@ HH$$L$nADE11@D$|$ L$4:L$HHƒ*HHyH8H*H;8@Hu*L$HHHLK @HyE11ɺyHHHG uL$uABHLP@HIH@8A_D11@D$z,3j1LADjE11LH*Y^HHaHL uHH*LP0HՅ*HgjAE11j1LK[]HtL*H2빀|$TABIH@MI9LL#Iz,LLL$H *L$H@@Dj#D@AĈL$EA!L$H щ*L$H@@Dj#D@ÈL$!L׺L覺HNILL$L$HLHxIABL׾PL$L$HtfH@ HMH@HHHH5R HL$bL$HH5 HAL$HLLL$L$ABL׾PL$L$HtfH@ H~H@HL MH5 LL$L$HH5` LL$HjAE11j1LLLT$AYAZHL$AbABt7I HQ Ht+y<tH:tP tHPz EtQH*LHSLHH"LSL$HHL$OL$LLH$gL$t-L׹HLM$qH=G*L1MLLIMLHL$iH=**L1LHL$H *HH$Hr"hH$jff.@AWAVAUATUSH(H*HL"AD$ % =TL?HHL-:*LzAIEDp#@" u E1AlD@D$AD$ AG < ED$|$HLDL$D!DL$HEAD$ Ɓ<HH9HL"M|EIEp#0HHPHL`IEHH([]A\A]A^A_fDHL AGtAD$ tLI$Hh |$AGuVIH@HH9HLI`f.E1ɅIEADp#x@LH@H*L`AGHD% =LHT$HT$H,HL(HIH*L` ID$@tHH@L 1DL$H5@DL$D% =pLHT$HT$HHH= 1u9HLDL$qDL$D$IHHHF@PLDL$VDL$HtH@ HH@HH8HH5 DL$H|$!DL$HH|$H5 DL$H>f.L@I@|$tQHLHT$HT$L"I$@(f.I$Hh HLHT$HT$L"LHDL$H=*H1USHHπ*HH(E t HUz tIHQ7HHx uH@H@HHH^*HHH[]fHH>*HHH[]fAWAVAUATUSHH*HL`(L6x Hu+j11E1jE1LHZYHt LhA} tdHLTx HuH@HhL%*H*I<$HH)HHGHoI$HHH[]A\A]A^A_ÐIELpMtDxEt.HEHP@HH*BA9`IELpL%E*H*I<$HH)H~5HGLwI$HHxHI<$HHI<$HHgAWAVAUATUSHH-*HEL`(H*HLLh(95IEH@@H(Hx0Ht'j11E1jE1LZYHt HX{ thLLx HuH@HXL%0~*H*I<$HH)HHGH_I$HEHH[]A\A]A^A_@HCLpMtDxEt*IEHP@Ht}Hf*BA9`HCLpL%}*Hj*I<$HH)H~SHGLwI$HEHxHkI<$LfLXLHHsH3I<$ff.fAW1AVAUATUSHH}*HHx0L`(LH3Hj11E1jE1LHHZYHt LhA} tvHLx HuH@HhL%|*HO*I<$HH)HHGHoI$HHH[]A\A]A^A_HHh0IELpMyDxEt*HEHP@HtyH*BA9NIELpL%{*H*I<$HH)H~OHGLwI$HHfHI<$6f.HHwHI<$ff.fAW1AVAUATUSHH-|*HHx0L`(LH1HQHEH@@H0Hx0Ht(j11E1jE1LZYHt LhA} tgHLOx HuH@HhL%z*H*I<$HH)HHGHoI$HHH[]A\A]A^A_@IELpMtDxEt.HEHP@HH*BA9]IELpL%=z*H*I<$HH)H~gHGLwI$HHuHI<$Mf.HHHh0@HH_HI<$f.L*IHHGAI~zfHIH?APQq@0@ HcAPQq@<@ HcAPQ?APIM~G11ItIHcH?AP0 HcAPA0PAP H@q@<@f.HH9HG8A1)tma#uLH9wuDHH9tg8 uH9v]HIH9sQAHHuA8uLH(uHIf[t]uHt"HIfDH=.71H=71AWAVAUATUSH(G H|$ HLILJLMM9r@HI9 ;yI9LIL $M)H)IDDHHD$LLHIAF4MxHcH|L $ILfHH8HcP4LI H@@HuAF4IQL݃HIIH9s@L)HLHEHEH9rI9lH;]uf.HLeH9]t311LL\$HL $L $L\$II9uA$L9Muf.HLeL9MtIcF4ITH9tIcF4IL)IF8Mv@MuLHD$P uA!mDDl$Lt$A H9H0H $<*<[ AF0IF(EHA%D=DmHH9r@HDEn IHH[]A\A]A^A_DL=88ALT$ Ή $ $T$ HAE D%=D$D %=Dt1HD$DLn8H5<2*@$H8LE1葺HH9TDuEDA<L=7BfDL=z7+II9L1f.H=37 $ $HAEljD$#HH9wfHH9{} uH9W_AE*<1wH>H2InH)Hމ $A~4c $IFHhIAF$H 7H57HDH=016fDLt$Dl$HE AF0HIF(AV$I$*KL6H56$*ЃLAF$IE1qH9rH1`HH9Z} uH9sLm:pHHgfffffffHc;0HHHH PH.HHHH?HH)H9HEH0H vIv(AF0H9/Av$AF$HEH9vDU*1w8H>Hr(@Hp5H55HDH=/1@HHAF0HvAF0L}]HLuHHHH0H wHHgfffffff0Hc?D0HHHLPMLHLH?HH)H9LEH0H vIv(}]\HMMNM>I~@MFIFIvIV LT$0E^4In8H<$LLL$(LD$ Ht$HT$D\$ HL$8JLT$0LL$(In8LD$ Ht$IF(HT$D\$ MH<$MNMFHl$8IvIV AF0E^4I~@AHH=-1 Lt$H3HG4H=-AF$HD1ELt$H3LH 4DH=,AF$HD1ELt$HW3H3DH=,AF$HD1{AF$H*3H53HDH=21VAF$H3H53HDH=+11AWAVAUIATE1UH-3SH?HHfDLt;A}09AE Mu(Hc4?t0@LIIEuHHL[]A\A]A^A_xs$%SHcTH>MpILH?LHIOIFIIIHI0XMt LHIIM9xM)IIUM}LM]MUIu8IM@IUMM ME0M}L\$8LT$0Ht$(HL$ LL$LD$HT$wL\$8LT$0M}IHT$LL$Mu(LD$Ht$(M]HL$ MUIUIMM ME0Iu8IM@L@~0xufM5LHIH$MI)M.t@u.AE$HR1H 0H=)+HD1fDAE$H$1H 0H=50HD1AE$Hg0H50HDH=*1AE$HB0H50HDH=/1nff.AVAUATUSH L'dH%(HD$1I9uI,IA$<EA H=m* H!HIL$L9rfDHI9HHH?H HwHL)HHL$HH1@տ*H5)SMeHL$IMeHT$dH+%(~H []A\A]A^HD$A$HL$HT$E1LHLj蚷ZYHL$u HtMeH\$HL+@H=)1MeWff.@AWIAVEAUIATIUSHHHH/,DD$ dH%(HD$81E<EAA AA4MELE1EAIH9EH5k*D Hc!HkH}H9wHH9DHHLF ?AH HwHH)HH|$(HurHH)H~MH5o* HH9HLAH=vAAt@AEIItBH9 11fHD$(EHfAEIIufMEA,M'<EA L9I9L-0o*HL$(A$cH5HwH'L)HBHD$(A$ADIL9v L9jH9HGAI/HT$8dH+%(HH[]A\A]A^A_fDLT$HL$(E1HHT$0HHjDD$ 0YA^DD$LT$uhHD$(1HD$ H5+H *%HE΃H5%1=fDHD$(HD$0H|$(MHT$0HE1HjLDD$(HL$ xXZDD$HL$Lf.AWIAVAUATUSH8Hl*H|$H$HT$0LD$xdH%(H$(H&c*H$HD$(HD$8HHD$H+HHD$PG$ÃD$j\$l1ۈD$[HIH)HG8H|$tD$k='HD$l$lX \$ t*H=l*HD$H+H|$PHHWH9u /&HD$@0D$\$HD$LH(Dl$kM\$ H55H$H|$ Hc t)LHH)?HHI9LOMDd$ CA=S':H*HcH>H$Hl$MiHD$pML|$`\$ IDDd$[f*X$$IreE#H$P&f$HH$nu ff$MI@HD$(IsLL|$`CHl$MiH$M)L|$`IDDd$[fDfH*X$$IrE%H$%$HH$|$ Nu ȉ$MI@HD$(H$Mj-LH)L9IO|$[2|$ ZH3|$ A)|$[Ld/f+HD$@$@W+I9]9H|(Hxh* uzID$H9V8IA$ttM97ȄyMHM)Hc6H5ci* L97<7<8<7HL9,8A$L&i*AII91LH)HD$8)H$Hl$MiHD$pM9L|$`\$ IDDd$[ff*X$$IE!H$%f$HH$$nu ff$MI@HHD$(Hl$MiH$ML|$`IDDd$[ @f*X$$IEH$8%$HH$|$ N$u ȉ$MI@HHD$(H$MI)IM9MÑ|$\MEM?&|$['H$I'Hl$(Dl$ 2@DLHIHZ*HHI3L9$rHl$(Hl$UHD$Ht$0Hp8|$[H$tD$ G0LH)L90LH$Hl$fMDd$ H=#D蝪HI@DH=#vHHl$H|$(NHD$8H*d*HH+D$HH|$8H\$HkHCH\$C$OH=e*HH+HH+D$PH H5{04L9|$ 5H}HEHD$G % =wIM4HD$E1E1@ D$ J|$[H$#|$\.I1M-L)FIH$c*HH+D$Ht2H\$LްHCHkaHl$MiH$MGL|$`IH\$["DfH*X$$ILH$AM $HH$MI@HL$(ML+$MM9MN̓|$\MEE1Mu)MIEHH DL`HD$8|$ h&11H$MHLMMMIMH9T$ HLMuH=Z`*IAVHI9@uʀ|$[H$uHPH$H$Hl$MiHD$`ML|$@\$[I@f*X$$IrZ H$Af$HH$$M@I@HHt$(IsLL|$@Hl$MiH$ML|$`IH\$[ff*X$$I8H$A=$HH$Hc$MI@Ht$(MɸH$LDȀ|$[%HH+D$0HIHHI)р|$[B$H$LH)L9j$LHl$H$\$[IiAMMf.L$M9,-A7<EA @H=}\*@D H!@H)IWL9r fDHI9 D HHLF ?AH HwH L)HH$H(H$~|$ C„EM`I@Ff*X$$HHl$M|$[H$"IH9L$0s7Mx0fH9L$0EAHHHHT$dH+%(YH([]A\A]A^A_GuЍJ Ht$ H誎Ht$INjC % LAĀZH_HH+Ht$H@#HDL$HHD&HHzHEHC @HCH=Hx2 HHϜIIHcIELDFHL{HrHt$ HH=61H訏C LD耟Ht$HH@ Ht$ HGHHPHHT$FHH\$IIHcIELDfHxHyHX@E t HD+H9Et'HH=1FHH=15pH=) zHDAWAVAUATIUHSHH8dH%(HD$(1H9AH9A G I9L911HS HI+H@8 trE  3Ht$ HL$ŋL$INjE A E1|@E1E1 {Ht$ HtHT$ HƋC nHH+H@8ZLRAD$ 1 AD$ E6D8tEKE11H覼E % =Ht$ HIHT$1LL AD$@0HD$(dH+%(:H8[]A\A]A^A_DV % =Ht$ HqU Ht$Hǁ E-Hŋ@ % =o"Ht$H%INjC  HHsHRHT$ LAD$ %@11LdHT$f.H1G+HDp8AA>DHG+E1HDp8AAJf)F3H&&%=$11LħAT$ f.HEL}HPHT$1f.Ht$LHfDHH}HpHt$eHEL}H@HD$C HUL}HRHT$fL訰߉S -ff.fff.ATH[I+UH-cB+SHA+HHUH;Lb(H)H~HGLgH[H]A\f.HCHUH;f.SHA+HUE+HHHXC+HD+HHcB H @HHJHHPHdJ+HHH@+HHE+HH+HH9HD+u"H[H+HD+tH>+H[Hff.fATL%;A+USI$x#Hx(xsHGHHtOH-@@+HH+H}HH)H~HGH_HEI$[]HA\fHH}D1聲H@H;HfDH@+HHff.HHA+HHHH8A+H;t3H?+H H+HH+HHB@+HHHƐATL%C?+UH-@+SHEHPH=+HHI$H0HеC@uI$HHE[]HA\H踭fDATHF+UH-?+SH>+HHUH;Lb(H)H~HGLgH[H]A\f.H胥HUH;f.AVHK<+AUL-2?+ATUSIEHHH>+HH@#HuQE u]L9tLHE@IEH+[]HA\A]A^fۺL5@+A>tAD$ usADH@H#UHut\ mH5# 1Uf.H(]L診t Ѓ w AVAUATL%=+USH=+I$HHHHp#L*H:+IHH+A>u?L9tLH芡E@u4I$H+[]HA\A]A^HGH,Hu룐AE uAH(fDL訹tH=;@+A1@AWAVAUATUSHH<+L-<+HIUH(L`B#@tL HHhHLIL5*>+A>IEU x#'U 9EvwL9tLH蒠E@IUB"u)H>+HHcA(xyH4@HHqH@<udH+HH[]A\A]A^A_@u%=tJ 谺aH5 1腟Iy,uHHPHHhIUfDƒ wAD$ AM|$сEw A Av>@"u-Hx=+HHcB(HzH @HH@<H ؐHHH(ANAG %IWHtBIWHE1Hx(腧ID$AwAw跜fH舨҃ #LIGLpAFAwv|AwMt$z, HP ʀ MgtFΈL`P MtAD$HHPHHhIEHL覟L蜟 HǾHD$uHD$P ff.USHH<+H8+HH(E HH+\4+HH E u9tHE@HH@1H蓅1HHUHHt`HRHHtMHE80H+tH8+HH@0H[]H+H8+HHH[]HH+fHEHx fH5+fHHHH+V3+HH@H;-A3+aH`USHHO;+Hf9+H$:+HHcB H @H HBHHv@+HSHHH6+HH;+H>+HH9+H-7+HEx"xH5+{;:|HH[]f+fHEHH[]DH4+Ef.ATUH-R6+SH"7+HEHHxIB"@uH 4+HrH L$H0G F  u4J#L%HEHPHUL`H[]A\Hf.FuHEHH0Hxff.fAWAVAUATUSHxH5+dH%(H$hHT6+LHLP0P#I ׃@H $@|$@"@CHHIHL$0@HMuHIMaIDMHHH0+HHtYHHA(f.B(H+ztH0HHH HPH`$+[HHExHHHr H9q uHL+fnHtH5+)u%HHxH0W N AA Uf.H#+[HHÐH"+UHH(E %o=u7HHUHB H9t HHB E@u H#+]HHHE@tHbHc#+]HHHu"+UHH(E %o=u7HHUHB H9t HHB E@u H #+]HHHПE@tHH"+]HHUSHH&+H!+HH(E HH++HHE t:u]tHE@tfHH@tZ1HnuLHI"+HB f%f=tHHB0H[]DHEHtH@HwHtHE80tH"+HHH[]H+fHEHx uHiHH++HH*@H;-+tZfH+fAVAUL- +ATL%!+USI$IU@ H*Af%fAf=ubH$+HH}|E < t^ t^ftH +IEHI$H[]A\A]A^ÐHtH}uH+H0HI$HDHEHx0uDfu!fAt)I$H@0[]A\A]A^H+HP0xI$ImH@0АH+!fHXhE 5AWAVAUATUSHL-g+L58 +IEIHhHB"@uHJH)+HHL M AT$  w AuIDx"AAAu EE u At$ HU%HJ =zHqH1g!HuLN I4$Hv LIH>I>HIL ǃ+S LΉсHoIEbfH0tkI$H(EupC H +:"C HH(IEHPIUHXIHH[]A\A]A^A_fD1Lf(EtE 3HE@(C XfH+:V"C H@(IEtAt$ 1I$H@ t HyH1@8H9H)HH +S  @HH9 H؁d\HCIES @YHu~ P PF(I4$f(V(fTf/vDց@@t HdHHIE(f(HaIE 1H膓E tVAt$ @HxMfH*fWS%H"S @(IEAT$ NHƃfHH H*XHff.AVAUATUH-+SHEP ffHx(HWLj(M@X"Hp# IAE~@xyIEH9p|oIEL4Mu""LǂHL0H+HB!+H;HH)HHGLwHHE[]HA\A]A^DLmHtHL0uAEtAF tLafH+HHHL,fuH+LpAEN@H=+A1efDHH;; &H@Lh(HEDHa+LpH+AVAUL-Z+ATUH-(+SHHHH HcH!+IMHHHELsHsHPH+HL$LLgHEMuLc[H]A\A]A^ff.@AWAVAUATUSHH+H5@!+L%+HHHH Hc(I$HHHB"@LpHHMtAV ƒ |L H`+ H;+LpH +I$H(B"H+<uHH[]A\A]A^A_ÐH+HH)HHELuHDIFHLxMAGILh(MKH+H+LqHH H@HH@ I9w)fI>L8INH9 hI$@ f%f=*H+H8Ht G FIL5+fH+HL2rfDrH@8HeP H $ QH@HDLxM7AG,qLÈH $HIH=+Hr+HL3HH9HiI$H+I)AI@ Hf%f= DEHHEL[HL]1A\A]A^A_^XfDH+LH $HH@H8+7tCH $H9 jIBfI9vVfDIL93CI>L6uL93+Hl+Lp,I<L0 Ll)DHH0{H+I$@H5e LLHxLcfDL06HqLH $H $HI/Hk+HL)HLiLL)HHHH=HyHPLLT$H $I~H $L3LT$HAHLH=1DD$L$2{DD$L$HHLLL$yHo+L3L$HHI訽ATH+USH+HH HQH<A#L'Q" A#u-H+HHcB(H4@HHrHPClAD$>I$L`IH-#+H+H}HH)HYHMB# sH5 +tH Q"F>u)H+HHcB(x-HzH @HHPu!H=Z1賌z,tf.H-i+H*+H}HH)HHGLgHEHH[]A\H +HpHHEHHHpHM[H]A\D[L]A\ @L0LcI@z,[H]A\fD@#軍H HwfDHwH}3fLHHEHxHPHUfHHDAUATUSHH-+H+HEHHH@#HRH|$i@I."IEHfDLDH5>fIHZDI.LPHIEP"^H蟊zL {H@Hx(PL {H@Hx fDAWAVAUATUSHxH+H +H8Ha+HHH<$HpH2Hc0L$HpH2Hc@It$H9Ht$H5 +HDH  +I9HD$H6 fL$6H +f) {HD$LhM9L@HI9HA tH$N#H+\$H HHk +Lt$1E1AHD$MEfIIsI1MYHF @DE t ~t!HH+=+HHH;5+ ALMىF M}AG EHt IM9SH$+MH0EQHT$L9CIFIHt` L9rF"D$0*DHl$H\$L=I9H;$<L+HD$M Eu AA  MI)IMwAHN+H +HD$ HHD$(HI<H99sL+HL$ LAEHIHHt$(L,HHD$@HHD$8HH HH5+HHH@IH4HH9uHD$ HHt$ HD$(LuHM9L|$8H\$8LI*OW HIJ<8IM99I>W O9w tZIHf.HD$H<$HHt A@HH9sN#`t4 H|$HHxx fDH9+HD$F"D$0H+HHcB(HZH @HH@D$0DHD$H+ H+t$6|$0f0HD$|$0HxHT+H83H+HHHx[]A\A]A^A_ADA9UAtMuA~u H;$ HuLhAE@n|$0 HHI9DE/M]Hg+H0M}LAG Ɓt$0Ht$%LDD$8AG LL$(L$ fDD$8LL$(IEL$ D$0A G EqMKHvHl$L,$Lt$H9$sX7tLH+*HHvL;% +tLXpAD$@|$0HI9L#AMtHAD$ < tI uu I$1HzLzt LnHI9tLJfDLcHAD$ uI$Hx|LuUHf+dAD$@XLpK@H+HH(H+HzƁt$0Ht$=CLH=O1|LeHLMDLHL$@IH\$8H)HHHDHD$8HD$8H+D$(|$0HD$HH+H@#HD$ H|$(H8H+H98 LIH)HII9rVLl$@ILLt$ H\$PLI?G IHGHIHMOHL$(H5`*JILHHIH4HH9uHD$ HHL$ HD$8|$@HN4Hl$HI)L9H\$PHL.f.wO HEHHI|I9r4H;O w9w tQHHDL+d$HH\$PIIOL'AEu IEHxxLLT$PLL$HOLT$PLL$HLH+D$8|$@HD$HAE %H=@IEHL$(H;HyIHL$(HHL9t$8Ld$HI2LL$@HT$XI}LT$(IHL{HD$ LL$@LT$(HL9HL$ H+D$8HHH*AuHHl$AufDHt$(LLT$ ]H|$8LT$ HD$HH\$@E1ML$H*LHD$8HHD$ II.LLHLeL`Ht HD$ HEAD$@uGIGHL9|$(uH\$@MHL$8IHQHL$HHT DLiLpifDOIH#PI>Hq*HH98xsHA*HHHt$H+t$HHHʋS сHL$9uHsS H *H5*HHJHZHnmwUADA^AH5*tGt H+2t H+8OmUAH*0t> t H[*2t HQ*8b8DA]AH*tD9E9@@EшLkD$@HLm7H+AFHHQHH*H;|HZ*HL4H_Ht$(HH HPLMELT$PLL$@NIELT$PLL$@QHD$@|LHE*HJH}HD$ H|$(H8H8*H98IMI9I>IMIFHMM9sMqqHD$ HHD$(HrM4$Mt1 Xwt#HML96H5 1!\H*MwHID$Ld$pHD$ HHD$HHI9HD$HH\$hMHHl$XD$@L4Hl$`Ld$PTjAE11U1LLsAXAYHtqH*IHJ0E@HIH9\$P2L#HkjAjE111LL:sAZA[HuHD$XL HHD$XkD$@E1|$0L9Ll$HMH\$PDMMDIUIH@JDI9r\LuAF u2 IFx tLYHEH@L>AF L\MH\$PLl$HMCL\Hl$AE@Ld Ld$PHl$`MHL$XH\$hLH)HHDH9HIH9MH@HHEI9jLE1E1jHu11q^_HuH*HHc'HH9<$ A@Du w A WtL 10YEu Ht$8HH)HH=uII HHD$HH4H|_HD$ HL(cH4*HD$8j LT$@CmLT$@9HL)L9wI HJ4J|!_HD$ H6H*AH@" WE1@#JLT$PE1LL$H~VLT$PLL$HA#HtHr*H~LT$@lLT$@GAF IF@ HHFH$HT$ H)HH|KlHT$ `H=13@H=&1%@DAWAVAUATUSHL-*IELp8A~ M&uMd$ID$ LPPHH *HHgHHH*HHCHCHHHCHJ*HHyH8Hq*H;8H*HHC S L1"EK HCx L0uMvMM"Ht)HSuIƃv}uLH;A$H-*H*H}HH)H~PHGH_HEIEHH[]A\A]A^A_fDH;U:fDH8X|HcXH}DKHH- *}ZE111tHs}TcH*H8HGHHD$Hu1_H@HHD$=5HL$HH@H$HAHD$IHH@HuHHxtt@uHHH9tH H@;HL$@HAAD$pHL$@AHHUpHH;QHL$@A|$S|$$DmHD$|$@ EL|$1L}6AW HL$HH@HD$ Hu A |$"HD$Ll$HD$(HT$HLKXHI$uH&*H*' I$H@ I$ AE@L=$*H*I?HH)HH*HWH@"@CHD$|$IHHGILh0AE t,Ma MuIH|$ uAIUHJHBH)HPv,Hq(H;PL|$HFHrI}QLT$IEH,*H@"@I*fD@t[H,*HHHD$NHY*H8豾 g@~,tHD$H*HQHHHD$|$ILoIEIuH@Ht$0HtH*HH HygLt$0AufDAFIH=9#.HtH|$0Ht$PRbI/fDIH*HHyH8H*H;8Hc*QHL,LAM 77HD$HD$(HD$ I$|$t wH>*Hp"H*H8HHH*1H8P(LH*H@"@t H*H(I$oH*H5*TE11ɺt1Lla;H *LtAH@ I@Hx(HxGHH@HH *H9HH1*Hp"H*H8HH!H}*1H8C'I$t €%H|$AЃ tL|$11LBAW IMHQHAH)H7蝌IH3*HHyH8HZ*H;8<H*QHL,LAM 4H#DI?|$8Vo|$t H|$JH*H@"@TH *H\$HHrHZH15 %=HD$@ Ll$IEH@HD$(HD$f.H*>H8 IEMMHt$(L@I 1LH)u3HLD$@LL$8HL$0l9HL$0LL$8HLD$@@HIH4HHIH L ڃHH)H9oH;fDLPJPIUHz H*HB HbII$f.PHPafDH9yH9v\L5 *f.H1fH9v:LHA<>HwH5H)HtHH9rH9M1L9sH5`,1>HHAH9r&HH#tHHH7H9rnHH9^9yHRHD 8IEHhIEHD$0k|$t.HD$@ H\$_S Hw*H@"@H*H\$HHHHXH g%=H|$11>HrHqI}HIEfDqLSLHHH-*L *DHM2H_E11LLLT$=LT$CIH|$H0H9tLT$=LT$HD$@@Hm*IH@"@-HIfH91HLD$HLL$@Ht$8HL$02LD$HLL$@Ht$8HL$0HE11ɺt1LZL|$L AG MPH PHHbL5*LIH8+I.HHI$I$H-y? E11E1HH:*8H*LI@H8HH=H*HH@H8G@rIl$ (PHLǾ IH@Hx(n|$vD8 H5QHD$@ H"YH\$H[C H=1LT$ DD$HD$>LT$ HL$HDD$HfHD$HL1HH@H8HPHv*1H8<u5H9*HH@HHtlID$80H+HmL%+HfAH+AI $A!H9 fD$8ED$Af.H+HmL%u+HH0+I $H9N8fAuAHL=+HcIHH9EFQH=+*9HHcIH,ЋE H+%E HHBH8HtwwHBEH(IH@0H[]A\A]A^A_fD7HHPHhHHPHHcPH+HHHZ+HBIHJHMHH[]A\A]A^A_ÐD$-D$DH7HHHcIH,ЋE I$fD6HHPHhHHPHHcPH`+HHH+H0WfI$Hx 3-61LXLH+f+HH @L;%Q+qffD;6HHPHhHHPHHcPIHH +fAC9HH@4ff.@USHH+HB"u)H+HHcA(xH4@HHqH@<t~H+HRHH,E HH+h+HHE t3uquLtHE@tHHH@t<1Hu.HHH[]fDHH[]fDHEHx tHH@0H[]HEHtH@HwHtHE80uDH9H;-+twfAWAVAUATUSHHo+HB"u)H+HHcA(xH4@HHqH@<2HS+L54+HJH(ILeL,B#@ L=y+IHtB H=h')IH H@H8HAD$ % =eLIIIGH8G % =aIL9HH@(HPIH<|Hx"oL1HaHJ+H(HH@(H@0H[]A\A]A^A_DHB(H@0H[]A\A]A^A_ÐAD$ LH++HHAD$ u6fD11L5H+LmH(HHH[]A\A]A^A_ÐtID$@HH@1LfDI$L` HBH2HPH%AD$ % =LGIHRHRHH9B oL fDHH@ ;@I$HH@H%HID$80I$H@ zI$Hx @L;%I+vfDL?AWAVAUATUSH(H+dH%(HD$H+HL(B"u)H +HHcA(xH4@HHqH@<JHB(L5+ImHPIL$L6H@#@3L=+IHtB dH=e')&IHH@H8HE % =zHEHIGH8G % =@EH9t6H1H@(H@(HPIH<LH5!MeH+L(HHHT$dH+%(oH([]A\A]A^A_@MuMeMmAE yAF ~AE 0iAV tAE i1LDAV HŀIH@ H9HH)LxMH+H8H+LH98H+HL)HL9HMt/HM,HHD$:fDLoLgI}L8XLG,HI1AE 02IEHL$H9HH<+LHL)HLY/H@I@(f/bH=v13HHH9H={l1,C@tRIE@( Jf/fDHH@ @HEHh 1L63b1L'3H]"H;-i+}HEH@ fHEHH@HLHyHE80&D tuL=/HLzLuLLL-IDHEHx ?IH@ IM~H@HD$`IEImH@HD$!1-/HE@8]fIUHz5HH!+HB(Hzx#HH@HDAt&DH@r A9yDH1H=x1@fDH,<DH@H+HB(Hzyr 9HE1H@HHBtHRHHB\DEDHE+HB LBHcH RHI 1Hω t# tN tAHhuIxfGE1tHWHHB\DED@y븐@uDHH@HI<AWAVAUATUSHH-+HMH,A 9L-~+DgL5[{HH4@H4HALȃ<t>@IG8H8IO@HIG@H}wlwA`HMA D9H5+Ic,H6HA(H5+>IH5+H>IH5+H>I H5D+A H>9H[]A\A]A^A_H+IO8HH@H8HIG8HPw,wHMA D9>A 9DMGHMt;IxMHtwqwLL$u>H<$l>IGHIPIGPHtw'wI(wwHMA D9^Y AGH $+IP?IOHH+HHt AG@I@HtIG@wwHMAG8A(f.IXH<$##H<$IGXw+wIG@H :+HHtH@IHH [+IGHHHh`wu(q H +IG@H5+HHtH@IHHAOPHH`IGHw'f[fDI8H$w'DHq+IOXHH@Hx(HH(IGXHtwwH `+HH8H@H#GH1H $H $fDH@NIGPwwIHIGHwwAȃ<IPIGPwwAf.HH@H7HGLF L9YL)LGHHFE8&+&fD& &A%LL$L$%LL$L$y%%%AAWAVAUATUSHXH-+dH%(HD$H1LmAE"r@:IE(HHD$ !H+HD$HD$8AE#% D$HD` EHD$(IcH|$4EH RH|$L5uL N<MLxMAʃ IcL>fIHT$Ht$@HD$@D$4\HHIT$D$4Ht$@1Щ &>HL$HT$ HEE@"@t H+H(HHPH D9~YHcD)H4@H4HH2Ht2QH RHHH)у WHhH9uDHHPMcK@IHHT$HdH+%(HX[]A\A]A^A_DᏀtQH}G f%f=jH +%H H(*HH5p1AAIhAHEDHq+HHHD$(@  H\$(Ht$8HHD$ C H\$8H\$H/+% D$HD` EfDHE@"@aHD$(@ RH}G f%f=_H+%H4HT$(H=o16f.H9t$HD$ H9HT$H*0D'AHHQ+HD` EIcL-rH RL4IHPN<2A? wgIctL>@tPH}G f%f=H+%LƒH.*HH5n1LAt}AIhAtoHmHHHt$H|$ [H\$(HH[HzH\$ H|$H|$8&AIYLmAE f%f=H +%H4H=h15@H} HoL%#mLDG f%f=t!H+%H4LH=oh14%HT$Ht$8H|$ :HD$(%H(L%HHfH+HcHHH$+HATUSHHH L%+A$H=+H8HaHd#H+HHi@@ H׼+HHP0Ht HHP H A<$uaH5@ v{HH=l13HA+LI@H8H]L1*H@H8GH +H8HGLMH@ w7H[]A\fDH+HHtL%˶+ fDMELH=Fk12fDHH5k 1DHH=d`1f.1HT$)HT$H@L=E1HLU) DAWAVAUATUHSHH+uH+8rG HŃHH5aj 1L%׹+I$r UHcƉH @H HBH < "9~I$Lc` MkhL`A|$ A|$DM|$`Mt$0 HEx$H9+H+HH9EH HL:uDL-+IEHXH;HG (gH;HH+L8H+L0Hg+H8H?^HtHf HDHhHztſ1I$HPHH5X+L+H="+H HLHI+HIAHAILM@N L+MLHM@I$JHL-+IEL`I<$HG u!I<$H I<$w-wI$I}LgI<$u1&L` /H5H1/L-+Hٻ+I}HH)HIEHPIUHӯ+HHP{0j1H=34I$SH;Iċwv+wL#I}H_H;1&HX5.01H=3H뽺HLIHD$HD$$ff.AVAUL-+ATUSIEHXL C @H-ٮ+HH)H9AHHvKC E1t@jtHCA@tHH@t 1HAAD$ LH)HHAT$ 1tCtIT$BtHHBt1LfDL%+I$B"@t?A8Hu0HHEIEHPIUHXI$[]HA\A]A^HU0A8HHDIUHJIMHBI$[]HA\A]A^f.I$HkHRHX1HMID$80=DHHH@AHE1HHC80A@HHx AAD$ LLH)HHqI9DI$Hx Hff.H+SAILAA(Iyy Aq &$H+Lx?Mt#IRHJHtHcH4RH4APH;LHtDAt5p#yAy,tMIIyAq #E1L[HcH RHLMtMA wL Mt͍pz#IQHRxHtHH @HHH;PHLD뜐ATUH-j+SHEx#H+HB(HzxnHH@HH@<<t@H1+L`H>+H+H;HH)H~iHGLgHHE[]HA\fL%+r "xf1Ht@<H+L`0~HH;ff.AWAVAUATUSH(H_+H-+dH%(HD$1HLuDz"Au/Hg+HHcA(LaH4@HIDxAz#@tEMIMt9A@ % =LǾ&Hz#AfE11Ht$IH/<)IEE1HP(B < H]+HL)AtIHMnM3HLHPHJ+HL$L/HMfLmHHPVMHLHPH+HLM6fH+HH+HH9B(IEHHHPHAEPHRHHH@HHLBHT$L+@ IL$*H [+HT$L$H9HLHpLI9q8H,E1-f.x IDHJHHH9H@ L HHtDXEu1At>H+HL)HH+IHIHLuHfDIHLuHHT$dH+%(H([]A\A]A^A_y,AA0H9+LxFH!+L` H=A)L=+IF AE L@IECH=\b)L=+IN(IF IGHf.AEff=`I}@HH $HH $HALaLypDHi+IH=(HIH@ 3@HH9HpLHHpUH=_?(HJLL L$L$ILLL$L$I I}PH $HH@HW HHp 'H $HAIG0LaHA]fHLL0I\LLD$H$R H$LD$H +HH9HpLv H $f8AVAUATUSHH+L%+dH%(HD$1H$HI,$@#t@H}LuHt0G % =H"ILH4$H&LH+HH)H~{H$Lm11HL+HHP(( H+M,$HEHHHT$dH+%(uKH[]A\A]A^fDHIHLHpH4$fHH HmAWAVAUATUSH(HO+H +H-+L%b+HL-P+HH ^+H+I}HHcB LRH4@HIHPHEHI$HҬ+H98YH"+DEeH3~"xH+HH BH B H+HHB ǁ HBLpMIHx0D@`L="+E~A@@\o LHh+H+AHc HHH I$H+EHHAH+:9 $"H+HHHH+H;I$H+ULHIP0Hu+IMH9HHH([]A\A]A^A_fDH+HI4$DB ;B$B H L@NHBJH+f:DJH+uHHHcHrH5+HBHL+HH+HB,Hx+B(H+HHBIEHB H+HIEHL(@"WH Hu+LHNNNA(B8HH+AHHƉA(LrHI@`Lj0BPHHB@1AFfBH+AHcH+HH׃HI$H+EHHBH^+8Hͪ+9#I@`IHcp`~HxHIHcp`H@HH@HHHPHΟ+HIH@(H([]A\A]A^A_DHH([]A\A]A^A_fD;Hĥ+H +DEH+H +@@#HT$H m+HT$HT$Ht$DL$HT$Ht$H ;+DL$B HB ^fD) @)@ "H=T1AWAVAUATUSHH-+L%+HEM4$@"Au&IcF(H@HIVH@AH+D8HU+HAF A;F$AF HH +H@HIFHH+DhDxH+H@+HHcHHXHPH+HH+HP,HK+P(H_+HHPH+H HH Hs+HHHEHH[]A\A]A^A_KAF M4$AF =f.A~,Dhff.@AUATUSHL%K+H- +L-+I$HcB H @H HBHHEx"yIUHSH|+HKHH<SH#H/H+{;8H&+HcS,HHHԠ+HS(H+HCHSIEH+HHS Hl+HI$h HEHH[]A\A]HI+H8Hg+{;8wmf.AWAVAUATUSH(H7+L=؞+H5y+H=+HLHHHH Hc(II,D`"Au%HcK( Hw` H+HcS,HHH+HS(Hǜ+HSHڕ+HHSHt+HHS H&+HHEh I$[]HA\HRRH+L%ʕ+H0H+{;8HƒH{HHCHwvswƒH{PHCPwvbwf.H{8Hwv+w fTfATUH-+SHUHcB H @H HBHHY+HKSHH<ȀDcEHH+{;8w |L%c+HC@H +HHtH@H{HSPI$HP`HCHwOwHES8P(H+HcK,LC0HH HB+H K(Hu+ HKH+H HKH"+H HK Hԗ+h LH []A\DA&H+HcH9NHP  HA0L%m+I$H8G s0sII$L@H)+H8HG+{;8 H+HSXHH@Hx(HP(HCXHtw wL%+I$H8H@H#GHt+14$DHH@HHGHJ H9H)HOHHBDH9s/H $+HqHH9t I urHH9ref.E1[]LA\DfDH.,I$H8G SH5tDHyDHEH=t?1 H5NDtHW+H5JDHH9H HDH5 ff.SFHH+HHKHHH+HHB+{H+;8ƒ"t@D$(HB@!@L`1MtvL$HT$HLLL$L$LL$LD$HAD$!@L Bt(ID$HtP LD$LL$ffiH+L IhIOK4HD$ HHT$ L`HD$(-HBHHL`0M@HB@!@D$4L`@f|$2H+HD$81H-|+H+HT$HUHT$HE@HD$80H$dH+%(YHĘH[]A\A]A^A_ÅHF+L 8fDD$4E1@!@HxHL$HT$HLLI@H_|$(HH$:H>H$HH$H2I ffh fO HHHHufDHɉ+HT$ D$(L QH+HH(E ]tLmA} EHMD} H+D% =RHt$H H0D} IA D|$L$1HT$HH=;L@1NfDHH$HHkH ff#L$4HcH̀>I;i H5+HH ffu |$4}IfDH=y+HH1P ff f PHcHĀHuLH-+Hf|$2HELuH@HD$HH+HH@Hh(IEHx0u@@]L`8M ID$H@HL9IIEHx0tL=Έ+MEa(IyEIcH@Hljƒ  AQ D9~NHcƒH @D)H HHtHH RHHH)у  HhH9uH+H+AEH+HH9_IcA D9>H@H5#+HIAL4HP+IcV,HHAV(HH7+IVHJ+HH0+IVHHHHt H5@H+A~;8A/<)hIEHx0bA @\E1HE %D$lHEL`ILD$2= L0LD$Mt LH3Ht$MLHH+HH)HH9E 1%@D$MYLl$ ILt$(Il$:IFJHT$LLHHt$HHHD$)H=[+1H=+1H5.H=-1H=]*1GP=IE$ H/H-HDH5i.H=)1zI$NfPX1HHz+H@#t4H z+HLMt"A@ % =t!LǾHfH!y+IHx ATIAUHSHtH}+HH;x+9@l+H HK Hl+h H H[]f.HCPwv0wQD+fDkUfD["fDAWAVIAUATUSHHL%Gh+L-xj+I$IU@"Au&HcB(8H @HHJH@AHOf+B ;B$B HH4@H4HBH~p+HKDxHH+Hk+H Oi+HLp0HcH@@HHXHh+HPHh+HH+HP,Hn+P(H#g+HHPH}k+H HH H 7n+H H HHPHH#p+HHtHHPPHm+H5Be+H@XHHP`I$?R  fPIUJ(H8H+BHNNNHHB(@ t(tI$HH[]A\A]A^A_Hh+HLpM.MtAE tXAuAu1H= I딐HT$L$2HT$L$B IUB Gf.11LTAU %_DAE 9L,fz,DxL_SHe+HH@0H8Hk+HuHd+1H0&H[HfDH=[ff.Hh+ATUSOH-g+HUHcB H @H HBHHm+HSHH<SH2d+L%#i+H8Hk+I4$H90H5c+{;8CHb+H{P?HSHHe+HHt C@H{@HtHC@w|wS8HEP(H f+HcK,HH He+H K(Hj+ HKHd+H Hg+HKH HS I$⏀Lc0h H*f+HHXH+HtE t2uu1H=o RHL[]A\11HU %_DE tHL[]A\@HCPwwfHHa+L%mg+{;8hն^H1c+HL" fDӻ*fDfDHI`+f.H%fDAUATUSHH[k+Hd+Hd+LHL HHIci(EY H HcIyM…y DNHcD9IcH@HHHtHAS)H RHHH)Dу HhH9u>HcH@L$ILWt01Ƀ< uHGHH@\ɃHGLI4S|HHXLЃ< < < tvH=?1ŭDHDmHDHHCI,I9tL-`+IEL9{uL)IH}IpHLImqHCHH@\H[]A\A] OKH[]A\A]DH[]A\A]AA,t ?E~"H_+HI9t H;G t>1NH1[]A\A]ÐH[]A\A]H[]A\A]fImHH5yg+H=1 HHHDH5 VH=1iH=B1;ff.AWAVAUATUSHL%_+L=b+I$h"u&IHcB(LH @HHJHhHvc+H;HOL)M3H^+HHpH2HHt@HH]+M7HAF A;F$AF HH@HIFHHg+@hHH+Hjb+H `+HHcHHXHPHB`+HH+HP,Hne+P(H^+HHPHb+H HH H e+H H I$HJ0Lh8HH0HH[]A\A]A^A_fDL$ _L$ AF M7AF ,z,@Ń1HH@HJL(fDUSHH-O`+HUHcB H @H HBHHf+HSHH<SH]+H8H\+{;8Ha+HS8HH@H8HHC8HtwwH_+HcS,HHH^+HS(Hc+HSH]+HHSH`+HHS H^a+HHEh H,]+HHH[]H蓵HT[+{;85茰+QfD111AWAVAUATUSHH-\+HE@"AAu/H^+H HcQ(H4RHHqHDjAL%[+I$|L3MlAF LH+KW+HHAF <rIF@tHH@I$HXI$L5^+H"Z+M&D8AD$ A;D$$AD$ HH C]+H@HID$HH;d+DhDxH+H^+HHcHHXHPH\+HH+HP,Ha+P(HZ+HHPHW_+H HH H b+H H HUHJ0HH0HH[]A\A]A^A_DAD$ M&AD$ 5I$HCI$At^HEH@0HH[]A\A]A^A_@y,AA8IHx I$HZI$H@HU+I$HH@LPL;5YU+@I$IHZHt8H@H;Ht%IF80yfD1L薦dI$H@ATUH-\+SHUHcB H @HH HBL EAHc؅L%Jb+IQI$H H=Hx"H)YHI1蔤@USHH-Z+LMAA x,HcMAH RH I4t#HhuH=19f9H RHIH`+HKHH HV+H HV+{;:|rHKY+HcK,HH HX+H K(H)^+ HKHOHwjAE1t$0H|$(H117I<$HFj1At$@H|$@HE11H;M6H H=T,I $HH)HHHt$ H|$LpHPHHH1HL0MAF LH+D$HHAF @'tIF@HH@1L6H HQHLt$9 I$HPHBLt$HTAv i IHS,HHyH8HBL,H;8HH,HL,AM  \IHR,HHyH8HK,H;8HH,HL$AL$ oHHIHx IHHH@HwpH5IF80L;t$LIPHHL$bHL$cH HNH>H+&H=1Of.AWAVAUIATAUSH8HJ,L5&N,HL$H(I|$E HL$(f%fD$f=]E#HH,H\$H\$H K,HK,H7K,HHD$ HHH; H pI,HR, HH+HHHH\HOL,c HHcB HrH @HHHXXHcB HzH @HL$HLjHHD`XHMtAELhPL#謓HID$HHI,HL-eF,IIMH9H(t%LIH@(x IE; IEH=dK,ǒL-F,M}M IIEHMK,HL% H,IH IGID$XH? HL IT$XIHIH@IH@IH@IH@ AG IG% @AG HJ,L8H=E,M}MIIEHJ,HH IIGID$XHHL IT$XIHIH@IH@IH@IH@ AG IG% @AG HkD,L8+L%F,L7HH,L=E,I$HE M>f%f=]t }"L%I,I$LhMeMAD$ 11L茬AT$ %_DAD$ tgf|$`|E#HD$(P8L%D,1HL$fA$%DH|$AG8L-G,IUHBHx Htw wHBLt$H5L-+Lp AGPHE1E1 L蝶HtrH8HtjG .HH+dA,HHG tDtHG@HH@1螒IuIHeIU\@At$At$1H=Q4IEf|$`HgC,1AG8fHcF,HH@Hx 背I@AGP轲HJ,H,C,L-J,IW@I}HtLGHL`Mx6f.IEH@JHH@ tH@ HtHIsf|$]AEL%M,I$NHE,H8=踦HE, AG$H8O!رH0HI,tE f%f=]H@,H8HtCGHH@HHt)L-@,f|$]Mu蜾MMuHHVE,H L,@`HAE,HHPHHcHB,HHHHC,H(I$Aƀ H8D[]A\A]A^A_fDHD$W1Ҩ2HoJ,&f.HaC,H(f|$]L%hE,tM$I@H8H1{ HD,H8H D,HnD,I<$HH\D,HHPHHK,HcHHH B,HHE,HHcB H @H HBH,HGH0HH,H8HE,HH)HH >,HGHH9,HHG&fD#wfDL蠺cH@H0L1MH@H8OHHC1Ҿ H=[IHH?,H ?,HHD$HHH ?,H;H N=,HH F,H+HH4=,Mw0H8HD,HH)H=LwH =,HGLH蘡qIH@ H=,H(H?,H8HGH(HE % ="1HQ8|$H<,H8HDD,HH)HHf<,HGHH@8,HHGLLH9,H0HC,8VܢIEH@5HH;,H8H5H蟡BH͢H;,H8HE1>H@H(H蕢H;,H8豼'ff.AWAVAUATUSHhdH%(H$XHA,HH,;,HH(E  0oDH;,HH\$PZ ff$R"H$$u4H=,H HcQ(H4RHHqHR$H H%2f$]HDH$(% ={H$ HHD$HD$H'H$'8'HtA,HHt @ H{7,HHt@ tH@x f$]H$'1H$HvH|$H1藇HHH\6,8Ht$,H9HH)HH5|6,HoHGH;HH]6,HL AT$ ttIT$z U E1H$HaH ;,H=,HH9dMH$LHH豮uE#uAt$$#At$@H>,LI@Hx H%Ht$E1E1 pHHH8G WH$}H;5,H1,HHHD$PHHH$XdH+%(m#Hh[]A\A]A^A_FYH|$H$ό$%=@y=`nH$E1E11PH= H57'jJHXZH5wHD$xHL$H5>H1edHH@@HD$HE1AH$LLt$(HL$1H5LLIFHD$@螩詫H /,H/,HHL$hHD$HHH;N H 6,H5@-,HH+HL$pHH4,H>HH)HI9H<$HGH5,,HoHHD$0HGEtH ,,HGLHH<$ ǙAE[H5,,IcԸH)Ѐ|$HHH L1AF  IVB <   ALqAF <I~IAG HƁ AF )IFx AF1D$E9McJH$Ht@HLaH+,L MtACHD$ LI@H8HG IH ^0,H3,HL$`H1HD$XH90L\$H/HD$ L\$HH8HGL`(M1LL\$H贀HD$ L\$H$LI@Hx H?Ht$E1E1 L\$H՛L\$HHtH8G HZH$Htp pM/Av AvfDL訢HHI-,H8HGH(H E  HH+&,HH E tG/ . tHE@t&HH@t1HYwt E H$E11E1D$$@裒H$HD$0H9aH耎OH|$(nHXfDL\$HL\$H@% =L\$H L\$HI@H !),L HHD$0HGH褍A8@E1AЃ InHtTHU1HtIHHjHx(H9t)Ht$L\$HHT$H $HT$L\$HH $HHBH@(E9 AF HH$E1D$f.1LQH(E HpH蟋H% ="H$L\$HynH$L\$HHHDD$@HD$@f% =H$ L+nH$IH1HULHuHHt$xLHM7H$H1H5KpfDHLH&,H8fD vL\$HH@L`(@L1L\$HQL\$HH@H80LǾ L$T$H'L$T$HH@Hx fDI9D$HH4$AL`LH|$(ML$$ML$MII {HD$x$L$H&,H(HD$ LI@Hx H Ht$E1E1 L$L$H H$,H$,L$H{0D0H|$@;L$Ht@11HL$HC0zMML$tWH#,H(Hy HEH5#,HHH(,HLHL$HEIHEL$LH=L$nvHcL$L$HHJ HLbXHLXxH-',H$,D$L}L AG A;G$TAG HHL$`H|$1H@HIGL<$H',A AGHD$pEwL+ IIcL%(,IGI$IGHD$hHH+HAG,H+,AG(H$,HIGHIG HD$XHH=HL$PH HIG@H%,IW0HIGHH-,HHtHIGPH*,H{$IGXHIG`H",A ? fAGHEP(AW8L+xHNNNILDx(ӁI$11DC$Ptt% =\LLhH$HTILvIfDHD$ H $LI@H8HG HiDH!,E1E1H$HD$H(1D$@HHH$DGAE1A -IuHD$PHHy,Z$f.HHPHGDLiAE L]MISHHHE80DIHhH$Mw(H$1 H@H(H#H$E1E1D$fDHmE1E1 H5H%LE1E1 HL(11HL`L$H8G % =褘Aƃ[E1E1H5ۡH譐Hu7AD$I$H@HHwI}H5gZHH;)uHuHIuHtLH=\H1Jlf.11H4U %_DE HHgE H;fDIEHpH$I}H$1 y@LH#H<$7f+AG L}AG IcAL4H,HHD$PB f%f$E ?H$!sH;HHuu HH@ HEHx ( 苁1xIH;-,HbfQI8 $8H-Ɔ1E1HܝH1IH-չÝL|$8I`fIH@I9LL0HHt+H8t%HLqH3L]IAGtLH!zH;arH9rHINrH&rLH=\H1if% =w&HD$HJ,H(iHs%,$LI@Hx H~Ht$E1E1 HD$@HTHD$PH@"tHP(B f%fW1퀼$yH$1%vH$H$19qf$] -HT$@Ht$H=H1rhfLǾ $$H@Hx H$LaH5CH=~L\$H̀L\$HHcLǾ L$莍L$H@Hx LoL$IHD$ LIAHx HHt$E1ɹ$L$訋L$LגHHH$HIH\$Hlf}.pH\$f|.hf}.pHt$LL1H==gHt$H=1*gL1蠌H $H@H8<( }HbtH `H@H@(H$E11D$H8G {cbHD$@H@ fAD$I$H@H1H?DH=1ΘHINH;nHnLInHnHnHInHnLLH=;H1eHH@ HD$H,H(HD$@8.wH|$(VnHD$xH,H(J&rE % =H$ H_HD$HD$HH$8H$HH\$f|.hBHH\$Hl`H@ L$crL$HHD$xOH~wH~H,H8LǾ $"$H@Hx bB# H$/.f$VHhHv"$tHD$8.tHf8.pH$H=h11dLCH8G % =ÏHc=WHigfffH")qLϾ T$L$KT$L$H@Hx LϾ L\$L$ L\$L$H@Hx L貎HHHEH@H$HEHD$x/HD$@HD$@H8/tHD$@aH|$(kf$]HD$xhH|.H,HAD$H}m]H$Dp A H9jH\$HxOH,DH%@=@4/-HH9 EuH,HHHH)HKʃ?H, DpL=,AHH9w0fHQ,`AHH9xyHHwDHH)H5Kʃ#ƃ?H, HHHhtyH9w!fD%@=@HH9uH:,H@8u EHD$%@=@H5LhH9l$H\$L5[HLhHH9;/uٺLL\hHH_}]1HH蠇H\$H9H^,H@8EHD$H9!1HHPHiQH%)t.H52Lgo}heH5ILgGLEy~H8yHH@ tH$H=1a_1HH蟆xmH|$1H`HH|$H$VHHD$@HƄ$1HD$+HR,DtH5LfH5(Lnf3H$H="1s^H,gIFx AFE9~nD$]D$LaLM6H$E1IAH$E1LaD$H$D$D$눿XuL$1IH$H=yX Ht$LE1HKL-A+nLH=H1W]H=1I]H=1;]MHOL<$H5I9H=ԼHEL1.% L,$=t2H$HVH$H v| tQH̉HEH@H$HEHHwwH\$SуuK? |.uDH0H wH MtDLH5oH1]ctH|$1H脃H|$HyKH vL-xff.fH-,H,HH@AWAVAUATUSH(L5,H=,dH%(HD$1D$IL/HX0@"@t0H ,HHrH1H ,LHcHHH)LjHHk8HG} HUuHRHJ LQXM{@%@HSXI PWLLL$'AIXZCCt3IA HPH ,HHI~Ht@H|$L%,I9tHtuNuL{8A<$HK8Hy HBuHRH)HCB@HL ,IL(IHHT$dH+%(<H([]A\A]A^A_@C L%U,f%f1L_MAwAwIIHP(HHkfDHA ,HHHH,H;8H ,HH9%HH=1蛇L,4@HRHzyfDA $C"@I}G 1LA $^M IP@t$7_t$HI@"@H,8A IuH@*HCHu?H`,LI@H8H`L1L$~L$H@H8AfDH5I ,H6H<(DHrLHD$qL|$ufL$SL$DE11ɺt1L蔍Zzf.UHSHHH?HV HHO hp8HH9s!t HHzHH}{ HO1tHH{ HuH@{ HuH@@8HG{ HuH@HHG{ HuH@Hǀ{ HuH@HHG{ HuH@HHG { HuH@HHG({ HuH@HHW8HG01D@HH4vH H<H { H uHIHHHL9HJ{ H uHI9A8sH[]HPr8HH9H@@ t@8D H<oHrH@ސAWAVAUATUSH(H ,HHcB H @H HBHH ,Lk LS0HL{HkPL`0HC8HD$H ,Mt$80L9t'MtAv AvHtEIl$8HUu HCHH@ OHHt G SH8@ JH} HHHUuHRJ8} HUuHRHH~ww} HHHUuHRf.HHHH@} HUuHRH} HH HUuHRH} HH(HUuHRH} HP8HH0HEuH@H1FDLHHH4vL} H<HMHruHIHHt9} HMuHI;A8vHCLXH$L[HL;[ H,HH0F 1LLT$L\$qL\$LT$Hm,H(H,8u M9HC@Ls(L9v5L)AE tHe ,HB8u AF 1HLLZ} HEuH@tfKAT$@AF =< - IHztI~臁IIEIFIEH@HBIUIHRHPAE IEH,MLnH4$HI]NAF %DAF AT$@H1, HtH=,HHAD$"@L8L5,A>AE@MH.,{H,;8HkHHt7H}LmHtwwL聀HyHCHH{PHCPHtwwH{(wwHa,Hh Hc,I$H([]A\A]A^A_fD 7HJHHG t0HD$L$Ku HUL$HD$@ H}HJyHHD$L$m} HUL$HD$uHRHUu 7} HEuH@L;T$L\$LLHS@LK(AHH@ hEjLT$PZYLT$L\$L[@} HEtIHI9t=HC@LHSL)IHL)HIHC@} HEuH@IIHHH$LHC8L9vvL)AE t\H,HB8uLHS(B uBL׺H1Ҿ` HHD$zHt$1LlfD1HLLW} HEuH@HHK(LxL{0AD$CHEK A ILm|IHAW tx <H$IEAE@AEL9tEHP+8H{HHH,L ID$PH([]A\A]A^A_DHH t$Hi,H@8uIH4$HqH$H$IEAEcH=,HPLxHHRDHRH,H@8.AN !LCHAF f.IH@Hxtt@uHHH9HHufHPHw%=+11H4eMKTfDH+L$L$'f.LXOIHLL9HUu H@ Cueuo f tfH{~&Ct AD$CH{(tHE{ E111́Hn,HD$L$eHD$L$FfCHUu @ uHRe+HJWHLT$L\$GLT$L\$H+HH0 fK:Ne1H+BL׺H~1Ҿ` IHv1LLh7Cƒ f uVHX,LxHHt%AU  M@HEH,8A>E11ɺt1LJDLhlNdLL$=dL$} HEuH@C.IEH@Hu]HHPxtt@uHHH9tށ HtH@,HB8u I}HwleHE WHuHWH)%I~AF E11ɺt1LOCH=s1ILAW AVAUATUSHH+H,dH%(H$HP+HH$HHHH HcHHD$xHHXH\$hHXH+H\$PH8gHC $$% =JH|$PH$BHH$HvHD$Px H|$PQ_H,E1E11H|$PfHqHD$XHD$PH$H@ ‰$ {HD$@@ $% =AH|$@H$AH$HH7LEHؿ f @@@u^u HL9uHcH.qIH9HE11E1E1E1E1I 1fHS<   <  < SHDVH)D)tEt HHAH9wt Hq HEt"1EtHAL)HAHH9IHHE1E1E11H9ffHlHD$XHHD$XH|$PHH _ A HL$@$8tHH$H9PH\$XH{(AuHD$@HC(pNHD$@pHD$XH@ uHD$HƄ$1E1IƄ$L=9$HD$`DŽ$D$0D$HD$ HD$A,$ML$7}IcL>fƄ$HD$@  < H\$"LL$H$H}=H$LL$HD$ C H\$ Ƅ$H˩ tH+H@8$MHH$HD$ H$"$H94Hx " H9u$L\$ M1Nf.H+AELHHH+h$HjtH HHh+Hc$HB H+HD$xHA<$H_H +H+HHHHH$dH+%(PH[]A\A]A^A_HY+HL$H0H9O$ Q M̀$H@A H|$;HD$@@HcHcD$L\$ M̽$H$"$H+MHDŽ$H8HL+OLH $u$LH$I@@ HGLH1tHH$L,I9vYH,H5+``u HI9t@~uӀ~tHI9uDH$L,H +HHHBH$oAl$HΦIH HEIHD$@ @t  % =# H|$L $_L $f(f1ҋD$0Af/ Z)Љ AD)@tDY s#A@Etf.^sff/Xf/L$0l$0L#HId=$HL$ H$H؀$J MH9^D$0D)A} IEuTx uNx uHH=)+HHJH9v5H-+ @HH9tPTDDtf..@.Mf@H+HT$`HD$HHHP DA} u IIEH9rAE IMAl$HIH HEIIcD$HD$HIl$H$D$0HD$hH9 HHHHD$hHL$HD$I@ HnH+8H+E111tH8sAD$IHD$HD<$AT$ID$I@T$0MD))D$0g1҅HhHcLH I;BfH|$@AD$IL$ H$HD$H|$$ @4 H5]+1H6F8EE@$L\$HIHD$H~DH+L$M̃$HH+HHL$`fDHD$@   H\$"LL$H$H56L$LL$HD$ C Ld$ Ld$ sH+H@8$D$4HT$ H9T$; H+1IH-+L$HL$Hl$(HD$81fH5+B4.IL;d$E,$HD$(FD%D=DSDD$9l$0t`H|$8AJZDD$IEM҉tI\$A $A`A`Eψ $t$4gIL;d$rL$L$LAHtH9T$+L$ L$H+D$ HED$3fDHD$@  H\$"LL$H$Hm4H$LL$HD$ C Ht$ H+H@8@$@H\$ DD$0E1D$H1+AHE9t9H9s4H+%`=`AuAHE9ulj+D$ D$M̉D$f.D$0MD) L HIc7Dt$0f<^t4<~u({~AuHSA<@Et HHH)t Hqs@*-@#@.@0@>t1@|p rH@|tADrH@>tE1E1@.wHH)މq1<^@ƃqHq ty Hq HNEt FHNH1<^ HfA g$IEDE9l$0Ef fH9$LH$H$2H$IH+H8LI@Ƅ$@u H$HT$pHt1HtGuI9ps L\$_HS+L\$H8HH@HGH$LH%jH@H$L,Df(fW "\f/?l$0LLf(H+HHH+HHrLH)ΉBHcI$fHSE11fEHDQ@H\$HH[HJH\$ H$fDs^H$fDHD$HP(fDHA$L\$ MH$1]fH=+Ll$`$HLjDƄ$1$1Ƅ$D$4HHIHD$0|DHH@H$HkHH@H$HD$P@ H|$PeH+H8H+8E11ɺt1jDH\$@HH@H$HCHD$HffDHT$ H|$H)H$MHD$HL$PH9tP @H|$@LL$>KLL$Hŋ@ % =1HLL$.LL$IHD$@@ D$% =H|$@1LL$-LL$HT$HH|$XLL$(H)IHD$HHGHD$HH`]H|$XIHWHw(HfL UH|$XHHD$(Hl$@H+G(Ƅ$IHD$$P jH-%+D%D=DLfDFHD%D=Dt)H Y+HHB(DHL$HHyHrH|$ H$~fDH|$HHOLbHL$ L$fDH\$@HHhH$H[H0-\H\$@IHD$XHL`(H@HX 1H5.Hn+H0HD$#H|$@bfH-+TDD.H9r$fDH9}PHTDDt^11L\$2]H+L\$H8HD$`LHHHLoI@tJHD$MLLDLH)H~DHj+FLL9ILHsL)HD$HT$`HT$pfD{#A1E1Ҁz.|z.rHAcƄ$${#A1E1)MA HH@Hxtt@uHHH9HHuM[HyH7#HD$XL`(Le1<^@rH@#t@.HA H)މy q<^HHE11A FLyHHE111L\$ H$HM1L)HH$LL$AAL$H,L LL$HIN-Dt$0LL$ @<DrH@DH;HU끺H(DH;HUff.AWAVAUATUSH8L=+L% +L-+L5b+II]I+h"I$HHcpH)ӍVu-H +H1HcN(HI$9H XH=s+?I$HcPIH,ЋE Hz+%E HHBH8Htw'wHBEH(IH@0H8[]A\A]A^A_HI$S>I$HPI$HqpI$HP+pI$HcxIH<@I}@uhIHcHPH+HHЋC H5+: HsC H+HH)HlHGH_IEIHH8[]A\A]A^A_~,PH`cH q+HHH9gf.3SfDH +H:+HH<H9:"H5#+HH)HzHH=$L+LHL$HHH\$M L$HD$K4IHH@HK>I}~fLHHL$L$,>I}I$HL$L$fDH $PH+H $H@H5+H=K1 RH XI}AWAVAUATUSHL5+H-+IH@(Dh HEL fAAD$ LH+Y+HHAD$ u<tIT$BtFHHBt:1L#.fDI$HtHA<!HvIHKI9w&fDHI9DLHLG?A:H HwHHtEHk,<HHGH9vHHKPH9rHI9IGHL$HHT H9sf2HH@pJH9rAW H,DAW HH,L(HHT$(dH+%(MH8[]A\A]A^A_IHHIGHL$.Hy,H8HGL0M@Hg,HH)HLyLiHCH9HH0H:HHHxHrH9rH&,IH8AG Lm1AF % =Ht$"LHAG <Av 9!@'HT$Hru IH9psLHIHT$HPAG IW%_DAG IH@AF HL$IWH4 H,H@8AO HH9L ,JHHH9EHAtL)AxEt1 @LH H9uH\;뺾VLFHDAF 2HT$ H1E1jLHDD$"ZYD$Eu5HD$ LHAAW S;D$IAGIH@H$H$IHv/@;RyHLC;LLH(0;LL H6HLbLLWH$IL)I9H,$L)|$tHLQLLlQt1LL HLI:LH81H $CH $H@L0PLnDHtYH@ HH@HL(MH51LEPHH5L(PHD$AGL IHH$}HHϺ7H1HLLLH9HH8IgD$HH9tHFHHBH9uH@,L(H,HH-LQH%+LAG II^H@HD$L8Mt H,8u0AF ELg3AG Lv>AG ?HY,8tE11ɺt1LRfDAWAVAUATUSHdH%(H$HC,HH,H;HH|$8@#t @"@qHD$8H;G % =_ GHD$PHCHD$@HCP HD$% =A L|$"H$L_AW HH-, D$HE@8tT$u&u D$(%1,7tHE@8D$(L$H ,|$L J, IB AL$"LHD$ HD$hH+,HD$HD$pȃD$vEH,HHcB(H4@HHrH@D$v<AHD$H|$D$p% D$4Ml$8Au IE@@ uH@DD G# @u3WL5,IT$HIHHD$8HD$HD$pLt$8LT$AFL"AFLT$Hl,Au HD$xd$4D$w@HD$XHD$XI}HH$H uHGIީ L$ H9I|)@H ,DtrH 3,AIL9v[IyIHM)H) H ,DF M9<<< H|$8Mb D!D$HD$PHLE uHDA@+ILd$ L|$@D$LE1MIHD$T} HEuH@ D$(M9H,L HI9%D=DuL9|$-T$1IL9D‰D$D$RH ,D4IM9w!qHA,DtbAIM9vRIyLHL)HhH9<<<Hl$ @LM|$u#HD$XML+ HD$@H+$IHI)L;d$h/L9wMH|$PI|$ H,|$pL8HD$H98|$wH|$x H\$8LH+HEH,H{HH.Z,Hc,|$vL8UH&,HHPH(,HHЋC Hf,:LcC H,HL)HI_IoH,H(H,HHH$dH+%(Hĸ[]A\A]A^A_H|$vD$4LA} HELsuH@D$(M9H,IM9A%D=DtH~Avk?Hv, D,fT$4HLL)NHIH|,HL)H MuIM9GH,LHI9+DtK@M9H,fDIM9ADuM9Hl$`LDHI9Hx4Hu,DulLH)L,AH9fDLHH)Hv:L{,AH9 G8;t$IHD$ HD$hI9 ILd$  L|$@1Hl$E1H݉MMDl$qHH0HE1IL9EH O8HLpIL9t$Hl$ H ,LI uH@H@ AjLjHLL$(LHT$PH=,L_AYI?AW H /HG+H_,0H,@0I?HG D$(5H9jH ,IL9SA%D=Dt;T$4HLL)@HH,HL)H I_ILLd$`MHD$8@ @H|$8% @G HH@Hx2HH9$ H\$8H1H{' HH@I9|Hp,H(LH=L|$8JL)HIHt>IIT$HPAG@|$v+H,II)L8z,AAGD$vLD$(IHM,HL)H^MpIAW I?LAEMI@IH9ϿEAH uHHD9q8HIcH4vH L HqJ| HL5EuH9rOH9rJT$4L)DD$(i=DD$(HH,HL)HIL$IIAW n@H,HHLMEI DAFrLLLD$HL$ LD$HL$IA`AD HG LPIUHAE < HRhH$HIEI9,ILd$ L|$@E1D$(D$GD$1IM9EljD$H$DT$MtE L9Hl$ L$(HHL9IH|$uT$4LLL)69IHd,HL)HMwIsHy,H|$8H(<'He,H(:D$L|$@MHcl$I)dLL0I3LHm9 LLǺIM~?Hl$81fHIDHI9t1HH!HuH,HO1HCHH8AFEH,HP#@HHH@ HH q 9IMA,HI;H9xL\$DT$Lt$FLcT$L\$LVLL$MEHkH;H_G tHWB H',1H@#DHt,@HɋP8DfHWHHK@ AH@P tA+ "IMAEEtIE[<$QH,LHs,HHH([]A\A]A^A_fDEtNEHIJ4#HHHH9t(HtHHuH,,HHHHH9uLH&,HH,HHH([]A\A]A^A_EHHH@ H@x IMAHAEDL$E19I;HGHH5M@% =pH=',HH5,HcD$LcЋ4@ƀL,IH@H@(H1E1DErE11FE;Ht HHH,H1IAE1IcEIcԐLLL\$D$lL\$Lc$IAA,@  GfD$fDH,1H@#DH6,@HɋP8Hϥ,HxLL$L\$DT$jLcT$L\$LRILL$@|$1D AE@1ҾL\$DT$/LcT$L\$L\RH@]t_Hl,H8HGH@(H L\$DT$L\$LcT$LRH@H@(zfDHH@ L\$DT$eL\$LcT$LQI;DH=K1@ ;IE11IcHT$L\$LL$D$)HT$L\$LL$Lc$p1L\$DT$L\$LcT$L5QH@HH JuAt}H JA,tpH,DH=NJ1H=,DH=[NJ1AHH DHCH,H=[NJ1H tJH-+JHy(L=,1A VHH-JH-IgfH%,1HHx H,HR@#H,H$ATL%,USI$x#1LHH¦,H,H;HH)HHE@]tEt1Ha(HHHxHPHI$[]A\HHHPHH?,HHPI$[]HA\1Ҿo,H^H eff.AWAVAUATUSHH,L-,HIEDA#LAHpIAQ"H.@IMLIN<J48L&Dƃ0AD$ P@ A@@uI|$ DHoDM A P u3ELH? E@eHƥ,HIEQ" 7u-Hۧ,H2HcV(\HPLT$T$HtYH@ HH@HH8HH5H|$Ht{H|$H51HAG X@Mt0LЋ%ÑL@HPH,,HH<8j1ILH6ff.@AWAVAUATUSHH ,H,HHHrHhH1L H,HcH;,HHH1@#L{D$L9r|HL,L5,D$|$M/蘋IHHxHO,H;H;8}_IALL\IL LAI MOL9sH,H(H,HHH[]A\A]A^A_@LL$LL$H@A|$ T$LLt聉J@L-5HLDsH5s4HIML1H=8fI)AtBH=8H1u$L-HuH54HL-4ff.@ATUH-2,SH]H{H3LcH,uH0HCHۑ,Le[H]A\H@USHH-ߐ,HEHC HH+,HHC t7u]tHC@teHH@tY1HuKHEHPHUHXH<,HHH[]HHtH@HwHtHC80tH,HmHH@0H[]fDHHx u@HHH+֋,HH*@H;,tWfUSHH,HH(HPHhHHHl,H;HH)H~&HGHoHH\,HHH[]HcH;ff.USHH-?,HUHC uft&H,H0HH,HHH[]@%P=PuHCH;Y,t H;,uH,DHHUC USHH-,HUHC u.%=He,tH0HHE,HHH[]H(C HUff.@SH4,HH89H,H+[HHfDSH,HH8 Hʎ,H+[HHfDUSHHύ,HH(E t6HuFt,H-},HE@# uauE1Ha,H-J,HHHHEHH[]f.Ht$fHt$<uDHH@tHHB HtRL-,HB7L4ITHHIDAs?t AFH)I$ID$[L]A\A]A^HzHHHDHH)1HfL-y~,IDH#HITI$HI$H@ I$H@I$H@AT$ %_AD$  AD$ I$H@'ID$ID$I$L[]A\A]A^fID$ID$I$L[]A\A]A^fkIRI$H@I$H@I$H@ AD$ % @AD$ LAD$ @fDHq5T4BDT4؉)HD%1fLUHSHH},H},H8Hׄ,H;HH)HHoHGHMHH*HE HH+x,HHE tHu[tHE@t{HH@toH1HHHH[]@H1HHH[]DHEHHtTHHHw1HtHE80f.HfDHH;H1HH[]HEHHx HHH[]HH;-w,H3ff.Hz,AVAUATIUSH;8.Ctff]E1E1HHz,?H{PHSHH|,HHt C@H{@HtHC@wwH~,S8HP(HX},HcK,HH H},H K(H9, HKHL{,H HKH~,H HK H,h H Eu~[]A\A]A^HCPwvXwKDLk@HC@ALCDfD'fDHG,LI@Hx HtCtUHu,j1E1A1LHH-N$PPXZMtKLH1LǾ ?H@Hx j1LADjE11MH-#Y^뵺H=A+ISHH|$dH%(H$G % =Ht$"пHt$ HsD$8%=`=@|HD$1ɺE1PE1H5qH=}VjZYH$dH+%(uJH[ÐHHHt$ H@HD$s1f.1ff.AUATUHSHdH%(HD$G % =H"žH$IHvHS1LIHH~ IDf8.pt,HtHT$dH+%(H[]A\A]DxmuIH9tHH}LH5-.(dL HuDHLgHXH$>@MMMH H61H5 7E1:yfAWAVAUAATUHSHL5y,dH%(H$Hu,M&D8Hv,HAD$ A;D$$*AD$ HH y,H@HID$HH,D(@DxH+Hz,HHcHHXHPHx,HH+HP,H},P(Hv,HHPH{,H HH H},HH,7Hv,H;#HH|$1H+HD$H|,HHD$-Aă]KH w,HT|,DŽ$Ƅ$f$HD$HY@Hv,H |,HT$DŽ$H5{,Ƅ$Hf$H9#HD$HHu,H|$H:H8EDH5YH1YH{,HT$DŽ$Ƅ$HHv,f$H~,$Hu,fH:{,HT$HHky,H,|,HH9~JH-cw,HUHcJ H4IHH4HJHH },HsH H4H t,H1H =s,{;9} yHUB H kv,Hcs,H H4H v,H1s(H I{,1HsH \t,H1HsH w,H1Hs H x,B H1H$dH+%(H[]A\A]A^A_Ð;AD$ M&AD$ fHt,H|$DŽ$Hy,Ƅ$f$HD$HHs,H:H8uZH8o,8fH!z,H HZHs,HHH,H=1-HxD葿H ff.@H-ff.@AWAVAUATUSH(H-/s,L-y,HEIU@"H=u,L;IcG(NH@HIWH@D$AHq,Hq,L AG A;G$AG HH=G{,H50t,H @H IGL=t,HH y,DpL5u,PIL+'H=s,HPIHH+McHH=q,L`P,L%Pv,P(HI?HPI$HP Hx,HI$落IHPL:Mt"AG AwvAw1H=^HT$tHE@ HH@ 1HȮH HQH"L5!],InHuHt$Iv <$@&AR ʀ  M 'cfDHLHHjAO n MWAR HL5N\,L%ic,I$H@H H@ H HH(L-Qc,J @HL5i,H=g,HH<$HBIUHH2HI+HHVHQIH1HvH4H7H1I$HvIMHHHa,HHHHJa,H; HI+HH$H;HHD$H)H HoHGLHEHHBHH2I$HJHI}HI+L$H?HHGHBIH:HH6H^jAE1jH|$(H11 ^_Ht I$I9tLt$HHHP@IL`I1MuH@ t$HL9I1HIHu@HL5R,HD$MI@  "HĽH;@IEHx L5R,HHE1D fD@@ G L/MgHL蠞fDHHAVAUATL%U-UH-V-SHEHPHS-HHI$L0AF LYAF L-Y-IUB8u>t/ u t'x#If@(f/AF %=~L1tIƋC <vxIHHxH@HCD0@C %_DC @ I$HHE[]HA\A]A^ÐILp C <wHeC IxDIUB8]uNHHPLH$Iƹ̃HH"HpH9rBHH3H'LH$Iƺ̃HH"HpHH{11L+HHH+KHJC %_ D 1LVff/V,>t!AF LH5],1 C A<HC IH@ HxAF fIF@qHH@aL: IQf% =L胾H=[fL訛AF H1L~YfH y@LII@(pAWAVAUATUSHL-S-L%@R-dH%(HD$1IEHPH P-HHI$LpL8AF  H"L藘HAF tYH V-H@8uIH4$H H1HH6E % =HH"3HAG % =1"L HHRHH觧C ߉S @uzI$HPI$HXIEHHT$dH+%(u`H[]A\A]A^A_@IInHRH$@Iw}HEHmH@H$;H耿yfDAWAVAUATUSHhL-_Q-dH%(HD$XHrP-HL8HD$IEh AG f *Ht$8"LHAG L%ZT-%=I$D$Ht @8L\$8LM'D$J1ɽD$|$IEHPHM-HL4AF <a&IH9jI~%_DAF HD$L0y|$D$JHt$8HWD$KHHGH9fDII+VHPAN I$Ht @8M9tAG lAF@IEHHT$XdH+%( Hh[]A\A]A^A_I$DŋR8AG jу\H-uX-D\AwE1HHL$@HT$JL\$ H4葖HT-L\$ 8HD$8@@|$HT$@|$1L9HlEL)ݹ@|$|$=AG %=DLHt$81҈L$)L$HDŽH|$8L$MHAG HT$8HHsHTIHh^HHH9-y?HȀBJ@HD$@HhI$P8AHJPHBˆD$JA1D$ 1謵u̇&I9|.fD1L\$OL\$t>HD$8AfDHM-OHJP HB<DI$Hu!HD$8DD$A10@8t1L\$ǯL\$AHD$8Eb11訯L\$DHD$8ID1L\$L\$tHD$8AI$Hu'HD$8{I$Ht B8D$'@8t1L\$L\$AHD$8E111L\$DHD$8HnJ-8H~L-A8HHH<+HHHH H ЃHH)H9HHt1HHH?HѨuIHpHVHHL!IH8HH9sHWHp H)LGHI9HHBHH9sf8HHH9uHl)D$AD$>茹AH1A~AAixD$KHIHHIHt$8H D$JHD$@L H<3HH)H9H^Ht1H0HH?HuIL@IpIHL!IH8HL9sHwLH H)LGHM9AH4IGHH9v8HHH9uL$HAD$1褬L\$ t;ItrD$HD$8xI$Ht@8t1L\$ gL\$ u11UL\$ uINAIFIJ|$JiuHD$8HH~"f{̇uD$ID$1 D$fAWAVAUATUSHhdH%(HD$XHB-HHHD$@  H5G-H4$HR8 7 H$HH8 HD$P B H|$Lt$01L薧IHD$0HHl$MHD$HC-HD$(H$HH HD$H\$0@ lH$HP8LI9HL$8Hl$ Lt$JLD$I~E1LLHH輡H=HT$8L9v%HD$HL)HD$HHD$ HH9H!LLL3L|$8H9%|$AH$HUH= K-D$Hj@8`1AIH$HH6@8,111诩D fD'H=A-% HH|$(HJH>-HH,=H|$Lt$0 L/IHD$0HHD$E <uHUHt$H9r1Ht$H,INjE %_DE H$H+HH@81Ҩu?H$HH@81訨11藨HH-H8)@HH;l$tAHEL+}LxH$HHt @8"HD$H9t @ E@HD$(HHHT$XdH+%( Hh[]A\A]A^A_L}H$MdHP8PH$H@8ML1L)M95@ALHHaHpBAHH9uI@H5H@-8%H9;-8E11ɺt1H1 u?H$HH@8111ѦH:-H3@-tE11ɺt1Hj[DUH=B-¾ H!HvMHuH9rrf.HH9[DHHLF?AH HwH*HEuLH9fu@y~H= B-@ƺ H!@HvGHMH9r4@HH9#DHHLF?AH HwHH[C-H8HD$H|$ HL+?HT$8If|$Hl$ tΙIfAOM AHEL+}Lxf.Ht$HLnH@HD$0HHD$E <tHzE _fΙD$IfAGN1dH?-M9M)M-fkHF4E7IIM9EutAAAtH?-F40MdHH;l$_vH$H@81蝣}H@8u*1vH$H@8@M9L5X?-'fDH!@-;IIM9AEAAH]%_DE I,$HD$HHt @8<E1HD$Ll$H@ HD$HDx8AkMM9HL$PD$>L|$ZH59-HL$ Ht$(zDE1HL$ LLL{HD$(HT$PL9v!HD$HL)HD$HHEH9xHLM9H\$PM9[HD$HAH 0=-D$Hr@8h1AQHD$HH=@831ϛ11辛DDH%=H|$Ht$H1HHD$HHHl$IHD$Hn3-HD$09@HHH+]iHT$PHLILLHE1Mt{HD$K .HDx8A1HD$H@8HD$H@8H1L)I9s.fDA HHAHp BƈHH9uHH;l$tHEH+]HXHD$HHt@8HD$H@8 HD$H9t @ E@HD$0HHHT$hdH+%(7Hx[]A\A]A^A_ÐHq5-H\$JHt$H HËE M HEH+]HX;DHD$HH-@8#1T$?蕙T$?uIHD$T$?HH@81a11PT$?|$>A>ID$>|$ZiDˆD$>H\$HLsH@HD$HHHD$E <H躓E ~f1ĘAĄuCHD$HH@81薘11腘AĄqH8-H8HJ5-Ll$HD HD$@ EL HD$HDx8ALLIL7}HHl$ O<.1HxLIHH)H[}HuLLLHHHHl$ L I}H ЃHH)L9LDHt1HHH?H֨uIL@IPIHL!IH8HM9sIWL@ H)MWHM9AHIBHI9vf.8HHI9uH;HH1HD$H]Ll$H@ f1ԖH*-H60-QE11ɺt1Hm8H7H/-8'Ha*-8E11ɺt1H1411#OfDHD$HHf.Ht$HH^H@HD$HXfD1HL$迕HL$TEI9H\$IMH!H13-B8IA$IL9oH0-E}8u HB1HL$7HL$HD$H@8u:71HL$HL$HD$H@8fI9H5p2-L)1AHH9uHH\$HtC H耚MfDHH\$L)ER8HD$@ 0肙dH;l$)CI9r"ıHfCIL9A@I$Il$H@H$fH$HHH $HtH5/-fMHHDt \UHHXH$HHPH$Hu/@1HLsAG @8Ll+uA@IHt @8DM? H .-DH$XH$sHPH$H}H5.-EHH؁@@t \MHHXH$HHPH$Hu-}#M}MHHfMHvIc L>MS}IDM MHHSfD}\HH$}1tL(-t IP8gH$buNk@@ 똀}1$H%.-L~(-L L&IHt:@81H--L<(-L QL(uMHHMHHMHH}}uN0HHHMHH>xMHHaMHHJ}0MHHlMHHMHH/;11荋H,-L&-L L MHHD]MHH5ff.fAWAVAUATUSHhdH%(HD$XH#-HHPH -HH,H "-HHD$(HHD$H.&-HHt @8AHD$@ +)HHD$8L-E <uHUH9Z#HH`INjE %_DE HD$(H(Ld$8KD%HD$Hy%-HHt @8HD$@ HQ%-H@8{HD$I9"AHl$ Lt$JLt$Ht$@IHt$%fLLL肠L|$@I9EDD$LLH=v*-HL$D$HmHT$@L9vHD$ HL)HH9XsH|$ HL+MHT$@IH|$8thHy$-H@8Hd$-H@81L;l$s4@ALHHAHp BAHI9uMfAHEL+}LxH$-HHt @8HD$@ 5E@H-H\$(HH] -HHHT$XdH+%(Hh[]A\A]A^A_@L}1 uBHi#-HH@81߇11·H'-H8`1蜇uBH"-HH@81o11^HG-H -E11ɺt1Hf1AXHg"-HH?@851݆!11̆DH|$f1Hl$ M % =H|$Ht$8 TdIHD$8HXE <H0E HȚH-8H-8E11ɺt1H̟1H]!-HL$I9 Hl$MLI-@HI#- IMHM9tH !-AjuH H|$8DH -H@881/H -H@8u- 1 HZ -H@8@Ld$L;l$rCH!-:<XHQ"-AIIM9AE1荁tAE11qtAEAWAVAUATUSH(H-H!-L-T-HHHHH HcHHD$IEL H-HB" u 1B#8AD$ < J#ΈL$@@t$Ht$L|3"D$IEL9D$"D$D$2DHHHs|$PIIM9}vfI?G % =>|$ILL胀uH&H'-IHPIWM9}wH-HH -HL$HB"u)H-H0HcF(x9H<@HH~H@<<tIMHH([]A\A]A^A_Ã~,uIEHqHxH9HyHPHxHj-HQHHfDH|$Lp  LLnt-HH)HI9H7H-HJtIAHuLHI~HHHHzHFI9uHEHQLqHEH9weI~HHHH5-HH9gHAhIFIIHEINIVH9v^II~G % =t86HƉL{IDžnHuH*-H@HHp H-H H-Q"L+u)H-H2HcV(xFHHEH-L0H-HHH[]A\A]A^A_H-HL)HxLIFHXthH-L(H-HHH[]A\A]A^A_f.LȇHNy,ÃHQ -HIE1LL{xHt6HIFMnvfDLL vILh;@H -HAWAVAUATUSHL%-L--I$Mu@"M>InuhH-HHcB(H @HHJH@LQoHI$t ImHH[]A\A]A^A_f@@#AGCIHXHHH-HH)HH9I$P ff=fE1Hy"mDHIHHEL991LLvHuH -Hf[nHI$HPHm -HHAGIHpHC H-:HsC ILI$z,L{mHI$fDL8HcL(HcHt@P#H?E1@uLIHHEHUL9}I$fDHHusHXD#o H=t1uDH舍AWAVAUATUSHL5 -L- -IL8L`IEX"u-H-HHcB(H @HHJHX1L[HH-HL)HHt3H yIID$MD$tYIIEHH[]A\A]A^A_IULuHE-IHI$M&Hfz,ÃeHL|IID$MD$fDLLrIPAWAVAUATUSHhdH%(HD$XH -L H -HJ"B#σ@|$|$u1H -H2HcV( H^HHEIL9CM>AEEtDT$11E1jALHjcxZYHDT$HxHH,HH9|$wHCtHHHtAt GIM9rBI>G % =uHH@ J 8HHHHyH,IHIFM9sH,HLeHH[]A\A]A^A_M9sKHL,HH)HHV,HIH8,LuHHH[]A\A]A^A_I<$G % =t]jJ8HHHHxL9}IDILuHHL$UHL$HIHH@ 뤺HX@DH,AVAUATUSHH,HHH Hc0H,L#HH0I)HLHH2BH;IH,HH)HL-,IEx"xEHLHHLpHPHFHH(HHL4(IEL)#[H]A\A]A^@H),HHtiHH H,HHPH@HHHHAf LpIƁH cHW8fDJ롐AU1ATUSHH-1,H]C# @ǃ uHC#H,HSHL,MefA|$ AD$ It$C#<HUB"u-H,HHcA(H4@HHqH@<t+H,Ht,H;HH)HHGLgHHH[]A\A]ÐL[C#<qLald@H,L MI$HH/,HID$H',It$I$HID$H,H;HH)H~ZLgHGLHDHUHH[]A\A]Dy,7HUH;HU HUH;fDHt$HHt$I>AWAVAUATUSHH,H5,HHHHH Lc0JHD$HHi,L0MIH5S,HH,HH-,IH IFHE`HHHU`IHIH@IH@IH@AV %_AF  MAF IH@HI,IFHx"L%U,H,I<$HHH)H)HHHH LHGLI$BH H,HH)H\$I$HSH9wLfH;G ;Aj11APE1LLH*iI$ZYH9LkAE u`HHI9$w1H52 5H,HHHH ,HHA,HHH@hLOIfDH5,HL$HHT HHL|HHDI$H,HHH[]A\A]A^A_ÐHL6;FqfDLnAF c4H;H,L8MIH5,HHY,HIGIGIHIGAf MwAO HRI<$f.{EI NREImf.AWAVAUATUSHHH,H,HHHHH H ,Lc8JL:HD$0IMoAE Z HCMwHD$ L9RHD$IEHPHpLbHnH9l$~L)IIAHl$L)H+l$HD$ HL)HL$HHL$(L)HL$I9AE @H|$H\$(Mf.I?I>IGHuH|$ME1HL$HtsH|$IEH9Ht$HpH;pHpHtEIEHt$HPIEHHHHHHH)HHfDHHHufL;t$ t-HT$LD$HIEH\$LHAE@HIuHH+P HH9HHHt0HLD$(H=HH<QIuIELD$(HH\$IuHXIEHXHH@ HD$LTH|$|H\$H[HLHHD$8LeH,HV,L|$0L0HI@"Mu)Hl,HHcB(xHrH @HH@<"HD$J IEH|I>AE@`HIELT$HT$HPI9HI}IIMt9JHJ~+H)HwH)LHfHHHuI}IEIHt$MEHpL+d$(tJ1/H|$#2HT$IEL|$8HIH<,HI?DLLD$(CIEHt$LD$(HpGH,H8H,LH982LD$YLD$L$ YL$ LD$I`6HLD$~'LJ|HtwvwIsII>BGHL` H=1LL$HL$DD$gHLL$HL$HEhDD$H1E1z,AA H|$ LLL$0GH,L$0L0Mi/H=,1,ff.AWAVAUATUSHH-,H @,HEHHPHULc JHH$Hp,L{HHPHn,HL4AG H ,H-b, HUfL${H,LkfI9Hh,_fDI$HH ,HI$ID$IuHt LCILLIHpHCL9mr'I}Ht G  L#Mu'9IfH,H,L$fH,L$$L HD,LeHP"AGIHpHAF RHk,:BIvAF H,HP"tHUHJLrHMHH[]A\A]A^A_HCH9x.-fDLLs&fD@#tAG=LUHcH4PLPIHtsvYIE H~HCHEH,HHEH;H=,HH,H+HH{HHtPA?H-,jAG oL ^L^H[2mH=d1DHCHH]lDAVAUL-,ATL%P,USI$Imx"xXLuH@ Lf%f=to*RHH,HH)H~uAF@u^I$H]HIm[H]A\A]A^fH,H:HWLr(Mu NH@Lp(I$끐1HfDHh1fDHHBHsAWAVAUATUSH(H,HHPHLc(H,IL H=,HMIl$HPH7,HL4EPHaNIHtyDWIG HgID$HH,HHH;zH q,Hz,L+!ID H{`H;i?=H,H,H ,M|$HH3L)fD$HSH,fE ucL9;wHEHHL9;vzIIO/HIGL)E@tHuHH>HtNjw,w@E1L;;s=II.LHIH>L9;wH8,tHHH$,L$fH-,L(H{,L+HP"}EHEHpHAV %H,8IvAV H,HP"tHHJLrH HH([]A\A]A^A_f@#tE}H8QHcHu@HD$HT$?HD$HEHT$HjLZkHxZH@.H=`1@HC`HY|@AWAVAUATUSH8H=,H,dH%(HD$(H;,H7HHFHHcHHHH,HB"u)H,LIc@(xL @JMHI@<tqH,HRHLJAV M 6f"AU IUB("-uHL0HhAV M I$HH[]A\A]A^@MIHLHH HD8HH9AE Hމ7H-:'IuAE HMEAU LIHLXAE HىHa-:IMAE HDAV 'AE H-t HAL?H<@AE H-@@t HjHL?HHLPHLPH@AVAUATUSHL-)-L5-IEIHhHB"@uHJH-HHL E AL$ ȩ u E u AT$ I$%HR Hׁt H HHU=AHR Ht HyHE1H9H H91HHuzH k-S  A8HH9H؁HCS 1HFE RAL$ DI$H(E HE@(f. zC ^H-:"C H@(IEHPIUHXIHH[]A\A]A^f1L8f(E t1HL$8L$bD1LEAL$ $(uIEL HhAL$ IHH[]A\A]A^DH`6H1fDAT$ fDց@@t HYHH@<HxI>HIL ƃ+S L)HсH?IEofDH9H)H(tsI$H(EuxC fW HZ-:"C HH(IEHPIUHXIHH[]A\A]A^A_fD1LV)f(EtE 3HE@(C \fHӿ-:V"C H@(IEtAt$ 1I$H@ t HyH1@8HH d-S  @HH9H؁phHCIES QHu~ IfF(I4$f(V(fTf/vDH,fH*f.z0u.fTf/v$L,fI*f.zf.S \‰сt,HIE$1L4AT$ @"S HB(D u%IEHhL M AT$ JfIHH[]A\A]A^A_H{S f1HL$'L$DH)ȃ2Dց@@t HXHH8+IE(f(HIE 1H3E tVAt$ @HxMfH*fWH%H"S @(IEAT$ FHƃfHH H*XHff.AWAVAUATUSHH-G-L5-HEILhMB"@uHJH -HLf.,1uHEL LhAT$ IHH[]A\A]A^A_E11fL86L$fATIUHHF uurU ti%HUHR =7HhI$H;P H]A\D1L,AD$ I$H(E t`HE@(f/f/w1f.EH]A\@21H,U AD$ 1HL$ L$1Lf(E pfDH]A\I$=tMHB HxHUH;B )UfI$H;P H]A\)fHEHr H9p ff.SHIJ-HHxH0W N AA A !uBteHHA(f/B(Hf-wH0HHH HPH>-[HHfDExHHHr H9q } H$-f.kHtH-f. uHHxH0W N AA AfH-[HHÐSHı-HHxH0W N AA A !uBteHHA(f/B(Hf-wH0HHH HPH>-[HHfDExHHHr H9q ~ H$-f.kHtH-f. uHHxH0W N AA AfH-[HHÐSHİ-HHxH0W N AA A u}!u>tYHHA(f/B(Hj-sH0HHH HPHB-[HHfExHHHr H9q H,-f{H~H- u%HHxH0W N AA Uf.H-[HHÐSHԯ-HHxH0W N AA A u}!u>tYHHA(f/B(Hz-sH0HHH HPHR-[HHfExHHHr H9q |H<-fHtH%- u%HHxH0W N AA Uf.Hѯ-[HHÐSH-HHxH0W N AA A u}!u>tYHHA(f.B(H-zuH0HHH HPH`-[HHExHHHr H9q tHL-fHuH5-) u%HHxH0W N AA Uf.H-[HHÐATUSH-HH0HxG F  tlL%-HcI$HJH-HH,ʋE Hٯ-:HuE HHPHHhI$[]HA\@HA-L%*-Hh@:) uHH0HxPfDH-[]A\HHfDHP.}ff.AWAVAUATUSHH-H@ f%VfHVI$L@ GIHp AG L!ƉuH-:L(D1@E1F#u%=1LAV Ip1LLD$iLD$HAG L!ƉH`-@@=H4IwAG Et Ad$ tAf HHPHLxH-HHH[]A\A]A^A_D1LnAV I1LLD$OLD$HfI$L@ ~ LLLAG@fLY.u%HH -LbL2H1AD$ AV Hɦ-HHH[]A\A]A^A_@IHp @LE11AVAUATUH--SHUHzL*G AU  mL%N-HI$B"@B#%=+1t IAU 1LQ HƋC L!HN-5H,HsC HEHPHUHXI$[]HA\A]A^ftkHLp AE tnIEHp C L!u HӦ-:uH%@H Y-HrH HB#f.1IAE u1LHIEHp HLp @.uHEHxL(G mf.H-[]A\HA]A^Hf.HATUSH-HHHPB A  ubL%[-HI$@"@t6H]E@u{HHPHHhI$[]HA\fHpH-HH,@0 uHHPH|fDHѣ-[]A\HHfDHxff.AWAVAUATUSH(L--H-IMHLaM@"@uH}-HpHL<h H 1AT$ A _@ Ɓ <25Ɓ00D$ AM9@A!H3ׁF#u E1F"@u-I$LJ tHH@ LI1H ƒ_AG IEH։uH-:LHL$"HL$f1@E1|$ Qu E1F"@u,1LHL$r HL$IA %=OH1LL$HL$C LL$HL$LI1H AG _H։IEH(-@@=H4IwAG Et Ad$ D$ ta IEHPIULxHHH([]A\A]A^A_H1LL$HL$,LL$HL$pDLLAG@tLf.u"IEL`HAT$ A f.HHH([]A\A]A^A_HH@ @1LHL$HL$IA fI$LJ \LHL$HL$D$ E1IfAWAVAUATUSHL5-L%@-II $X HiL)U AM b@ с H#@"@3E1AE %=1LLI1H ‹E bH։IEH-HHuE I$HPI$HhIHH[]A\A]A^A_HpH--HLt-HELLx AE ur1LnIH1LD$Hl$IAE %=IEH@ E1AE tIEH@ LI1H ‹E bH։IEuHß-:HDH1LD$!Hl$IHELLx I@<2 IuI $HiL)U HH[]A\A]A^A_fDIH VAUATUSHL%-H--I $HEY LHPeB @A @  unIA"@tM1eLL@ǃ^AE@HEHPHULhI$HH[]A\A]fH-HIHL,@@<4uHEI $HPLeI$HH[]A\A]fDL hAUATUSHL%-L--I$HPH}-HHIEH(E  Y@HUHr xkC H-HDHބyHsC H9tIEHI$HH[]A\A]fHH9 0tu@tu EtwHE@(C fW HÜ-:"C H@(H裖@E bf.1H@ IEH(E f.IIHyytuLCC C HމuH-:DH1H^E DHPTLHp Dff.USHH?-HH8G  H- -HH)HHO HtCuUtHOHU0At"H H At1FHHU0HH-HHH[]HHtHIH0HwHHtHO90uO1 DuHH89DH1-HHH[]@HHy sH0jH9u HW0[HSf.ATL%-USHҘ-HHPHԕ-HH,I$H8G  0t[HB#trHHp E H։uH-:HI$H(H[]HA\DHHeE@tH'D%=tT1mHƋE H։Hj-tmHxhHuE z1H?HHp <uI$H8G fDH[]A\HDHff.ATUH--SHEH8G  L%=-H F-I$H HrHB#ui%=1bHƋC H։H_-HHsC HEHI$[]HA\t3HHp C H։u H-:uH1qH@HHp ]@<IuHEH8G fDH1-[]A\HHfDHPHff.ATUSH!-HH0F  uBL%-I$HPH-HH,HE@uOHH(I$[]HA\D=u HH0DH-[]A\HHfDH`ff.AUATUSHH-k-L%<-HUI $HBHA"@uHqH ,-H HH:p O Ή tpHHzLh G twHHp C IH1-:HsC HEHPHUHXI$HH[]A\A]@1y HUIHzG u1a H@"iuHUH:O AfDI$HH[]A\A]fDHeff.AVAUL--ATL%-USI$IUHhHB"@uHJHސ-HHH8U G  t{HLp ME tuHEH@ ItwHIS сH ה-9HCS I$HPI$HXIE[]HA\A]A^@1! I@1H IuH$uI$H8HhG 2f.IE[]A\HA]A^HH5dH=31fAUATUSHH--L%-HEI $HPHA"@uHqH |-H HH8r O Ή HHxLj G HH@ MK ʁHy-@!ItoHI@HSK HEHPHUHXI$HH[]A\A]D1 IHEHxG n1 i@tkHCK &yuHEH8O fDI$HH[]A\A]fDHHA1H*H=Q213AUATUSHL% -H-ܐ-I$HMHBHA"@uHqH ̍-H HH:p O Ή txHHzW Lh uHM1A"@tsItC Hɑ-:HsC I$HPI$HXHEHH[]A\A]@1I$IHzW ttHH@ |D1k@uI$H:O !fDHEHH[]A\A]fDHMff.AUATUSHL%-H-l-I$HMHBHA"@uHqH \-H HH:p O Ή txHHzLh G uHU1B"@tsC L)H[-:HsC I$HPI$HXHEHH[]A\A]fD1I$IHzG ttHHp |D1qHhf quI$H:O fDHEHH[]A\A]fDHCUSHH/-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9Hֈ-|H0HJH HBH-HHH[]f1HHHzG u1rHD1|uHH:G ef.HA-HHH[]ff.USHH?-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9H-H0HJH HBH-HHH[]f1HHHzG u1HD1uHH:G ef.HQ-HHH[]ff.USHHO-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9H-~H0HJH HBH΋-HHH[]f1HHHzG u1HD1uHH:G ef.Ha-HHH[]ff.USHH_-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9H-}H0HJH HBHފ-HHH[]f1HHHzG u1HD1uHH:G ef.Hq-HHH[]ff.USHHo-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9H-tH0HJH HBH-HHH[]f1HHHzG u1HD1uHH:G ef.H-HHH[]ff.USHH-HH:HJG q Ɓ u}tPHHzHh G tVHH@ H9H&-uH0HJH HBH-HHH[]f1HHHzG u1HD1uHH:G ef.H-HHH[]ff.AUATUSHH-c-H-HEHPH]-HL$HH:HJG q Ɓ HHzLh G HH@ L9 @@HcAD$ H?-:It$AD$ HHPHL`HEHH[]A\A]Ð1HIHzG s1nnf1:tuHH:G "fHEHH[]A\A]fDLjff.AUATUSHL%-L-$-I$HPH-HHIEH(E  u}@t CuEE tWHEHp C HމulH -:t`HsC H9tIEHI$HH[]A\A]1HVH뢐1DuIEH(E dHfDATUSHH--H6-HEHPH-HL$HH8HHW q ց t}HHxJ(G H@(*AD$ H-:"AD$ I$@(HHPHL`HEHH[]A\D1 Hf(HxG }1L$L$m@1>,uHH8W (f.HEHH[]A\L`AVAUATUSHH--Hʁ-HEHX HHfL$ʍf%fH+HcH>fL5ACL--IEH8G  T+H@(Mtffs f/frTfoTAD$ IHR-:9"AD$ I$@(IEL HEHH[]A\A]A^DE1E15DE1AA"fL5 ABfDE1A?f.E1A@ffst@ftff.Q"f1@f/so1DuIEH8G HEHH[]A\A]A^@fDfDLH$-8t/LH=#H=3H1Ye H=#D$D$벐AWAVAUATUSHH'~-;L5-H-L-)-HIm@#Hو-HH)H2 IHHPH~-LL$HL$ImMgL$LYHHH[]A\A]A^A_@H-2H - 1‰1Љ1ЉL5ވ-LnfDH} L}HDW  tFHf(f.  @w@HJ(fDHH hIHIofAUATUSH(L%c-Hl}-dH%(HD$1L-m-I$HImHHH@#tTH}HHtGG % =dHt$Ht$HHT$Skt$?DH-2H P~-HD$ 1‰1Љ1ЉH=7-H{-Ht$HH-C  HH҃H?HsC H&-HH)HHEH]IEI$HHT$dH+%(H([]A\A]DƉHD$?D H5UHC@tHtfHHHpHt$HHHQH51HD$f.Hxff.AUATUSHH~-L-4}-HHPH{-HL$IEH(U  tdHEH@ CAD$ mH-:]ID$AD$ IEL HHH[]A\A]@1HfU tHE@(D$hD$uqf/޴p f/&  f(fTf.v3H,f%fUH*f(fT\fVf(AD$ H~-:"AD$ I$@(AL$ ΁H5}-@6xk@@ID$AL$ !uIEH(U 5fDHHH[]A\A]HEL@ @8M/MD$AL$ 8@1Hvnf/@f(fTf.H,ff(%KfUH*fTXfVf(1LvAT$ сH |-@ @t{HxvID$AT$ b AT$ HƉ%u[HF|-8tOIt$AT$ +HL,LL LHLLff.fAUATUSHHSz-L-ty-HHPHNw-HL$IEH(E  JHUHR  IоHyHHIHH?AD$ H 9{-@ @.@%IT$AD$ yfD1HH‹E nHE@(AD$ fToHz-:"AD$ I$@(IEL HHH[]A\A]DHEHP HIHH?fD1E1 uIEH(E fDHHH[]A\A]1HF%LLSLxFAVAUATUSH HQx-H-rw-dH%(HD$1HHPHLD$MtK ACC@YHEHPHUHXH*g-HHHT$(dH+%(H8[]A\A]A^A_fIUMeHRHT$ LD$M#E1HEH8G % =LD$LD$1HtFHuHT$H6v }HtHrH<HrHx H9HFHHL$ MHL$ 1LLLD$WLD$E~AtHmDHqg-8@Ht$ LIu߫AE@TEtf. EHt$1LIAE yDz,A%EAAHH@yHt$LLPIlHH@ @1H5o]AE H@H9HFHHHLD$sLD$2fH`-8E11ɺt1L\LxLhAE f.AWAVAUATUSH(Hgc-HH;G % =HD$L%d-HkL{ALsI$@" u E1@#U % =HU HysD$1E1EI$HPH`-HL,Hk_-8LL_AE@lH}b-LkL8I$HH([]A\A]A^A_ËT$HLHD$IE} LT$^QLT$IHi-HHyH8Hc-H;8H_-E111vLT$HL,LAM vIEMLT$@HvIEtAFLp@IELLHL$Hh0IEHH8L$IEHI[fDHH@ HD$0HEH@ vHUHz gD$1E1gE1ADLLLT${LT$WLT$Hff.AWAVAUATUSHHL%a-dH%(HD$81H`-I$HB"@LxZ R#HD$ D$ fH$f\$ HXL0C % =Ht$"HۦHAV % ="LHt$ 谦AV HNjK H|$( GHd-H@8;Ht$ 1ҾIHAF % =cHt$ "L1K HD$(MD$ ]E1ҀtGHC@t=HH@t1ҁ Ht$HDT$DT$HhHAF tIVBtHHBf|$ }t|$ H<$~|$H$HD$ HHt$H9HNf|$ }LTHT$(HL$ LHHiHD$(IHt&H)IH~|$t HHIMtAuHAuI$@# I8BH5Y-FH]-H]-HHPHHpI$HHT$8dH+%()HH[]A\A]A^A_DHa-H@8HT$0Ht$ HD$0H|$(:Ll$0MtSH[-L0MIHH `-HI1LMIFHT$ Ht$(IFHD$(K D$ E1Һ@D$ E1E1H Z-HrH L<H8H|W  5H$HZ\-HH=P\-HD$ HII~H@HD$ *HHkH@HD$E1Һ 1E1E11E1fDHHz H<$qH<$~|$tH4$ 1HH$f|$ }HD$H<$IHxHH$H9ILNIH1LLI@AHt$ H|$(ҁ |$ IH@HD$(Xf|$ }HD$H`IufDAG H]-:MwLAG HV-Hr0LLDD$ AE1@|$ H$HD$f.IH@HD$ IFI@HZ-HHDAE1 DLLL LDH<$|$ D I_ff.AWAVAUATUSHH[-H-(Z-L%b-HM,$HHH HUHcHJHW-HHU-HI݀8L4ucL=Y-IULI7L)HAV uJI$H؁@IuPLpHPHEIHH[]A\A]A^A_L fDLuAV fDLHIH1U-HZ-ff.AUATUSH(H-Y-L%4X-dH%(HD$1HEHPHU-HHI$L(AE % =[LHt$"葞LT$HMR7AE H[-H@8@L\-@ƺIA H!AHvHHOL9rDHI9D LHLG ?AH HwHHHt$HHH?fDHt$HC H.Y-AAtwtsH{C I$HHEHHT$dH+%(H([]A\A]@IEI}LPLT$MHD$11lHhfDHT$H1E1jE1LZYtHt$HHHH?DHIff.HtSHHt YS[fff.@HY.HHP8HtY?rtTH5t}HHxHE11ɺfHNj@ t;% =t?"1Ht0H51HfHGf.1ff.fAWIAVAUATUHSLH(T$Lt$hL$DD$ dH%(HD$1M|$`HP.HI9T$`LHLyIHM}Ix(1LL賾Ht LX0M IsILHD$dH+%(H(L[]A\A]A^A_f.MlHH`HD$HT$IHH`L|$hfDH@@Htb11LHT$IHtLHD$LLHpAt$At$HT$HHD$HHH@HuH6O.HrLHP@|$`~ @AVL$hLLHQHS\$$SDL$(DD$$AIH HMEIOL9LHH貾LE1/f.Lh,H۪ǃt+IHtMt!A?tLHL9E11HIH8HpH=1[ff.HE1E1j11j3Hff.USHHN.H;t H[]f @H-6:H5'1HHHH[]ٜfAWAVIAUIATUHSH~IHM.H8"At I@ ugHt}u4LĭHHt8uEtI$HL[]A\A]A^A_EHLTtLE1eH@@ u<   1ҾH= dI#@L5G."1ҾH=9IA?fDSH L.HHt H [fD{H[H fSHK.HHt H@[fDKH[H@fUHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$$HD$HD$ D$0HD$RHHHdHT$dH+%(u H]趽fDSHJ.HHt H`[fDKH[H`fAUXXATUSM.f~=1f.HH@I|HtwwAG09σHH@HI)HD.Mw(M.HHt@HC.IFHAvAF H?B -HBwHcH5;f; VHBfAFf۪LfDAGAGL-ܜL%/I~Htw3wIMw(IFCtwHcfA|UM9wHB.A~ ;8|hIFA|uI>H{H4C.IFH9t-HHHI.H@HH@H@HHPH A.HI>蹪4@{fH)P\g-INIO(fAV IGIFHB.HHt @AV HA.IF(AF$IfDSfDAmHD$(dH+%(/H8D[]A\A]A^A_AG+AG<T$WD$ T$=AGHH 3D$ sfDH  AȅU,EgEIVIW(fAF IGIFHA.HHt@H@.IF(AF$AGtTAGAF ITDH=T$訹 ӳ AGT$BfDHiPAF IAGNH5H.H=R1E1HAGRI!H=nT$ T$MnHbB.IH HI!AGRxH=1輸 AG0cI> 51Ҿ/Hl1/HmIAG01H=Mnl1H]H4H轞L꿡H}1HIAG0I~y41Ҿ5Hڛ15HۢIAG0I~F41Ҿ3H觛13H訢IAG0lI>4A~1H膢IAG0JI>31hHcIAG0'I>31fH@IAG0IvA~IQIAG0I~:HI~IgL1H蟍1I萨L꿏H`IH*IFHp*@#AE#AG0cI~蠍I~ItgL1H"1IL꿎HIH*IFH*@#AE#AG0I>$1HIAG0脲HIAG0I~IAG0I>1уIAG0uI1薠IAG0ZIVIv1IXIAG0脖1HUIAG0AvI>IAG0H<.HHt@IVA~1ÏIAG0H<.HHt@IVA~1I蛈IAG0Hx<.HHt@IVIvA~IhIAG0lI~胝IAG0WI~ΤIAG0BI>01Ҿ1HK11HLIAG0I>XIAG0IVI~I6茪 IAG0IvA~IdIAG0IVI1豓IAG0IVI~I65 IAG0IVA~1IwIAG0kIVI~I6 IAG0OIVI1/I~I/A~LH-IAG0I>/I~I/A~L1HLIAG0I>x/I~Il/A~L1HIAG0I>G/I~I;/A~L1HIAG0nIVI~I6 IAG0RI>.I~I.A~L1H蝤IAG0!IVI~I6豨 IAG0A~>t I~.I>.IVA~1HKIAG0IVI~I6_ IAG0I>[.I~IO.A~L1HIAG0IVI~I6 IAG0fAVIvп@IIAG0EIVI~I6է IAG0)Iv11茯IAG0IVIv1qIAG0IVIv1VIAG0I~-1HG@HARI%AG0I~E-1H Iv迡H @H蘛ARI$AG0QI~,1H辮Iv迡H软@HKARI$AG0I~,1Hq@HARI#AG0I~I~IӲHL1HIAG0I~ʧIAG0nI~%IAG0YI~,I6HЮ@H^IAG0"I~+Iv迡H蘮@H&IAG0I~+@HIAG0I>k+1HܙIAG0I~݅I~I_L1H_1IPL꿛H IH"IFH"@#AE#AG0#I~2HXI~I,_L1Hڄ1I˟L꿚H蛜IH!IFH!@#AE#AG0I>F*IAG0Iv1IAG0sI61IAG0]MnT11fAI>PzIAG04AvI~I|11IAG0 I~ IAG0I~;IAG01fAIvHt I~sް蹢AG01fAI6Ht I~E11|IAG0H2.I>HHWH@L,AG0YH2.I>HHWH@L,ۛAG02H2.I>HHWH@L,贛AG0 ֨H>IAG0I~)IAG0I> z1HIAG0I~I6x1HʖIAG0I>yIAG0uI~I6yxIAG0]IVIvйI~EF#4IAG07IQ f#fv ACGHI!A~I6E1AG0HL!H%IHL!H@IMnA~1蘜IAG0A>1肜IAG0I~-'I6H@H苕IAG0OI>&@HeIAG0)EF1I]E@1荛IAG0I>9&1hH誔IAG0nA~I6貗IAG0VA>9IHW0.H8AG0/Iv1{IAG0IvA~苧H%1H$IAG0I~IAG0IvA~ICIAG0I>_%I~IS%A~L1HIAG0I>ΓIAG0rIvA~IbCIAG0V1fAM.DIVA~1eIAG0)A~ЃhIAG0I>$@HIAG0I~zI~I{,L1H)IAG0I~T$I~IH~L1HIAG0hI~zI~IsH~L1H蟙IAG0#1ܡArHL!H AG0II>>IAG0I~)IAG0I>IAG0I>ѩIH;AFAE#AG0IHt11賛HAG0ItI>輞IH AFAE#AG0OI>IAG0;fAM.&AfEM.AvI~E1ILAG011E1חA6I~H'AG0I>11E1AG0HAGRI!AVMNIpIT$M(LL$("HI1T$ HRLL$ 1tHXZMt2-HڿH轤LHHH+,.HށH8A荧IAAAG0IpF f%f u N"IpINIV1MA@H2IAAAG0INIV1IvM肘ApHIA@AAG0IIN1MnIpIHL$V1ҾH7HL$LIH1A~H膦IA@AAG0INIV1MnIHL$1ҾH͇HL$LIH1託AXHIA(AAG0o11fAI>kpIAG0OINMn1ҾIpIHL$LHL$LIH1'A~H蛥IAXAAG0IvA~tH1jIE111q^_IAFA9}AG0I~谄I~HtBH;(.H;IvHQH;nAG0eIvA~HE11jI1Ҿ1lqAXAYIAFA9AG0I~"I~H谄AG0I>?I~H蓌A~HgIAG0INIV11MǕA~H;IApAAG0AFHIN1MF1PMpA~HIAXAAG0Y^GAFHMF1IN1PMUpA~H詣IAXAAG0_AXI>D1H蚋IAG0I~%A~HYIpIV1HI6IHt HIAXAAG0I>}H=qT$轠 T$iHMF11jM1woAZA[IAG07H(.HHt@INIVE1AvApMFWArAG0H'.HHJ\H AG0I~ׁI~HtiHb%.E1H;IvHH;蒝AG0I~萁I~Ht"AG0E1fI~譀IvI1H\sA~HСIApAAG0&I~M.jIvL1HsA~H荡IApAAG0I>+I~1H͢A~HQIAFAAG0H&.MHHt@A~AG0E1}H=o1rHJ&.H8RAG0YArHL!H AG0I)Mn E1fE`AG0fAIvITIH-.I~I>H$.H8AG0AFA9vAIvA~IAG0~IvIݡIH{-.I~vI>cH\$.H8AG04HE-.H&.IHHI! AGAG0D$ AFA9vAIvA~aIAG0H$.HHt@IvMINIVF A~f%f,ӁE1AG0AroIvA~I6IAG0SHd,.H &.IHHI!: AGAG0D$ ApA9vAIvA~}IAG0HAGRI!A~I6NHyH".@<HI!AG0HL!H5IvHL!H2IZH3#.MHHt@IvINA~F f%f1评jE1AG0ArH".IvH;ӥA~5bE1AG0ILJfEIVI~I6V IAG0H*.Ha$.IHHI!葄 AGAG0D$ hIH"I>{IAG0MI~{I>HIAG0-INIE111*IAFAAG0INIrIAG0I>MnLHrIAG0I~[I~IHpL1HIAG0oI~I~IJL1H踋IAG0dH[IAG0Ht$ H=crLl$ AG0H:.H1HtH!.H;HL!H IxAG0?I>I~IA~L1H芅IAG0I>Vt1HIAG0ALJE1 H=ud1H w1I螄L1HiIAG0INI1}rIAG0qINI1^rIAG0RI~IAG0=IIvHt 跑HABuHF.H@$AH1o11HIAG0I>sIAG0I> sIAG0AFAI~IrIV1I赆LH1HeIH.H8AG0[IFMHX(LkMt6LLD$vHPHHT$艏HT$LH٘LD$Iŋ{ LL -I~I葀AG0IFMHX(LkMt6LLD$GvHPHHT$HT$LHfLD$Iŋ{ LL 躅I~IAG0u1E1fAcI6HtH ".HpI<1 HL!H H.IH87AG01 HL!H H.IH8AG01褗 HL!H Hv.IH8軅AG011i HL!H H;.IH8者AG0GIvIƎIAG0*I> IAG0H.IvH8E1AG0ILJfEH.IvE1A~IHwHH@PHtHB]t@tHDArAG0A~I6IAG0{1fAM.iI~Htw wInIo(I9oH].L-eL%Wl-H}HtwwHIo(I9op} ;;|cHEAA|uH}HtH.HEH9t.HHHi.H@HH@H@HHPH.HH}3}iiB|sI_(IGH9v$H{HtwvwIGHH9rIG(E1{IGAAG0%AG0AAG0 AG0AG0AG0AG0AG0AG0A~1E1114HHj.H8k$H.H8|HAG0NE11dH=?7`H;_AG0aE1ɔAG0K{1誄1H{pA~1HMwIAGRAG0AG0AG0AG0AG0AG0AG01赓 HL!H H.IH8́AG0AGRAG0AGRAG0wAGRAG0iAG0`AG0W‚H=;]1t@PXH=1HH52.UDAUATUHSHHL-.IED` fAA3G upHߺHwHfAv6xE@ukC @uQH.HHIEHH[]A\A]fkaE@uEC u1H[붐k{HfDH8fDH(C HfDATIUHHtj11AjE1虎ZYHtBjHLAjE111v^_Ht1HxHPt&HHL1]A\|HHL]A\pH=.H1݌ff.fUH@u/HGH0HtFH! rHEH]D@t ]a@]XfAT1UH}Ht=HH@]uQHh8Ht(zH1HI.HL]A\H .H]L`0LA\f.+bHfDH .AVAUATUSL MI$HH.HI$AD$Al$ w6uID$ID$I$[L]A\A]A^ÐL- .IDHHITI$HI$H@I$ H@I$H@AT$ %_AD$ , AD$ I$H@_@L-y.H L4ItH&HAIDs=$t 'AVHH)I$ID$L[]A\A]A^H~HHHDHH) 1HDH@I$H@I$H@ AD$ % @AD$ f.[iI2ID$ID$I$L[]A\A]A^fLAD$ fDHT4RrDD4؋T9rHD1fDG IIH֩ u-tHG@t HH@u LdDHAHNLȉ׃@tyH5. HHsIM)MMIyH‰΃@H5f.@  HHsH)ILfDPHуtHtHNfHNLHP@IqHtFHJRHuDJHtHHuE11f.Hy.SHHcB H @H HBH u [f.H.HSXHH@Hx(HP(HCXHtwviwH .HH8H@H#GHt1sZ#[fDHH@HHGHJ H9tH)HOHHB@cr떐ATUHHSF % =tUKIĄtLHytELHtHHtAD$u^I$HxdHHEH8IHHH[]A\A]fVtLnIHHtHUHLlHcE11ɺ#IEHLEvIEff.@AUATUSHL-{-L%L-IEH(I$@" u@#V| rHH-HHyH8H-H;8NH-E111.HHH߁K uH@H.HHtEHh@IEHWDHhmHt3HpHt)I$B# tGH-HIUHfDHq-IEHHI$HH[]A\A]@HJHE-HH@@u@C H-tkHxfHsC IEHfDE tH;-H@8u"H}jHHH8jHHafUSH(H-w-H-dH%(HD$1HEHx"H:@#< t@H|$@HY-HhHBHH7-HjHHHT$dH+%(H([]f.HH@HD$HGgH|$u8ARRAuxYuHGHx(HyG @u[iHHH_=HJH|$,8CODE HGHHxCHL$H iH8FORMfxATHGHx0H_H-HHh@H|$8GLOBtH|$|8HASHpHGHx fDH|$Tf8IOI@H|$48NAME(HHx ?H@H|$8PACKfxAGxEHH@(Ht)@t#HHx Ht@<H?HH=&7dfH<@HFILEHANDH9}fxLEqfHGHx8SCALLfxAR@HGHHtH1-XH@H8Q=HH|$ZEH|$Tff.USHHO-dH%(HD$1HH(E % =HH+H$HH=wE  t;H-HH0HH-HHHT$dH+%(u|H[]fD%@@=@@t4HH-HHp-HHHEH@H$mHEH@HtxBnBHWHXS@AWAVAUATUSHH-L% -dH%(HD$1HI,$@"@tkLuLm@ f%f$L1:ILLIEH,I,$HHHT$dH+%(:H[]A\A]A^A_DHY-HH)HHPL}HH*-H:HWL2M@ ILf%f$VAV % =HL)AV H4$Hǁ cIHB9MufH -ILH L4HHIHH#DII~HpH4$1UH@L0HQff.fAUATUSHL%#-H,-L-=-I$HHHX IEH,f1H0f*H=f*t'E@u2IEH(I$HH[]A\A]HH*E@tHPDAWAVAUATUSHH-H-L(HHHH H -HcHj-HHHHD$HH=-HDp HpfALfDH -HrH L$J"I,$HGH@8HHDHHx .HBI}HWHuHWH)%H}E ff.ATL%K-USI$Hf-HPHC-HH,HH:G %o=uOHHHp H9t9HNHH E t1HY\HH*I$[]HA\[H]A\@HuE H*I$[]HA\ATL%-USI$H-HPH-HH,HH:G %o=uOHHHp H9t9HNHH E t1H[HH*I$[]HA\[H]A\@HuE H*I$[]HA\AWAVAUATUSHL%-L--I$IULpMB"@uHJH-HL AD$#@ ET$"AA MI(AA  M Iy y Mp M#I|$(LL\$"8I|$08AD$ Ad$"L\$f%fAD$ HK.H@AD$#ID$fE U"U"k1Ҿ HU fTM#ʉ΃4+E" !HU(B!@UHZ1C!@tH{S ff W ffHW(B HHz E1G!@tLg@FHHe##E H}f%{fE H.HHEHG % IH$HIfU"0E#&1Ҿ HGLELMJ AP ffE fDfL$IHU"E"tH}(W ff LH}W ff uL'MtAT$ ff%uI9l$(uG#L\$0E#HGHEHG"L"U L\$f1E"<H}G f%f=6E#H]0Le(H+ ]C f%f q C %=8H{(G f%f="E"ƒU f ʌDfU H.H`E"HUG#E#HGHEH$HGH(I;<$!L$H$DH5.f%H.H.H(HEE!@HMHP fHfQ ffurH1HtjV ffuZHHtRR ffuBH9A(u<@!@t6HPH:Ht*H8t$H:HtH9B!@t HRHuf11HL\$OL\$HH.H}IHQAD$ ffff%f=uHL\$L/ L\$MM#}"Le(MAD$ f%fE#E!@H}W ff: E oH5.H6H9w(D$/D$ E1fD$1E1L\$E1L@DBfAAf AEDA#Af @(DDA"LaEAAAf tEuA9 E1@~tHI9qH HH_Q fHH H2HHEHP fJfv f @#HHB f%f=HHP fJfv f @#HHu@ f%f=c11HL\$L\$HDHE11H8L\$H&Le1ɺ1L\$ I$LLMLD$LL$3H011H3HL$1L⿡11HH@"Hك C"l3HC(LD$LL$L\$ HEL M$IL AD$" FA@" ;H" 2AD8DML9ADA"EAAAE8f EDLMkEZ fAfAUMMIER fAfA2L\$HD$D$@@"T$ EE H|$ T$/f%H}f fE HL.Hp Le@u#HEE"| D ȈE"DHA~"BN#LH6L\$fDfdM$$M/HA DE"<Hm ff f fP"H@0HEH@ f%f=t$f=H+.HH@\IL`(MAD$!@LI\$C f%fzbC#XHL\$1ɺ1H0Hs(L1H0K#E"L\$C"IH@(@!@KHXHC(H@(HHD$ -D$ D$(D$ Ѓ)HH\@ #mLfA@ ]MEQ fAfA0D$/D$ f:H5.D$/D$ H6H9w(MAp D$/D$ ffAp"@A@#@I0fF uH6DF fAfAHHD$/Q D$ E @ffL\$HD$D$@HcD$(L\$Ld@HHG.I<$LfCL\$D$(E fHcD$(L\$Ld@HH.I<$LyfCIL\$D$(fHcD$(L\$Ld@HH.I<$L9fCL\$D$(E HcD$(L\$Ld@HH.I<$LeCL\$D$(DHcD$(L\$Ld@HH?.I<$LeCIL\$D$(|$8ÀM#Pz1ҾH;1Ҿ H'O"΃DFA'DG# AAHM# HMfU"f u @EL\$U"L\$H}ff Mf.C#0I9|I9sE"ƒaU Df fU H.HRPE"HUC#E#HCHEH$HCH(I9$H7E#H$E1ۃD-HcD$(L\$Ld@Hu.I<$LcD$(L\$D$(I $H{Q ffuLIIF#L$f@HHK L$H HQ LIfG#0L$H}L$G#E#E H?f%H}fE H.H@0HEL\$E1HD$D$T` tM#@@M#AW"H_(HS ffC!@H;kL\$E#2I$HfD tM# €txM#@HH@ I,$;,H}(HGHx(hE H}f% fE bH}L$L$LL$cL$u vnM# eI,$H$H"ȃ,+H$@#ǃ@8 H<$AƒALGLL9@A)9HD$DDMHH'Hl$ NIAD$!@AMD$AP ff?IP(B 1HHz#HL$He#pH<$gI,$c $.L$ff.H. H.HHHH H.HHHTH>.Hf.H@HH@(@1fHt7HHt/PHtAt΀P1P1H1fH@HtHHt BHtHHt B HtHHtHHGhHHc@ @SHHC Ht[DH{@HtJ0HC Ht HC0HC([HC@ HCHHC@HC ff.@H1x *0f.SH5HH==;HC@Hy.uKH;Gt2f.HH5H;HtGu[1[H).ff.fHHHx HHDAWAVAUATUSHHGHujHIIHE1Lh fDHtlLHL$IMt1y;%8Hu.H{.tLtI Lxu4HL[]A\A]A^A_fLtAAIHHHx <HHDHHx 06HBu1HHz 9HHff.HGPATIUSHHh @t_HÃu^Ht&$8HuHK.tLt[H]A\DH 9uHÃtH9[]A\HHff.HHHx +HHDHHx 00HHx .SHHx @u-Ht H`1[#H[ff.AVAUATUSHGHu]HII fDHELLHH *1IHy-m#8Hu H.tH@tI[L]A\A]A^fH@1fATUSHH+IH} HtHEHH9t31HE HE(HE0H`L[]A\fHHt#HHtHx Ht]HHfD{" Hff.SH1Cu[fDH{ G uH[H@DkH{ DSHH{ HtwvwHC 1[DfUSHHH/dH%(HD$1H} G % =t5HH$H)HE(HD$dH+%(uH[]fDHH@J#f.SH1Cu[fDH{ G u*% =t1[AHG[f.KH{ G fSH1Cu[fDHC([ff.fSHHdH%(HD$1CuHT$dH+%(uWH[H{ G % =t-HH $HS(HH)H9ʺHM@HHH""fSHHdH%(HD$1CuHT$dH+%(uBH[H{ G % =tHH$H9C(HH@!fUSHHH/dH%(HD$1tst6tYHHT$dH+%(uqH[]fH} G % =t-H`H$HHxH](1@H](fHH@H51m f.AW1AVAUATUSHL7AFuH[]A\A]A^A_In IIHӋE  tHz"HMI$Ly@ |ItE%H9qLeJ;IF(HK<A+AEHtt at F+Dt;r+ffHtr<wfDff.Hͪ.SHHtAHHH9t#H H8u@H@H@[@HHt(HHþ @IHHtHH@ HH HHff.fHUHSHHHXHHu[LGMt?H~0HHI|HtwvGwLEHH;]|L(HH[](DH[]fLEff.fAUIATUHSHHHGHWHH9|-LbLHtLHfDAQIHЋсDDt<:t݄u1H[]A\A]A^A_Á@@\LHPHHы@@t(tIE1E1M9wvMG1LgL Lr)t)9(u-L Lr)u׃uL)ID\uҀzHJIL)LϺLL$HH=LL$HIMtrGH} G uux<6% =1HǾHHt@H} G <|f.fD t 1H} G \H.H5O21Ia RfDHzV{H} G ,H51H} HtwvwHE Iff.@AVIAUIATIUHSH0yN1;IHMIHH|$LH4$HLHsIHHh D`$IEH ;aHD$dH+%( H(L[]A\A]A^A_@YN1;IHMRIMHuSDHD$`ALjfHHoHPHT$1LB@E16"@MMIH h71E1HH5*`HHHu HHuAWAVIAUIATIUHHdH%(HD$1HH?HHHt~H9HwADžLHDHI3Ht~HUHB H}LLLHlHT$dH+%(uhH]A\A]A^A_fDHD$dH+%(uDHLLLH]A\A]A^A_f.HH1ff.@AWAVAUEATEUHSHH8H<$Lt$xHt$H$dH%(HT$(1MM>MH8G % =i"Ht$¯HT$M>IHvH1LHHgI >Mo Ht$ H6LLHHMo HMtIG MʼnKHD$(dH+%(H8L[]A\A]A^A_f.$EE1Ex}ILmAAEDڴE1DH8G % =*"Ht$蛮HT$IHvH1L迵H}#LH1IHtMHt$ HH|$HIH4$LLHIHUHLL` 趯ʼn=IHHt$ DHIHHMH|$H蓻H4$LLH!IHUHHHh {fDHHPHT$LgHHPHT$LgT$pLDHRA0D LKMH 1E1HiH57zDHo.H(Hm.H(HAh.H(Ls{IkICH$gL $IS/ff.@AVAUATUHHHIDžMtA<$u-2HAƅx{L%իLJIHttLH5Nc.1LHaIHt9HHHh zŃt&GHL]A\A]A^fDE1HL]A\A]A^L%]DLIHnL%]DLIHPDZAUATUSHdH%(HD$1HH?HHd|HH}H9HIHtJL+HH1H5b.H)HHtaHLL` BHEL(fE1HD$dH+%(u2HL[]A\A]HH}HdDL+fDATHHt2H{a.fHHtH9PuL` LA\1艶IHtH艫DžxLA\HHtMUH a.HHHHt%H9PuH9p uH1Džy H]f]虺fDHH=Q1f.SHdH%(HD$1tB@t$Ht$HDHT$dH+%(uH[f.@HdH%(HD$1@t$Ht$4HT$dH+%(uHJf.ATIHUHH7HLHH]A\ÐU1H1H]fDATIHUHHdH%(HD$81Ht$ oD$ HBHD$0òHŋ@ % =tQHt$"HϧHT$HLOuv?uHT$8dH+%(u=HH]A\fHEHuHPHT$DHHD${HD$ff.@HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$HT$dH+%(uH[ff.HtSHHt YC[fff.@AUATUSHdH%(HD$1H)L'HAD$Il$ HIE  HHH$HƋE IL$(1H9} H)LH9HFHHI\$(HHT$dH+%(H[]A\A]AD$cH U1뿐HUHuHRH$H$ sHt;E % =t\H1HH$H51WfH5Y,1mH$fDHEHuHPH$vfDAWAVE1AUATUSHHHHIBIIHfDL耼HH~\HH9HtYLH)LHIIH2I4.HLHu&L1$HHHtL_tMM)HL[]A\A]A^A_ÀBL 藺DLH)%LHIIHI41LCff.Ht'HHtH@HtH@XHt#H HHDHdH%(HD$1Ht$iHu#D$HT$dH+%(uHf@HtHHtHx0t郤1DH(HT$Ht$H|$HT$Ht$H|$H(HAVAUIATIUHHcI9HINMHHHMXE1HL]A\A]A^fDHLIHxI9~LHtLH)UHyMuIfDHLHL]A\A]A^'AVAUATUSHGHHHIE1B% =uUDj HKulH^.uGHHD虮IHxuHtIH [L]A\A]A^fLؠtI tILHff.@AVAUATUSHGHueHIHHDh {uLH].u'HHDIHx[L]A\A]A^DL(tI tILH[L]A\A]A^DAWAVAUATUSHHL7AFMtzIn IV0H9RI@IIV0I9L)LLRHu L#tHHI)AHtIn Mn8f.In E1In(In0H`Mt7I<$t0L8HAIcEHEH[]A\A]A^A_DHIc[]A\A]A^A_fDI)E1In if[IV8HIF0HH)HIv8I;F(TMt"I>t1L蔫ADžt!IV8I+n0HIV81cE1E1L#LqIn IF8@HHPPHt  H@PЩAVAUATIUSH)I$@HC HHC(HC0H9H;/Hu?HS@Hs0HOHHHk Hk(I$H1[]A\A]A^DHȵIH~hHHk@H{ HII9INHLI4.HH))+HC H8LHC 'DH蠝HLcMt5tDMsI$LHH6@ HH?Hu@H耵tI$HH@<H=V/HHt|HcT/L,^/HE HrH\/H H94HHtz0tB1uz u B$DJ fHH9~1AAAHDAH X/HDfH]/D`AWAVAUATUSHH_]/L5S/L-U/L%W/IIUI $HhHtrH9~mH5W[/HH9^L=fDHI9]>HDHtH0t@1uLL1HI9]~DII $L-\/HE1AuH9~5HDHtP0tH1u x$t7HI9$|1ҍFDAEHL[]A\A]A^A_Dp$uHxuH8&ut1LHXH̺AuIATUSHQ/HHtuHZ/HL@L9HHL@HL9L$L@u^HR/HHHH9|HuHQ/H9(~HH([]A\HBH\/HHQ/H9(~H:Htwvw۹HLzLHH=[1,LH=*1ff.HP/HHteHHrY/HHpH9uOHtXHHt$HN/HH9tP t P H%X/H98~HH8H@H=1H=1{ff.AWAVAUATUSHL$ HHBHIHLHH1MyLkHAWM蟛H;ZYAQH0H$E1ɋP O@1MtEHH}1RHtQDVLGH IL93|HKDHtx0uD$ tOE1MtEHD}HL1IL93}H[]A\A]A^A_MtEHH}1VLQDRH蹚H mAUATAUHSHHG %=tw t2IHtHHI觵HL[]A\A]fHu{膹ID} tat=HELHp HL[]A\A]DBwHtDIuHL1脱HL[]A\A]LHMDA\Ɓ ĀHA H@HHp H@HH@1uHFH@N<=OeLBXff.fAUATIUHcSHHL/L9~7HOHH1I=HL)HH=uFHCH1J|躗HCHH8Htwv"wL H[]A\A]fDHD$薳HD$ff.@AWHcAVIIAUATUSH(HoH;H|tH([]A\A]A^A_DLJ/M"MI$IHWO/HH I$ID$HK/H@XH0HH=K/HWXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ AGHHDLXHEHHXHEH{HLHHH=I,$LL$HL$L\$HL\$HL$LL$HE II$LI/HP IT$HXI$HXIL,HH9Xx0Np1@&I*@x%HHEIHM/HHEHEID$J,(HqIHHIHM/HH HHCH'J/H@XHHH5J/LHVXLDHHHH@HH@HH@HH@ C HC% @C ID$HC % C H([]A\A]A^A_Zf.Ht#I,ۃEID$J,(HpI*HHEIHvL/HHELE@I,ۀ&tHuI,ۀ} u@uHUR\@@pHxe\ LL$HL$L\$ L\$HL$ILG/LL$HfKIhHwHEIHK/HH HEHEHHH/H@`HwHH=1H/HW`HEHHEH@HEH@HEH@U %_E  E HEH@HEQ@( 輫LL$HL$L\$LLL$HL$IL\$LE/H*@( \-HHHEIHQJ/HH HEHEHF/H@XHoHH=F/HWXHEHHEH@HEH@HEH@HEH@ E HE% @E DLL$HL$L\$'LL$HL$IL\$LD/HHLL$HL$L\$E LL$IHL$L\$LD/LL$HL$L\$謠LL$HL$IL\$LLD/H_ LL$HL$L\$豩LL$HL$IL\$LD/A( LL$HL$L\$iLL$HL$IL\$LC/ILL$HL$L\$LL$HL$IL\$LC/HATSH(HxH{IHH=u@~I\$ID$LI$AD$ ID$H[A\1H97|HGHff.ATUHH~3SHHHHx2@(IH8(AD2LA\$0[]A\DS8H蹱H@(HB@1C1 tHSHPH1 S0P0[fDo(tDATUHHH;=C/H;=L/HHtwwH}HtwwE1u^ t LeA,$tHH]A\PI|$HtwvwI|$ Htwv`wLfDHEHxE1DE(H]A\f軩`fD諩5衩蚩AUATIUHSHHH9w|[HH9}&HH)HH=u\HKH1H|(H+HCL,I}Ht/MeHL[]A\A]DHOHW1IF@+ff.AWAVAUATUSH@L5H/L=y@/rIH(@/HH<HH @/HHD/HL%}A/HH HCID$XH HIT$XHHHH@HH@HH@HH@ C HCH% @HT$C 譮HT$HB HHP HSH@HH@H7?/H(H;HEH ?/HHC/HH HEHEID$XH>HIT$XHEHHEH@HEH@HEH@HEH@ E HE% @E HCH(E % E I/E 苶IEH(IEHXH=/HSIHfH;/1HAE HH/1HH蓳)IEH(IEHXH=/HSII/HH+B/HHM@/HH'E/HH=/HHF/HL[]A\A]A^A_fDL5E/I>bL==/"LkH=D/蟭H==/蓭H=A/臭H=?/{H=,E/oH=0F/蓯H=F/~f+HH( L( ,AWAVAUATIUHSHxHt$H$HL$dH%(HD$h1H5HEI$@\%B\I$H\@HE@]Lh@PI$Lh@HE@]"I$B]tHz8Ht HE@]4H@8H@HU1I $B]tHB8HA8I$H\HELHp HE@\H@0Ht H@HEH@0I$HB0HUI$HR(HP(HUI$RXPXHEE 8Hxt11LH袚HEP\׃|$HLpHMIvHHvH{L;H|$(H~H6H|$0H~H|$H<$HFHLch`MLD许H=g/HHLQIJ 0H0L4I9|M,MtEE0E 1I}uAE1HL$@Ht6AU H Ht)AH$HtHp`MMHsHmsH5tA9&HE1贃Le8/IIE&PH8/H@%HT HHH)=/HHHAAE1I T$HLd$8Hl$ tdH|$|$OLl$(H\$DI9|3IDH;B/H tHtP1uH8&3HuH|$uAD$gI $Y\t[HA(Hu HHtP ff uHQHHrHVHtHxHRL,Mt A}Y\fDHD$hdH+%( HxL[]A\A]A^A_f.HPHuL萞E t AL$ HEHp8LMLLpLۮLLH-I}DH@PAVH$Hp\@ HpHHt 9Vֿ1[H$H<$ AnI}HLA ICL5/IH^f.I$H@0HB0HUI$HR(HP(I$@\MH@(H@@7D L{H|$ Hs5/HHL$HHHH :/HHD$H6/H HHxHC`HVHH|$HS`HHHH@HH@HH@W %_G HL$ A HH@H4>/HAH8HH8HS7/H;8dH3/HL$HH I HD$0H|$Ld$@Hl$8Lt$(HHD$ fDHl$ H\$E1I9|3IH;>/L,AHA tP1uH8&txHHuEuD$HLd$@Hl$8Ll$(H\$I9|3IDH Ht!H;:>/tP1uH8&HuDtIJ(H@\@oHEDT$OHH@PHD$`H9D$8H|$E1E1Ht$` L2/DT$OHHHIHL$H}J4(iH|$E1HL2/$M+IE@ME艥l$HLe2/E@C,HT$@뒃ILH4HD$01HeL./IHHHL$P/HL$PL./IA H C Lw./p3$\p3$Xp3$Tp3$Pp3$Lp3$Hp3$Dp3$@p3$<p3$8p3$4p 3$0p 3$,p 3$(p 3$$p 3$ p3$p3$p3$p3$p3$ p3$p3$@3T$ T$PT$PLHA@]tIx8HtHD$X裬HL$XT$PLAE0I}HL$XLD$P)HHcaHL$XLD$PIL,/I@8HH\HH\ LD$XHL$P蛒LD$XHL$PIL,/U&L,/IH ILZ,/LI,/HD$F( LD$XHL$P LD$XHL$PIL,/蔈L+/IHeL賔QL+/HHc։HHH8AH=@5/H)HLHOLOHH38IH HL1IHIHI L1MHILHHL1L1L3@I H9uDIwYH=iHcH>FH0H FH(H FH H FHH FHH FHH H LHIH1H LHL1I<9H HH1HHH1HH IHH@H1H1LHLH HH1HH1H HHHHH1H1H HH H1H HHHHH1HHH1HHHH1H H H H1H4HHH1HH1HH1H H1H1HH 1o_H$H@HHxHt 111wPH=d1AWAVAAUATUSH(L-D2/Hu)/ImHHuH9H3/8EH)/HLxLD%D$H0/L IJM9|KHtH8uHEL;`HEHHCIm뱐EtH )/HH5HHH-/HHMeHCI$It$HPHjH9H;hHhH,H]IEHLbDH(/L fHy(/HHH3H0H-/HHHCHuHEL;f~_L;f}LfH,H]CD$Ht//L IED s H '/H@HH(L[]A\A]A^A_ÐH,H}HtwwLHHT$LD$賋HEHuHT$LD$W@HT$LD$蹃HT$LD$H H'/H(/LH8ǜEH'/AAEHL,It$I$UfDH,H}HFwv0w3@LD$VLD$H:H=ja1藣AVA1AUATIUHSH 谛IMtK1AD$LcHt]K1HkEAu3H-&/HLH}轛{0vHELh[L]A\A]A^H%/HH8N@AtK1ff.AWAAVAUATUSHHHL$IIMHAtvHT$LDHIƸHE H(/H8uL0H-/L0MtAE<@+<%C<&HHL[]A\A]A^A_fHH_%/HHHT$H?YqDHT$D$0Hc)/LZLL9Ll$ MLd$(ILt$8MD|$4@HL9KIlHtD}0AT$0A8uDU1Au΃} t}$uH}I4$DT$H|$ӚH|$DT$uDL$0MHELLl$ Ld$(D|$4Lt$8Et HyAtA tH|#/HQHH9By$Ht$0H&HEH !?&EHsHEHruL9tLHLT$裖LT$uAF1gAF tAN$at$099@Ɖ !9GׄtHD$ L0AF1 t D$8 EIMQ\€@HD$(HL$HL$Ht"Ht$ HHzHHD$HdH+%(;HXL[]A\A]A^A_f.H|$(D\$4IEHHPHH|$P\DD@XAL׃ DEHHt$Lt$0DAVt$0H HH.I>G1 tHGL`H+/L0M9VIEE1Hx0@^@CM:襇H /IH/LHHD$H&/H(IGL=/HH@HH &/HH@IHD$ Hp1HHHP}I~IHD$AF AF$HD$ HL$L0AF$H/HL$HHC&/H(HtHmI/?Ld$(FfDL$09|+D$0%HD$ L0AF1 D HE1A} :Ht$@AHt$%@Ld$(HL$ JH@$t)yfDMuI~0AN\%=H|$(tAF\{IcF`IOHHҺHDJHHL$H@JH@IE@`t D$8H@1LLT$H VHVD@0A9&HEѹH5X1gLT$HD$HHtA<@<%a<&wH/HHWHHH /HHHCH8%/HHyH8H_/H;8H/HHK HD$H1Hy0@E1@}L|$ HEFX1INPHLIt$AWt$0DL$\IH @J@1T$<LT$LT$A:&MIH5UH#UHEH5X1辀MuLT$D$<@tL$<,L DB0LT$LTHTA9&LELIE@\t9A^ IEH\ ΁tW@A} tHD$HHtBH)"/LH8~A^ I@9fDuH AHHb/HHHHH/HH-/HH HCHEXHDHHUXHHHH@HH@HH@HH@ C HC% @C H@"/HHyH8Hg/H98qHH/HHHHH1/HH-/HH HCHE`HHHU`HHHH@HH@HH@S %_C u C HH@HC&H C Ӻ( T}sHm .}MsHAv0I> ʙH=TH1YH=T1Iw0H? 蘙LLH=TH1!\ff.AVAUATUSH dH%(HD$1H/H HHA1IHD$HPHD$ PH /jDH IHuyA>&HHH@HH@HL`LhMoItbK\HtC0H9uC1uH{tH;L9tHL诌uÃ{ uDHD$dH+%(u'H L[]A\A]A^I׉H=S$@ATAUHHuHDHH]A\DATAHdH%(HD$G % = t6HwH4$HD蚎HT$dH+%(uHA\HHHpH4$zf.AUATASHH='Pp1DICLHIH;/H8{Hd/HLH8{HHxPtH\HHxPwvwL[A\A]f.+}fAU1ATI1U軉H=S'HoLILHIH/H8ԉLwH/LH]A\H8A]{fH=/AVAUATUS8u H/tXH/H0HtIHHA\t A\H A\@A\HHPPHtH H9Hy0u A\@tL%/H-/I$H}HHpH97cI$UHEI$HpHH@H9H-/H^@HUHHtCJ tHH+=/HHv(H;/tuH<G1u J @HH<uH`/HfA\H/HHHHHX/HL-/HH HCIEXHH1IUXHHHHI<$H@HH@HH@HH@ C HC% @C xC % C I$HBHE[]A\A]A^HEI$H-y/LhHHXHqHELH8HtOG tHH+>/HHv6H;=9/t-ITH Ht z0t9&twv[wHHXI|L4uH/IDw1衆@H-/yHEL9mHU( mveo tDUHLEHEfHHEI|HuHyL1H](cfAWAVAUATIUSH(HH{@C\HtHC@!H{0{`L-/I}H/IEHC]t)HC0PHH)HxHGH HHGH{0yHC0HC(Nt @HC0Ad$ ]L_C\u(ĀH{8HtkC\HC8C\LkHMH /IE:HHHLKPDSXH*LrLAHDHIHtHHt:&uHxMHG f%f=t-H /%HH5CD1HsDþqHHIH=CHt3A f%f=w%f=vgfRf%f wHcH>@1Ap#ÐA"<tuBAp#f.A"<t1A#@Ef.ft fhtfuH gAWAVAUATUSHhL$UHH|$8Ht$(HD$@H/CHcHT$ D$PD$D$VHD$HD$0HBHD$0>E1ҋD$PAtHD$8H|$D$VH@HGHD$Ll$ E1E1H\$(E1E11HD$fDE11D9d$t&C f%f{f 8fC f%u HC f%f=@f=@@t$t"S H= /H5H94Df=f=ZS H=/H50H94HE1EDd$I@B LAD)AHI Ѓ@~(L$PtH|$Ht$LJAf,wDOcM>Af=of=t f=B"tGHB(H9tuHt9Hf,f="f=t f=I9t$IB!HRL9HDʨ@tH`I9u[D]A\A]A^A_Z ft fuHmf=t f=;HB(@ f%ftAȀH9uB"tA@lf=t f=HB(@ f%fuʋA@uDPDLR(ER fAfAKrH99A H~.LRHH@NиAZ,tH.@3AB,1AƒAz#E A xf=t~f=tff=t`L7.%EA@uiAt B#ADDOcM>AE1f=cHB(E /B#t(B"@tVHB0AȀA:AA B"B#H.L@AB#9H.LRHH@NиAZ,OH%.@uAB,39ظAD#AWfAVAUIATUSH DW dH%(H$1)$D)$f%)$f%fC5D$>IHD$D$<fELl$(HD$HD$ f fCL$ME11D$?E111HD$LPEuWIO(A!@HyHEg#AG"LAA@DDI>IEW fAfACtH H>HL)HHHLfA~HEHHE1tHzfDw"@@t$>G#@,H_(H\$C!@FzLKEQ Dff[ D$>@f\$LO(AA!@IqHt$H^ f\$Ht$HHHHYAU ff%tIH|$ u|$<u:H|$H„tH|$ tAQ ffC HLHD$XMIHD$HL9C H\$@1Ll$`Dl$?Lt$hME1LL$P II9SI>HtG Et % =1Iv 6IVIIEuHIL HHIH L ׃H<H)H9Ht1HHH?H֨uHxfHWHHL!IH8HI9sIQHx H)MQHI9HHBHI9vf8HHI9uHHHPIVHG@11H|$0fH|$0G D1@Ll$`LL$PLd$XD$`Lt$hH\$HH\$@Ht$XHCAHD$pHHt$hLEHH|$HHHDH<@LL$@*BLHD$0IB|$`LL$@IH$H$I@H9g MLfHHH9%uPH%tHHL)IHWDH|$(ID$<HD$D$>HD$HD$ VfDHD$ IQ(B!@rHJLL$LL$(DQ L$>IDfEfHD$0H@@L@@L9sIH\$PLLM)Hl$@ILd$xIL$JD=I3fLeL4lHHLJ4 HIDH3HL9HuHuHCHff@ f@@ufeLL$`D$XDD$PHT$HL$@LT$04LL$`D$XDD$PHT$HL$@LT$0Hl$@H\$PE1MLd$xL$Ll$PHEH$LL$MHD$@L$KHM9$MH9E1AG!@tMwHH;\$@MBHH9L9uAD$ f%fCtHD$(Lp(M9MDAF!@I:Ld$(L9u1ɺLLL$U11LHHD$xsUMLD$xL$HD$PMIH;=LLT$x+?LT$x&IFHnL9eIRfH9Mt$(H1ɺLLL$T11LHHD$xTMLD$xL$HD$PIH9RMIHD$PfDH1ɺLLL$MbT11LHHD$xNTLD$xL$HD$PI@IHE1{H$L$L$Ht$01|$?HH\$hLfHH^ HEIDH|$HHFHVH|$tNL9l$LL$(H|$1SLL$(H11HLLL$(SMLL$(LDH|$AE f%f%MI1ɺLL9SHL$11L(S|$<@tOL1ɺLRHHuAE"D H\$0AE"D$>AE#AE f%DfAE H.H I]0IE<[H|$HC(1|$`rHt$0HF01AE#HH\$0HC8L)HMq(LL$(My0L0<1AF!@LL$(tI~LL$(HI9H@IEHFuAG!@KkI_1ɺLH_PLt$L1LLJPHIMH\$C#H߈D$< D$>D$>HCIEHC19H|$Ht+1ɺ1LL$OIu(HL$1LOLL$H}ML9H|$LOLL$(H1ɺLLL$~O11LHHD$xjOLD$xML$MDHCD$`AHD$pHD$hsHD$PMI{HHE1E1N1Iq0V ff H|$ HOH9N Iq(V ff H9N@H|$XHH@AD$ IDD$?HD$HE!@HEH1x"@uH@!@ufH9upHD$XL$L$> H$LH$HD$HH$H$D$?H$$D$`HD$H@HvEQ xI$It$H@H$IRLLWff.ATL% UHSHC f%f=w[f='fEf!H{HHt\S"t\@H{(HtOHC f%f=vf=f=f=uS"@uHS"uDH9t C!HH[@tHM"΃@u fvѐf%f H}L$IHHDt$ ExBl$(H.AfDA)HLd@I<$L~DA9uHD$hdH+%(Hx[]A\A]A^A_>E"<RIHB0f@ ufHHB0f@ t|$ D$ D$(D$ H0ȃ)HHT@U ffDMwI9+L$IHmHEH-Hw H.H(e!HEM{Ie!H@fžff>tIcTL>fDH}W ffffff O ffL'MH}01HT$8L\$HN.D$8H}(HT$<D$<yL\$tt ^|$<e#E"<lU f~f}fDIH$HmqG#E#HGHEHG.H<$H$H(fE BL$H$e!I+@u#V4H}W HfffA "2fW"Ⳁ"]O#ʃ0CH7V ff.f!A fIHB0f@ uHHB0f@ tHEHt.u @P 1ft fHHEHuڋD$ D$ D$(D$ I7Ѓ)HV0HHT@M!U fHH$H @ fD$f%f% HCH9G H4$E"^"M#ڈ$H ЃE"HGHEHGHHE,H,HEIH$H*Dt$ t$ T$(T$ f%ʃ)HM0HcHL@fDU"fDt$  t$ T$(T$ f%Hu0ʃ)HN0HcHL@`f.}#FH.H:HR\ -€t!H .9H . GHu.HXE H}f%fE Hg.H@(M"H](HEf.HL\$BL\$H L\$LHU L\$fvATUHSHdH%(HD$1Fu!HHvH{(H4$/fC~$L%M/HcI$H4Ht-H:HD$dH+%(H1[]A\Ði2HtSHCI$EH,؁e fDG % =tAH"H4$HWH5H:f.HHHpH4$WDAWAVAUATUHSHH8Ln(dH%(H$(HFHD$A}_+DeEE4Hl$ L$H7NHDBLH1o9jPLT HH]BHH=VH7/EL=/McN,ILH(H9CH /HC L)%C M}MpE1 EHtuuH$(dH+%(+H81[]A\A]A^A_@Ht.[fA>DEFA:fA~UL-A~T"fDH/HLH8HtwJwHIJ1DRH7H/JIGNO fA~REEDQ-HLsLhLl$H;-I/HL6HL>UH1SHH9sHH[]HdH%(HD$G % =t3H"~H4$H(HT$dH+%(uHDHHHpH4$>fUH,H]Hg(AWLcAVAUATUSHH-/HJ/|$ L$$L#dH%(H$1H-/HD$@HHD$H/HHD$H&/D$ HEJ9E1ɹ$LIH5$:Ic~9E1ɹ$LIH5K9Ic~c9E1ɹ$LIH59Ic~;9E1ɹ$LIH5917AvHHD$0d$LD$0E1L$H5s9Ic~8E1ɹ$LIH5$K9I~"EE1ɹ$LIH5XQ#9I~8E1ɹ$LIH58H/L\$8HHD$0L)HHD$(LMcL\$(ICFHL\$(ICM5DHEHx ?MtAv3Av|$$HdF@HT$@HtNHBH@8HHDHHH H/JHt/H51MH>/\$ H/JH51HT$@HuHH8@]uHtHAH@8HHDHHH l@HEHIH@HH2HE80%fL18H@H8f.H/1J<^=IfD1Ҿ Ot$ L21Lp)L+ff. w' HsH/H~HH9tF@H/uH/HHtH/Hcwf.111U.PxH=1>11$11s$AWAVAAUATUSH8L=Y/dH%(H$(Ha/Ld$ L$@AHADIt0LHD$D$H|$ Z0H|$G % =tV1HH=`D+fD$LfD11Do,(f.Hw%1D111A,15,D111!,ATIUSLFHn(ItHLAHHe/LHE11H{HK8RLH11HCHߏ[1]A\USHHH-/M8HVH}HHv(Ht3E1E11V HEHHSHt2Hs(11{H1[]f1E11HEHHSHuH{(111GH1[]ff.SH|/H{H6HCH1CP[UHE11SHHHH /VHpBsH83@u2HS(HP(HS HtBHHP H[]fHx HtŋwvwHD$f&HD$ff.@S^G t!HH@ HC/Hڸ[1)8HH/VH4D1Hf.AWIAVIAUATUHSHHDD$DL$ g1HHL`Mc\$Ml$A$LGDHt+PAHAjL1#;_AXHuA$IcL$ED PA LH/j1AH8:AYAZHnH8D$1LADLPjDD$H|$:H|$Y^HHx2IcL$A$1LADED PH/jAH8r:X1ZH HH[]A\A]A^A_ff.UHA SHHFNHVPjDF1H? :ZYHt H9] tHH[]fDHHUAVAUIATUHSL'HHG MtGH9] ECKA1HSDCLPAU9ZYHx[L]A\A]A^H9H(/L M$I$HHƿ/HL5/I$H ID$IF`HHIV`I$HI$H@I$H@I$H@AT$ %_AD$ | AD$ I$H@I$ID$H@HULeHHu HLeH9] fDLmHUL8>AD$ rfD3I dKHSH=s6HHA/H1j1A E1jH87ZYHt HHH@ Hff.@USHH7KHS1HŋCDCAPH/UH8b7ZYHtH[]Ëuv uKHSH='1s5Hd!fSHH (HH5.HHB@HHHp [AWAVAUATUSHX4$dH%(HD$HHHP HH$3MH,H}Ht׋wwLL$3AD$ L$HHL$ %HL$ HD$ ;HD$ CHLIuIU^ L$L$L$ L$IL$*)L$HyHH=1(+ff.AWHAVAUATIUSHHHt$HT$xHL$pLD$hdH%(H$1H@HHx x<D$ HHl$pj1E1jH|$ HA+L5/A[HH[IVL9@H9@@@|$ Iv0H|$pH9IDHPHH@@HD$H HL$MHA(Ht@LA(LE1ɹ$HHD$H8H w wHD$HH@HT$pB HHX H @<  HHD$(H|$hLl$hE1G <  AW1Lt$@L$H\$0Dt$IlLd$8"LIH/H8HtjADE11jIu1?*AYAZ$H|$pLpEu|HT$p1BtHHB HtR< HH9D$(tNHD$Hx(HtHHx Hש/jE11jIuA@1H8A)HD$@_AXII99 I}G % =HH@H$LgD$ HoD$L5/H|$hLl$h1ҋG < Ld$L$Il6D"L3H$HH|$xD;|I9t6I}G A% IA =uHHPH$HwLd$L|$xj1jH|$ LAE1(ZIV0^HHH9L9IvH|$xH9IDHPD$ ukHLh@Ma IE(MHt@ME(LE1ɹ$LI}Hw wIEIEH|$x|$HT$pH HD$hHl$hAx uHHhHRDz|$uTA_ENH/j11jHuE1E1H8Lm^'ZYHH@HALHH%DH1vHH1H[ H$HtHLj@MIE(MHt@ME(LE1ɹ$H$=I}Ht,w wIEIE]DI}HKwwIE,@HIZ|$Ll$pMtIEE1HxHD$HT$xHL2I~INLl$1Ld$ HRHcH$L,MtIEx tFMmMuIN9HT$xLADfDHL &Iċ$zPHcA<:uHA<:uH|$t8IE1AHcHHPDD PjH|$A %^_HCIEH@H@ HD$H)HD$H9D$xH|$h U $IHH5υIUHcBD <Ɂ$LLPHcHT$Ht$M1H|$ wD$ HD@H$dH+%(J HĘ[]A\A]A^A_+}fDA<$:H|$HD$xHT$pAHt|$B,HHB Hv,R<HHcHHPA 1DD PHZ/jAH8D#A]HXHt1H]+HLoH@LƒoI}G AHD$]H/L(MIEH /HHE/HH IEIEH/HD$H@`HHHL$HQ`IEHIEH@IEH@IEH@AU %_AE Q AE IEH@Hh/IEHHxHD$ HM/H8H{/H;8gH/HL,HD$AM HPLl$ E1Ld$(Lt$0HL$pIcL$HIH,Ht HEx HmHuHD$HPAA9~Ll$ Ld$(XHD$p11E1D$HD$xHHT$pHD$HxH2w8wHD$H@fLH!HË$PHcҀ<:<H<:-HEH@L` L9d$pH|$xHtQHEA 1HcHHPDD PjAz AZA[Ht HHtx uH@H@ HD$8Hu7MAD$I$Hx x<HD$8H|$h Y!$IHH5GHUHcBD <Ɂ$HLPHcHT$8Ht$MLH|$(HEA$1HcHHPDD Pt$8H|$0AMAXAY;:mHD$x11E1I}H0wJwIEL$AE ]HD$pHD$x1E1rIH\$(HCHD$(}'HB@ % ɁDt$H\$0ALd$8Lt$@HD$xE1H$LAE11|AHDA[ 1BWIH5~H+cHLoH@AǃI}G HH@dHH@HD$(HGHD$0H/L8M-IHH/HH s/IH IGHAXH"HHQXIHIH@IH@IH@IH@ AG IG% @AG H/HHyH8H/H;8H/HLIA$HHH5|HLH:Htw<wHQR Ɂ.HLLD$HHL$@IWI7LD$HHL$@ALt$0\$8H@H\$xHYL1>$H5|H1&HH@HD$@HGHD$HHV/L0MIH @/HH/HH IIFHD$H@XHHHL$HQXIHIH@IH@IH@IH@ AF IF% @AF H(/HHxHD$PH/H8HC/H;8<H˚/HL4HD$@AN HL$HLd$PD|$HHDIHD$@HH5zHUHcBD <Ɂ$HLPHcIIFHqHVLH9}]H;QHQLL8L;d$@I<$Ii$IHH5yHLH8HtwwHB@ % Ɂ.HLLD$`HT$X'IFILD$`HT$XAD|$HLd$PHT$@hHT$@NIHB@ % ɁA( HL$8&HL$8WH& HT$pA( HIHHD$XHD$XlDAWAVAUATUSH(GjHIHX@HHC H>1LIH.H9C AFIHx H@<H?IHI$MD$H@Ht%I8LI$MD$H@ILHK/LL(M IUHH/HL /IEH IEIAXHHIQXIEHIEH@IEH@IEH@IEH@ AE IE% @AE H/HHzH8HD/H;8H̖/LD$HL$HL,IELAM I$HrHHpWIEHL$LD$L8IEHPI9s'fHEHHHt@HBH9wMHk(Ht4H(L[]A\A]A^A_DAw;AwHk(HuH/L(MIUHHR/HL /IEH IEIA`HdHIQ`IEHIEH@IEH@IEH@AU %_AE S AE IEH@IEI$M|$H@HcI HL$AFt+IHj HtR<HUHH@HH/L;|$HD$Lps)I7j1AAVE11LIXZL9|$wHcMEHU1ALDD PHD$HhU{$E1IH5! LAM Lk(Y^f H|kHD=DL$LAE HmLH( LL$LD$HL$LL$LD$HL$9fLD$HL$aLD$HL$I LL$LL$yDI=LD$HL$LD$HL$H,HUH=H=1|ff.AWAVAUATUSHxH|$0dH%(HD$h1GuH=15DHHB HtJ<L0IFHD$8HD$HLHc@HD$@HB@HD$H;HD$H8H wwHD$HH@H\$HC(HD$ HtHHC(HD$ HD$HT$8A 1L=ʐ/@IcNADD PjI?AA[[HHSH|$@ H(HGE1E1 H5HHHl/HD$HxHtHD$0H H`PHD$@@H.HHD$Ld$`H1.HH1HHD$`HtHLj@MI}HwwIEIEuAEI}HtHD$`@u HHME(MtUH|$E1ɹ$LIE(6fDI}Htw~wIEvHQ/L@Lt$PH|$0AHPHH@HZH-/Ll$8Ld.@IcNALA$1ED PUA}XZL9tFH3j1E1jI?1AHVY^Hx w H<$lH<$fDH|$ tHD$ HHxHD$hdH+%(Hx[]A\A]A^A_fHhI7HH|$@HLt$P@H|$1HHPH@1LrHD$LLt$(HPHHZH@AFt-IHi Ht!I<vHMHxHfDL-/LeLt/HcMEA$L1ED PAUA _AXL9tTH3jAE1jI?11H AYAZHx w H<$H<$fL-/fIEH9D$HD$HHxHD$(HcUHuDEHDLH@@AHHH(H|$H|$@ HD$1ۃ@@HD$HxH wwHD$H@f.HmHUNIVERSAH\$HH9${LFfHD$hdH+%(zIcFH\$8EHT$@DLHD$Ht$HH|$ HH(HxA[]A\A]A^A_HMHUNIVERSAH\$HH9{LH/HHT$HHHH[/HHD$L%/H HHPID$`HoHHL$IT$`HHHH@HH@HH@Q %_A HT$ B HH@H/HBHHzH8H/H;8H'/HT$HHJ H|$0uHD$&W|vIH=H^H\$H|oI^H\$8_H|$(DD$\DL$XH4$HcUDD$\DL$XH4$2~IH`AD$ LpLHSH= bHHL$(HL$(( L$L$L$L$L$L$L$L$HL$(L$L$(L$HSDAUATUSHGHIHB HR<HHcXLhA L1EDPHH/jAH8HXZHtHmI$H@@HC@I$H@@H@@H tyHtVf/w1f/^Hf/r*\H,H? Hf/wH,fff/wBf/w1f/H f/r*\H,H? Hf/wH,fAWEAVAUATUSHhH.$H|$\$Ht$HT$ HL$(E1Hto1ƁHKL\$0ufA2Cu^M[HTфZHD$H+\$|$QH(LH HhL[]A\A]A^A_L\$HH>HcH>L_HfDDALL/E1 A#A0 jHHHPHAHD$0 HHHHcHD$HQ0 %HHHcHD$HQ0 HHHcHD$HQ0 HHHcHD$HQ0 HHHcHD$HQ0 HHHcHD$HQ0 wzHHHcHD$HQHHL9rBHtHUA+H9vH9WNHHcHHD$HQL9t 0 vAHtHUH|$Lt6HD$AL9r@HHD$L9H0H vHD$H9D$aI90߀EH=t/@֋DDGI ]HI9v3@֍F @HAH=7HF誹H^E1HD$dH+%(H(D[]A\A]A^A_H0H wHHD$L9rAHPHT$L9sPJՁuHPHT$L9tPH0H _HD$HPDHH0H w HT$HL9rAAf.I9"0A@ IE1HD$L9H5s/DDn\HL$-jHAHL$I9f.H|$LcHL$L9eH0H TAHfHIH0H HL$HI9uHHE|HHD$L9fH0 but trI9UfA}ueAHHEH|$L@t uZ D AzHQLL$HL9MIY+HA .>ff.AWAVAUATUHSHH(dH%(HD$H+1-11у߀I݀QuHPH9HHЃE1NHPH9P߀AzHPH9mP߀N]AHPHUA$H9}Hσ@QuHPHUH9]H(dLzAL9LrL9w tIL9A<)uL9A>)LL)z0$HT$LM9rIM9AH0H vtM9s1H o/ IM9tA%D=DtM9>IVH9.H Po/fDHH9%D=DtE1H9HAAE H]@HPH9PE1߀NHPH9P߀FD@$HPAH9w|DHH9s:0t)HHH9tOPH11kHPH9t/H.tnE1#u!HBH9tR:E1HD$dH+%(H(D[]A\A]A^A_HHH9tP1HHPH9tH냐AHPHUAH9H߀ITHPAH9pP߀N`HPH9SP߀ICHPH96P߀T&HPH9P߀Y HPHUHfDE@tH9w@HH9t߀:0tE@f.\HBI9B tZHd/EMtVHD$(dH+%(?H0L[]A\A]A^ÐHe/tfWHt$ H=֘+<HMt;HLL)H)HvY;0uTCY/IHHIIEHIEH@IEA H@IEAH@IEH@ AE % @AE IEL[]A\A]A^DkI#IEIEIEL[]A\A]A^@AU{r;CHcHfDH~HHHDHH) 1HSfDH@ :H@IEH@AU %_AE uu AE IEH@1fTDD4DL蜻VDD4DL|H~@LAE zDyff.HtCHB\t8B\HHB0Ht*PHH)HxHt&HGHt$HHGHz(HufDH[/H8HGHHtDH1eH@HHfATUH-jY/SH7HU/L%)Y/HHHEtI$HyHEH3W/HH=\/LHHS/HH[/HHHE^/[]A\DH-U/D@Eu |$;AD$Dh@HD$ Ht8tINj|$t*Lt$fI>LutIL9uL輬LhLLLH HNjD$IH|P9ADt$LHH7H_LhL3LHHIEALL~HR0H=sHvM0HU08>HHbHګHHH@HD$HH8H|$HJHJ0t HU0H$dH+%(HD[]A\A]A^A_f.HD$(HTDH1U0H=rDE~yL= HHHHHH@HL=ضLEbfL=\e@D$;H8D$0)D$;D$HI0fDD\$ED$;D$@L$T$H-IO0HEHt x 1H1H5v|$t)HEHt x HH5q1D$HT$L%pL-qMHL3Mt&A>CH5nLL=p'MEHEHt x HLLL1FHCH;\$HML3MuH-IN0HEHt x 1HH5_u1HEHt x H1H5\uL-oHD$0HLEHۃ"HHEEAA"Ht x HALD1H5pL-]o`HD$(HLEHۃ"HHEEAA"Ht x QHALD1H5oHm/L%nL-oCH5\hLеH2jHjHDIH-2H0E1E1L=iut$1H觨H$IH;H0H9uL=iMtqf.H|$p QLt$pA~L=ioDAT1UHHHt%HYL`L-HLHHHHH]A\f.ғf1DE11ɺt1ff.fbf鲯fŠf1鰊1P1逤1镋D鲨f题f钘f"ffG tHGÐ1@钨fUH1̔E % =tH1]͉DHE]fU1HLE % =tH1]鍉DHE]f1Ҿofff1EDE11fHjjt$(H(fDE11offf.ff.ºf1鵺DHAE1Q1R1THff.@HE11AR1j#HHHE1ɅQAE11jA1HH@E1QA11jýHff.HIDHcAPHA$AAS1舽HDHILcE1y ALcPA$L1QLHHHIHcE1y AHcj1ALj HHÐHILcE1y ALcڃjLLj1DH0üHff.AHIHcE1y AHcjA@L1j{HfDATSHH>0L MI$HHB0HHy?0I$H ID$HCXH}HHSXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ HL[A\裙I[( Ԣjff.@ATSHH=0L MI$HHA0HHy>0I$H ID$HC`HHHS`I$HI$H@I$H@I$H@AT$ %_AD$ u. AD$ I$H@LID$H[A\@LAD$ f 輡R[IA fҫfO! 龫ff. 颫fH=>0H8鈫1կD ¯f 鲯f颯fATSHH>;0L MI$HH?0HH<0I$HID$HSxHHzHH HH)HCx1HHǂHI$ H=8L!AL$ HH.=0H8&HCH@ Ht@I$HI$H@@<LID$H[A\fD胖I 负H'ff.ff"fffIE11߻ff.@ffH UB0H1 fDH9vDHHFAHwHuH)1HtÀ?u1郕DHH=D0ALDLJ<HtLIt3HD!HH9v HH?H H9ufrf@ދff.Қf那f11CUSHHdH%(HD$1L >0ЉHAA AHcD!AHLGL9w zfIL9toELHLG?AH HwHuBHt I)ILHT$dH+%(umH[]@HtHHHHE1jAZYutHtH11H$IoIfAWAVAUATIUHSH,dH%(HD$1kADLDHVB0B48TAEI4A H=S=0B ?HD!HHMD$L9wDIL9tEHHLF ?AH HwHuRHt M)ILEHT$dH+%(uvH[]A\A]A^A_Ht HEA$fHHHE1jELVZYEuu1HtHEH$Me跦H]60(ÐAUE1ATIUHSHFt AFHH=臹HH70H8HL'AD$ Do%G H50GA#\$ A\$ H[]A\A]ff.@H1ҿ魛ff.fUHFHHt H@ HtHEHHtIEu"H]*f.H}(EtH} HtՋwv0wH]H}(Htwvw諜f蛜fW HW H@Ht[@HHHt5H9t@u W Hyt @W Hyt W HHu`u W ATL%50USI<$H/HtnE H<vHUHzt%E W tQ ЉE H-40KH9CuI4$HcH4H)tEtv5E[]A\fHfDHHe []A\@[H1]A\Jf.AW1AVIAUATUSH(_IH%508ILxM=L<$LME1D$D$}Ht[HHt~{tt|$D$}LD$HLILD$HxCtH(40H0LƁf Et{HL9HHCH+CuH90H@H9u€|$H{(LD$ID$LD$HC(HCEuf.ILxM9t_H30LH,$AHLa Hd|$H(1[]A\A]A^A_fDIMH,$LxM9uHE1f.HH@xtt@uHPHt H:HHu@LLHD$LD$6HD$LD$D$HRL<H60H8HGHHt3L9@Ha20H8Lǁg |$1L$tL$H@HG t% =tD AfD%=uHt HH@HHGG % =t-H"1x1ҿHHzf.Hw1ҿ`UHHSHHT$Ht#G % =ts"Ht$wHT$H~MHfeature_H90u>Xs@w1H ^@Hc4H>HEHx H/0!XPH[]DHHPHGHT$fDHuցx nicoHP p:nievufzalu@HtE HH+/,0HHE qPOtHE@tHH@t1Hj}2H/0 XP/H"x _SUBfx __SHHpos_as_nH9P xame_fxsexpDHHx itwifx sezfH bx lassKH :x efer@|#HHvalbytesH9P MH x c'fH&H fx safDHHeyword_aHP H9H ;Heyword_aH9gfzny VDHBHostderefH9P .fx_q"xqbfHHKH x yref 0H ^HH JHx witcx h@H zfx rydHRHefaliasiH9P >fxng-|@HEH H@HHHE80fHfilehandH3PHp Hareword_H3H H f~le~sx ndirfx ecxttfx ay`Hodule_trHP H9H Hore_deliH9+fzmsiHtkH;-'0f.HignatureHP H9H HmartmatcH9zhHultidimeH9H xnsiofxnaxlqx tate_ fzdefzll}fzue@gzs0SAU1ATIUSHwH-\+0Iŀ}u#HLIELxHuHL[]A\A]A^A_钦fH$0HHH@8H|Hv H@ H+ x-HcHH0HHtoHx8HtfvHW uH@H@ HP(H1[]A\A]A^H0HHt+Hx8Ht"HW H uHHHcoHzH1[]A\A]A^CfHI*^A<$11H薄A$E tILEH}I@,@LH&0HpDD4HHuI@E "E 1H,gH&0H0H2躔H$0HHJHAHHHpPHH"tH$0HHP H@HrH@HeH@zfJH&y6H*$0HH#P H@HH@HHHp@fxHxH0Hc0eHxH11wAąTM H.0HHHx8HHW H uHHHcHIHH(4 H'#0HH P H@HH@HHHp8efHw Ht$uHt$LcH~ G < t#% =W腔I9LHdHb08vH niH]"0HHVP FH@H9H@H,HHpHKdH0HHP H@HH@HHHp cH!0HHJHAHtHHp`HHA8HHDHHp HHw0H3F EH;G ZЗMH)08=E11ɺt1H$jH5e)LAH "0HHc0cH5_)LsH40H0HH0HH9H\|HzHX0Hc0bxSHD#0HH G _W 7轛-HH5(LIH018HbH5(LH5(LxH5(LHn 0H0롄H5e(L蹈vH0Hp@H;5O 0MHH;5!0HFHHP~3H5LWH=@0HpoH00aBH5DL  H0p8sH0H0nH5'LLJH00H0L$LuLHH5}UH00r`BIcH豍HDHI r~2MHMtfDA$HH1I+kM9uLޒHfHHEHxSe GDHA8HHHDHHp H mHH5Xkq@3fDH5%L艆FH0HH|Hp8H}j@H5%LIHqHH00_HY0H0^H0H0qH00^H0H0lHd08xH00@UH}^MHH@ HE0H0q*H5AHzH5^CHzH0H8H08HHfDHF(Ht#HHtHL@HL1H@1ff.fAWAVAUATUHSHHLf(dH%(H$HFtoHD$C H}LHykH089H$dH+%(*H1[]A\A]A^A_fDMtLqeAD$ % =LHt$"bZIċC MHh\C A@%=t 11HxHdC u@LsHLLHXjH08 EEM<DH?H5,1>c DEI1ۃEH|$A<$PATHHM$HD$ HD$L|$L$H$M9w6h$/uNM9tIHt$LpuD$8u1M97LMA:LHLF|$Lp~MI$Md$H@HD$H>H5,8ESH~H~(t1i1HËG % =t!"1UX1Hh1H@Hf.AUATUSHdH%(HD$H-08u(HD$dH+%(H1[]A\A]HLd$ÄHY.f"1WILHLH+h1H`HHtHHnHNj@ % =uLo!HC1Hff.HU08t1DSHXDHH(1H`HHu1[fUSHH(H~(dH%(HD$HFHD$/HtYHuHrequire_H9H|$xE1E11IPjHt$LHT$ eH=BH1DHrequire_H9u_befuf orueuH-0HS tHSz H}HtwwHCH]HD$dH+%(H(1[]_aft f erH-h 0cG % =t!Ht$"rUHHD$DHHH@HD$H}H<1T@;u9}HH=@1莉ff.UH1SHHsHH[]\H0S<t <t91[DHY0HAHHc 0H+H1[H8VfDHXH|1Hv]HHu1[f.SH0H;Htwv<wHH 0H;Htwv wH1[sÐsfH 08t`USHHHtm`H{ G < t@u@H tRHHx(HtGtHHx t xHHIuH5: 0IHHLHMHH5 0H;LH)H0EHcЅ8H0HHD$L)HH9H$H@ H(ICISEH5]0IDH@HH2H9uILE1mL 0Ht IHPIL IHpH IEHH0H8II+HHGHBIH:HHIPLFHNH΃1HHHv 1HHF1ÐHF(1ÐHF(Ht#HPHtHL@HL1H1ff.fvc>H~(Ht#SHzkHC(1HC[fD1ff.fH~y1fSH~(H3kHC(1[SH~(HkHC(1HC[ff.SH~(HjHC(1[ATUSG VHHЃ0f 5w{fJfuHGx fDH{ HG >w\ uHH{ G@qSDtb[1]A\@f0uHGx tH5v@ uHE11E1A@Hs(H{ ju|jSXYuH\<[1]A\DH/HSHHHEH:@HHNwwS<@HGx H5:fHGx H5:H= 1}hDHE@H{(LeG % =t)eHH{ L RSHHp [SH5:{fDSSjH=# 1g@AWAVAUATUHSHHHH~(dH%(HD$81Ht?~wJHHcH>fDH/HHt Hx8Hu@H/8HD$8dH+%(HH1[]A\A]A^A_ vHuH@H@ HP0H/HHtP wH@HtHXHtHHx`gE L+% =XHt$0"H;2IHD$0HxH|$0aHT$0LH%kHIE`HAHChL%/M,$E AE _AU -IEH@ AE t7IEI}HXH@IUHxHB Hھ H)8HuH/;tH]H@;]I<$E11ɺt1mCHI/HH-P H@HH@HHE % =HbHC8H/HHHx8H HE % = HQH/ljH/f"fN4 HH5Y,E H=sdE % =HaH/H/5 <H=7/23HH5XHaHi/zE % =] HZaHQH=1cH!/H;Htw0wE HH/HHP H@HHXHHHxPcE L+% =Ht$0"Hu.IHD$0HxH|$0^HT$0LH_gHIEPH6>HCXMHV/HH:P *H@HHXHE % =H_HHH @E % = HOH1/ljH./f3 fE % = H__ H/%CE % =3 H#_HH/E % =( H^H/ E % =^ HHt$ ",Ll$ HJD-H$HD$(>L5E/IЉT$fHEA%D=DtHD$0HT$(HHHT$HD$Z|D$0D$D$ 1E11fDL|$(MH$HD$( IAHA%D=DtLcMLLTIHT$Ht$LL*ZzHD$09l$VLiE % =Hi]H/XH/H8G2e=DFH5OrTE % =& Ht$0H*Ld$0IL1L2HH/H8 U H Kt%H{H)L)HedL%~/E1IH5E$I$MH@Hx TLkRU Hށ LdE1ɹ$HI$H5IH@Hx \TH$RH(/HH P H@HH@HHE % = H[HC@E H/% Dc8=HJA1ĉC8Ax#@nH4L%5/A$@U HHt$0GLD$0HA$H./HH:HI9OPHaHA$H5@/H>~@HHcȃH;|E1111H3HO8aFH=H1\E DHEX OQH~  #FC:HcQHC L%J/A$U  HYHA$ A$E % =HIH/ljH&/fZfwH/H;x\U 1AHRE H/H;HtwBwHZ5뾋E % =<HXH/HH/HHP H@HHXHE L#% =tHXID$HHHxHvH@HifE %=Ht$ HDH/H,@HD$(y@LUIAL[H /L$Hv/f fHD$(D$vLm1LAHC@E H/HHrJ bHRHUHRHH% H=#H(V{6H{ HcO& HEH@ HEH@ HEH@ ;HEH@ mHEH@ HEH@ HEH@ $HEH@ CHEH@ HEH@ HEDH/mHEHmLhLl$ $M|$B?l$Hc|$L>\1LH SM,$0E % =HTHH!/H;WE HH/:{% =HHt$0"t"H|$0HHH|$0RHT$0HH^[HfHC H@H8WHH5s1,IM(3 HHt$0"!H|$0HHH|$0oQHT$0HHZpH@LK]M,$LHZH HHD$0H HD$0A$H H)HH|3%xIEL` w%wCHUHmLBLD$0HEH@ -HEHX HEHmHx@@HELmL`Ld$01H=ZC}ZL%/E1IH5]$I$MH@Hx JLHU Ht$0 ;gI<$,YPHx(Ht2H3HUHR SHEHmHxHELeH@HD$0L-/Ht$(A HM8LD$(HMJ<12H U H9uIH/H-i/H{@H9HtH;=f/t;A $Hk@QHEHH WHEH@ WHEH@ kE1*HEH@ HELeH@HD$0mH@/H-/H{@H;=/Ht H9to;Hk@HHt$0MA H/HH{@H;=y/HtH;=}/t;HT$0H{@H#HC@HHHQHO@EA $;H511E oF >CHEH@ &H/HH0 CLt4[]A\A]A^fDA>CHLD[D]A\A]A^A~Duf.nxeDDE1xnxdPg&pxwxexnxtDDPE1loxnvxtlxibxnXxuNxeDD<PE1ei xsxt xexnDDxWwH HcH>E1E1xexlxextxe1DDPE1ahhxr^xoTxoJxtDD8E1xc$xcxexpxtDDE1xaxlxuxexsDDE1xnPl!pxaxczxkDDhE1xrTxiJxn@xt6xfDD$PeE1ixnxdxexxGDDPE1ePsxgPr( cw(gxextsDDm@PE1ioPxrFxmPE1eImIxd?xi5xrFDD#f.E1xk xdxixruDDPE1n?oxcxtxlDDfDE1xixvxexnvAl@gH0HJ8pFE1:.BP%@EAlPE1osxtxaxtzDDfPE1hHrxixtxeDDPE1ilcgxn]xtSxlDDAPnE1tYmxa xsxk DDE1xrxixnxtDDPE1lrxexaxkA@pH0HJ8pOE1C7BP%@EA!PE1ltxaxnx2DDE1xexfxexrA/@H0E1HP8с<<{o@P@EA/[fE1xHLxEBxC8xKDD&E1xExGxIxN DDE1xlxsxixf7DDPllahQPmotE1dyxioxrDD]@E1xeLxcDD:E1xs-xeDDE1xoxrDDPiE1rxyA@H0HQ8 t E1AP%EAsf.PiubE1aGxy=A@.HV0HJ8p E1BP%EAE1xexfNDDE1xo@Abxe4xt0DD"PlE1m PE1cgxext>DDE1xaxlxaxrDDPE1auxd~xyDDlE1xa_xnUxd#DDCE1xe6xe,xp+DDE1xi xfxt2DDE1xlxixtDDxextPpsxoxcxkyxnoxaeE1x mXx eDDFDxt7Phs!Peo xcxkE1xoxpx t3DDDE1yPmlE1sPE1rco|xprxehxnDDVDE1xEPeE1i,E1xtDDfDrxexppDDE1txaxt"DDE1rxyxpxtDDfxoxsuxtkxbaxyWP E1a6n>x a4x m*x eDDxdxnxextxexnxtDDf.xoxsxexdxixrDDu@xtgxh]xoSxdIAv@:Hb0E1HP8с<< @PEAvDxlxlxexrDDxsxexixfH51)PE1n t`xuVxrLxnDD:xn/xg%xtxhDD xsxwxrxixtxeDD@PE1mV uxtxdxoxwxn-DDnDxl_xeUxnKxoDD9xm/xo%xpxexnDDfDxnxaxlxlxyAJ@H0HQ8 t E1zAP%EAJdxoWxsMxtCxe9E1xn,x tDDxfxixrxsxt DDfDxoxsxtxexnx tDD@E1xnxdVDDrPi& E1rYE1xnDDDE1xl7xlDD%xyxsDD xsxextKDDxcxaxlDDxexsxsDDxdxexxDDqxigxl]xeDDKxaAxr7xmDD%E1xeDDPerPil oxtxoE1xex nx tDDfDE1xtDDE1xfDDwxomxscxtYxeOxnEE1x t:DD0xs&xh]DDxp xecDDxcxk|DDxnxkDDE1xrDDE1xdgDD@,&E1ɹ$HI H53pWff.ATUHHtDHL`LLHH% HIRHL]A\E1HL]A\fATHUHSH#0L#Lu []A\L!H@L`LLHHf%HH0H}CH5+HuKH0H0HH40HH0H0H0[]A\fH0H0HH10H[]A\D}{cAWHAVH)AUIATUH,@SHHH(E HII9AL=KDE'I I\H=[,1AHD$HtgLHHEH9HT$sNHt$HHt$HT$Ht$IHH)HHI9LCI HLLD$#LD$BH1I9tFDI@LH^;LL1E1HD$HSH1I9uH(L[]A\A]A^A_HH5LL$L$HH5?LLD$DD$LD$L$DHH5?LLD$LD$Lff.@AWAVAUATUSHdH%(H$H0L M+I$HH0HH-r0I$H ID$HE`HHHU`I$HI$H@I$H@I$H@AT$ %_AD$ C 1AD$ I$L-#HD$8H@HHD$0HID$HD$@HHD$PHHD$pHH$HH$HH$HH$HH$HH$HH$HH$HHD$HHD$XHD$`HD$hHD$xHDŽ$(HDŽ$0HDŽ$8HDŽ$@HDŽ$HHDŽ$ HDŽ$HDŽ$HDŽ$PHDŽ$QH$HH$ HH$0HH$@HH$PHH$`HH$pHH$HH$HH$HH$H7H$HD$0HD$HD$pHD$H$HDŽ$SHDŽ$(THDŽ$8UHDŽ$HVHDŽ$XWHDŽ$hXHDŽ$xYHDŽ$ZHDŽ$[HDŽ$\HDŽ$]HDŽ$RHDŽ$HDŽ$HD$ HD$(HHt_HLhLqHLH HH# }C H5HL-H LEH0HL0LtmA>CH5@LHHD HELD$ L|$HLD$LLALD$LLL!fHL$LD$ HLAH$dH+%(HL[]A\A]A^A_@L` AD$ fD}L- f.A~H.fI L fff.AWL=AVAUAATAUHSHH<$ HLD0HD u L E9tDHH=10ID3DH=1LL$LL$DLH $IH=1@AWAVAUATUHSHHt$(T$L$,dH%(H$1H!Hb0HD$HD$|$(Hl$ AD$(E1E1Dt$(HHD$4DJ,HIEuH3HA AII tAuEtHl$Hl$ EuF|$L3H'H$dH+%(HĨL[]A\A]A^A_|$L HI ID$A1HD$DLAIHyL,MH/H4HHt$L9|$LK >Ht$L)H9HWHHBHT$ HT$ LqIH9D$LK >L)HPHHCHt1H5N,4@4HH9rLLIIL9|$v5LK<>LLD$ L)L9HPIGHT$!HT$LD$ K I9r.HH `LIK I9sIDLLH=M1/L$,S HHGMtSH;D$sLLH)HHJHCLHt1H5AM,4@4HH9rLI@A%|$(HD$L(fDE11H\$0L5V@C<.1IHt2HLxLyLLH HI+N$kII0ugH-0HEHbL-e0MuI93LL]LeIEIL=~0H|$H\$0L|$`DH1fA<$utteE1E1A|$zH)0D(HA\DA]ÐA|$FuAHWA|$-AHfA|$fufDHH0H@8cAVIAUAATIUSLLLLHHIL H H H)H9rhHunfDH[;yHL)H)ukHcHu^D-uJML4[]A\A]A^fDH9wfHH9t;y뚸[]A\A]A^fHHH<HHHH H HH)H9}HufH;yH99H 0fDH1H9v2HH41HwHH9H9HH9wDHH9;y{fH@HHsH9HH#3tHVHHjf.HtM1[]A\A]A^HHHSH9PHH#tHҍBHH1HH)H~;tiHH91@H1BD$?HD$HHD$@@t$81ɸE1!HcHL$ HD$L4t$8IFHD$I>IFL,MtuEAH|$t*HT$ LAALDLHM>ILE1M$LHII>pHD$(HL$L,MD$8|$?uHt$H|$>uHt$@HD$0HHXH1[]A\A]A^A_D$>HD$@Ht$jIHD$H-MEH ˆT$?[I}HX[]A\A]A^A_HD$>ff.ATIUH--SHHtEHz0H|{0H5MH;WH` H{0H~0[]A\AL%Hff.fATUHSHH0dH%(HD$1L#@.HLLCHL`LHLHHŀ}CH+H5ΜHBL%sx0H}0HLD$I $~I$HH.)uAH-z0EH*z0HD$dH+%(B HH=![]A\H1z08HD$dH+%(H[]A\L(HH}Hy0Hx0H-YHHy0H;H|0LHHBw0H` H;0H` QHE1H0H1H y0EHD$dH+%(u fATIUH-"~0SHuHt@H|0Hsv0H0Hw0H8Hx0H`x0[]A\HuALFSHԀ0HHt*Hp:11H;wvwH[KfAVAUATAUHSA 4HF4H/N,LMjAxA L1XIHHL!HHF4DIH1DHHt2H=L`LHLHc HH1HAՃ [D]1A\A]A^7Hi1B<IH6[L]A\A]A^fD:t)H VHIDH5u1:yE1L[]A\A]A^H[]BHs0foO1HqrstuvwxH$Ayz1:Ƅ$fD$)D$plHl$pHT$XL%t0HILl$`A$Hv0Hl0HXn0H(HLA $LH|$qH-HT$`Ht HD$XH9r!H n0IH1DHH5m0H)HIHHHH)кHHHIf.Hl$8E1H9Ht0|$HD$8Ll$HHHD$I\LH|HӒHI AL5Fx0A<Lv̀uAvHH|$HHt$HHIHD$I)LMHl$HIAG􏿿H9E(ALDHEH)H~HHv>DAH=n0HHT$HH9v=HxHBHD$HQHzAAAu? AHH+D$HD$HD$HD$8HD$HD$HIHD$HD$HL$AU1ATUSHH(dH%(HD$1HHt2HL`LWHLH HH y(H1S Iĉ% =Ht$"HPS Ht$Hǁ AHT$HHt"Ht$DHxHH2Mt(L1~HD$dH+%(u#H(H[]A\A]HH{HpHt$vvfDS@ulH%g0HHxHE11ɺH5kHHtPH;k0tG@ % tR=t;K[HHa01[@HH@ =tH[HH@ AWAVAUATUSHH|$(dH%(H$Hk0H8Ht w wHj0HH#j0H;H,HHrg0HD$(8CLt$(H-AHL*H d0HTe0o oRoZ ob0oj@orPoz`oJpPooX `0ooh@opPox`oHpoLt$(L1L`LLLHWHHd0H$dH+%( H[]A\A]A^A_ÐLH5d0LǽL`LLLH:HHod0D$7.HQe0H5c0iooPHt$8oX o`0oh@opPox`o@pVoo^ f0oon@ovPo~`oFpo)$I=0Hac0D$7HD$(8C9H|$(HH-]0E8L%b0I$Ht @8Ht$(H=01ɶIE8H-b0HEHt @8I1LHHng0H(ֻLHH fDD$71H|$`/1HHD$PfD$0HD$HD$LAHD$ )D$PfD$L@l$LH<$zH<$HD$hD%@EEfAA=@AƒfA DHAALEHD1A8DAEf I AD8DAEfH]@@8DH}AEf H|$HAD8DLEAEfI^AD8DEAEfA @A @AD8DAE%D=DDAf A8DLEAEfL$IAD8EDAEfA AA8AE L$LE IACA9AEzH|$LEHDBE9,H HHHd0H}߉AD4H]D%H=Ht uD$L HD$ ' @'fDH 8H|$,T$0H|$H|$ H HtIH)H9HH\$ctHD$ DPHD$0H|$0|$7HD$8@II@iiH`0eH=tHt$ DQ-DL\$ H{HI H It Ht H)Lލ H)HVfH)fH^08t4D Hf.\tf0PDffHD$ A\nfD)@xUofHt$ DD uL-]0E1ILl$8$;HBCT%IIIB`uDt蓵HBƿI?=1F_#H]05\$7@f.D$0:Hb0H8HH-rH֭Ha0H8H-]08HT$(HL$PH51ԬHT$(E11Ha0H&H5|HHa0H81蛬Ha0HH81臬H-xW0E8H\0HH@81u;HH@81u11dH`01ҿ:HHp1RE8H[0HH+@8!1ou;HH@81I118Hi`0H8wwHM`0H>HD$ DfD ӿu5E8/趿1袿: xxneu5E8H14LH5:1ƺHT$PH51Nu1uHEHMIUH2AHS1HRHHкHѺHC@tHH\$Ht$@AVAUAATUSHL5U1IHhL E @L9t AD$ E HE@t{HH@toف>HV1H@"@*LDHiHHtYHI.E@H[]A\A]A^@AD$ t ID$@tHH@nDL9t+tE LAD$ u|H1[]A\A]A^DE t}HAD$ K))HJP1HHp0AIHhAD$ {LnLHIILnf.LDHBHH.HT1H P1I.HB %tBB#tAfDEAI0L EAI(L EAI L EAIL EAIL EAIL EL H1HH HHH1H1H LHH8HH1L1HH L1HH H1H HHH1HHHH1HH1H HH H1H HHH1HHHH1HH1HH H1H HHHH1HHHH1H H1H1H I1HA H&H=\Hc4H>r3$\r3$Xr3$Tr3$Pr3$Lr3$Hr3$Dr3$@r3$<r3$8r 3$4r 3$0r 3$,r 3$(r 3$$r3$ r3$r3$r3$r3$r3$ r3$r3$3D$DFISIEizID3A(y$NDA+9AAIA)A A1DDAAD)1M9wILJ1MIIM9ANLGMGI@tA+8ND HtVHtIHtRщ[)11ȍ41 1Ɖ) )11A@AAff.ATL%F1USI$Ht'H-q?1H{臻HHUHHHEHuI$[]A\@ATHcUSL'IL$H9HcH9H9}{9|9~qH}Hctu] HcHqtOEtIHEHxt>H5%>1H vH1>Ht%HH H1HHH1HHH1HHEPH[]A\fH<ICHID$LEff.HHAHv0HW1Ht%HAH HHH:HHH9sff.GtHH Hf.HHHff.GtHH Hf.HHHff.SGtHH X[tF@SGtHH X([X([fDSHGtHH HX[DHt@AWAVAAUATUSH(GHL` HD$M@ u6A9uDiu@HILxH9fDLLtHD$L` ɱH\$HC L C<^Lcl$JIIH([]A\A]A^A_DDLͯIIGH9D$fD$I<$HcWLGD uQ uIA9DLLrf.Dl$HD$ADhEHE8HE0ELH@H[]@[H@H[]fD%G 1ATIUHSHHdH%(HD$G t-Hs0Ht$@CHC8HC0CLH]H{H}I$H"DHJHI $HuH9V~HHHtHHHEHhHU21Lc8tEunH{HcGD tFqHJ51HHHHD$dH+%(yHL[]A\ÐI$1N蛲fHEHx tx<}MtA|$ hID$H@ HV@LHHx >x<4HCHcPH$HH|:|:ID$L11Hp 4LcE1LGMApv$ApH{%G 1LH{8:xxHxG % =tHzH$Lc+_HHPHGH$ff.USHHdH%(HD$1H$H@HH-Htpv@H߉pHHuHHxuHD$dH+%(uH[]fH豢ATHAH0H|$Ht$dH%(HT$(1Hx)1DHT$(dH+%(H0A\@HHt$H|$HT$ HD$HD$ ~|Ht$H|$t1H|$ tHt$H<$H]H<$Ht$AhHt$H<$II A1FAWAVAUATUSHHAGu`HtEIʼnHuHtHcHA HHE%HImH[]A\A]A^A_L7M~ MAF<ʃHcHy HHIGM,HD$I9v fDI}111IL9l$rI?Ht 111LMn AF<f.t\111LMn DAF<Mn dI?MH111jDAFI>HcWLWHD uT$tDDHtL9D$Dt$AEuH([]A\A]A^A_MIcRIzAD uD xLDDHLT$DG LT$uHLT$ LT$IEIcHAUT$LD؅I]HHE贠HCH([]A\A]A^A_ÐHT$HL IIFH9\$AEMUHcHt$AELHT$HcH裝DHT$IcIEA HHcHT$HEHH([]A\A]A^A_fkIHHLpH9D$\$HcT$HYA9DHLT$LT$DSHH 1L$EDLT$f LT$RD$HH=F1U%HHt H]E1E111%H٢HuH=FyH%螟E1HtD@DHf.ATUHSGtPeHHe*1L MI$HH/1HID$ID$I$HID$H31HHyH8H,1H;8HN)1HL$AL$ HEHxHXt HgHH)I$Hx9HX AT$ %_AD$ uEAD$ H-18uhL[]A\H@ I$HX AT$ %߁AD$ tL菭AD$ [HH]A\!){IH'18tE11ɺt1LpsӣHff.AUATUHGu~HU1HzLbt HUHI9uH_&1]L`HLA\A]f.KHIHELh(LH5LDIH1LL]A\A]@PFHoHH]A\A](ff.fAWAVAUAATUSHHG zHH+Lu0t MLEHAMSM&E9t(}8t1H5@誗EHELEHHzHrMudE8}HAfDMuKE8D9HK1H!L$EuMtH11f.M$$MtI9T$tMtC @Le0HL[]A\A]A^A_MtH11 fM$$MtI9T$t9H1HzLzt H@HI9u9EHE8ELwpC E19HE8E1}L.fD%L1C vs$PHIH1IMIVBHrL蕌IFx@IFMH@LLHS$AE ID$@AEID$Lh}fDHH@H<觔HCC \HcHzT2  苧HAHxHOwwIF4L5&1M&MI$Le0fK @IID$A$ID$@I|$Htwv_wI|$2H &1HI$L E1HE0c aIF1ۉM&K辌ff.AUIATIUSH1HuHt-LHHߢHLHH[]A\A]GH1[]A\A]AWAVAUATUSHHGHmHHxL`t H!HI)ML5,1H-&1O,$MEM&L9 L=%1I?MpH,1HH)HI9VAA@uT1HtIHtXEtI|$)}HB"1I6H H HVIHIHJHBI@tIIT$HHHPI뗐H[]A\A]A^A_ÐP膗HHE1AlAAI fD@uV1HsIHtL= $1H+1I?HH)HI9HEtLSIIHPL@I@tLHaIIHPL@IfDLH蝊LH萊L蓜`ff.UHSHc޾%H膖HtHXH[]fDtE111Aٺ%HeHuH=/=$p@AWIAVAUATAUESHHHWL-+1hHcHH3Hu@HH3HHL9nuHAG tJIH9q0uA @AG AuIL)`IHxuAg HL1[]A\A]A^A_%B=Bt 1mIH@0H90uHIW<@HHxtUHٍu ]H]ff.fHAWIAVAUATUSHL%{)1I$HxH"1H98oH,1I<$AGHL AI|$t HMtAG %P=Eu&Ht$PH|$XLD$H*LD$AI$ML$D#xIHVA|$ tsAumT$PHt$XH E5fDH%1H9C$ E1HD$xdH+%(JHĈL[]A\A]A^A_AtDM= DA#@ M,p L=1IHHHt$PDH|$XLD$IHCLD$HD$HCMuMH18H f%1HHH H1HHH1HHH1ШHIE HHIEHK@AeU贎HHOL@(Ix@Lp M-IcL{ HLI@fL{ Ls E1 fD^IHxA|$ IG } DpI$HpML$D#JMMHcPLLHHHCH9HcP:L tLHT$PHt$Xl$LL$HHcLD$8HD$@Ld$ AL|$(EIHDl$4I@IFD98D9`HhHLHHD$@Dl$1LLd$ EDl$4L|$(LD$8A+HCHcPHT 1t,z H 1L9!@t AL$ H{H;="1- A D$LcLD@M6MEl$Ld$ Dl$4L|$(LL$HLD$8GIH@HD$PIG;H|$XLD$HT$pHt$PHD$pH|$X1bLD$AEDjfHD$A n ML$.@I@HE1PHHAHwPg AHHuEH1D$Mu9 Mu,Ht$PH|$X LD$(DL$ 衘LD$(DL$ IH18]LLD$(DL$ |{Ht$LHIduDL$ LD$(|$(E1IHzۃf.AI@LD$H<˄LD$ID$@HL$PL\$X AL\$`HL$hA`IxZEt MtAG %P=Eu0Ht$hH|$`LD$LL$H LL$LD$AID$DA#PHL;ME\$ A^H|$`BDL3I]AD$t>H r1H19Ht!HH H1HHH1HHH1HI$BHHD$H;1Yt AL$ I@HI@MOHIHLD$HHH94H'I$HiHxtLgtAD$  HT-HLH|$X>f_LD$H|$pI E1@IHx/E\$ IGA C DpIT$HxDA#HLMMKHcPLMtLM?M$IGH9HcP@:t tMLHT$hHt$`LL$(l$HcLd$ HHD$ADl$4IDIIG;tD9`jHxLHH|$ֈNHD$H|$L$D1Ȩ1LLL$(Ld$ Dl$4H1L; rMwH1I9QAD$ IIGHAD$ tI$L;z08 %B=BL1LL$^LL$Iiu Ad$ MA^ HD$o1E1AAv AvE1@lM@JHT$L1~1fMM?Mql$Ld$ )I@H1ېPHHAHw@PHHu؄`DT$ALLAVAALjɎAXAYHDT$tHPHtB n * M$MPLLD$.LD$HiM%LfIzLLHH\oH1L M!I$HID$I$ H@ID$LhI\$#uH@HTHL`@t$ID$LEDPLLD$^HuAD$ LD$zIyIM-MHt$PH|$X jH¹LLgnpLރHHtLNAE QLH+q 1HH.AE ]tIE@HH@1L]{fDI@T$ LD$H<}A|$ T$ ID$LD$IfDHI]@H|$XE1裋fDMtAF W IGL蹐H20DpI$ML$D#HIHmHt$PH|$XDLD$ I-1"AD$I$Hx H|$Hx<tLD$hIpHl$`E1B|:Lt$Iuf}IS+Lt$1udIFxHxAD$I$Hx x<LcE11H|$`葇A^ zH|$Xx:LMHvI$H@0L;8IHL$PHT$XLE1Ht$LD$(DL$ hLD$(DL$ {LnHHH|$p M$HD$E1H|$X识L$PHT$XHLVhDpID$DA#PHL;M @L=A 1M'MI$IĀID$ @AD$ LD$ T$dLD$ T$HD$cELL$LD$II A1fIEHTH@HIH=IE80.&LLD$IHIPHHHH9!HHT-HLHG1H 11LD$(mILD$IEHx \M$;Ht$PH|$XLD$ 蚉LD$IoH׾pHT$|HT$H(pHHT$qWLd$HDT$HT$VDT$HT$q1AG H= 1E1IH߉D$LL$?D$LL$OL;-21dL Qu"H H5N"HDH=#1;H|$XT$݃T$LE1nuHl$`}:E11Lt$1~kM'1!bHD$mLLD$(DL$ LD$(DL$ B|:&IuH 1L; IFLx MAGIHx x<LL$\L$@0}AIF1HX(HIH߉L$zL$HHx I9LHwIPLRHt`IHMu0HIrL;0uII)IL9~ HHLI@HHHhyuH@ HH@wvswHkHt@HDl$MAH@H\H}Ht i߇HH9wDMDl$IFIL$Hx(谇L$L$nlL$넽H5>nHL$LD$1zLD$L$u,H5?H=E 1~T$hHt$`H .gH|$` ȁu AT$hHt$`H :3H|$XـLHILcE1y ALcAQLA1PL:HDAWAVAUATUHSH8H1L MXI$HHr1HH/1I$H ID$HC`H+HHS`I$HI$H@I$H@I$H@AT$ %_AD$ x AD$ I$H@ID$HFHUM HB΁HD"HZH\$GDz8Lr0H\$HHt+HHSH9s@HVH9rHl$Ht$HwI$H\$HHXKf.1HRHHt~HHE1tHHCxuLhG tHH+0HHvH;= 1t WHMj1LAWE11L,Y^uDDHWLH蚃H8L[]A\A]A^A_HzH|$HEH<HD$(xHD$ E HD$HD$(HT$E1LsHkdH0H8H8EAtI tD11HBwMg@MI<$HhwwI|$HtwwI|$(HtwwI|$0HtwwLtIG@EHE@P|IXHtwwI`HtwwIhHtwwIpHt+tIHtw]wI!tAgPILJ@H0F1HnHUHB HjzH5L~NH@ HHcHHPAD1DD PjA{sAXAYZfI|$HD| |H@ H@ H@fDH90H0HHJfoHHx HH[]A\A]A^A_"]fHEH<*@ ]fD\ fD\fD\$fDI #\G\\i\DAWAVAUATUSHt$ _H0HL(M<IUHH0HH IEIEH-0H@`HHH 0HQ`IEHIEH@IEH@IEH@AU %_AE ~ AE IEH@IEIEH@xD$HNbIEHL}T$E7D!L$I$HteIwHHtPHCD90uI9t2HcPA;WuHxD2DuH4$iH4$ufDHmHtiIE끐H0HHtuHH 0HHIGHEHCO1H;0HCI$T$ HI$IEH@HmHuD$ u>AM HL[]A\A]A^A_ú1{WHd0L}Hgt$ L|LuAE q 5WMIH=* 1snAWAVAUATEUSHHHt$(HT$ dH%(HD$81AHD$0HHAA%HD$DD$L|$ Ll$(EIGHD$ @HmHtH]D93uHcCL9uH{LL6guHL$D D1uH|$GnT$Ep<H-04HD$ADd$fDH|$mD$uNH0HT$8dH+%(HH[]A\A]A^A_@LLIwj觯A1@HT$0Ht$ H|$(g;tHD$0ADd$HD$HD$0HD$DD$荭II EA1HHF7`DH=G blfAUAATIHUHSHNHAD[HL]HA\A]NAUATUSHdH%(HD$1AԋV HI% =H"LI7AU L $HƉ؃ EEt3LADHjNHT$dH+%(uKH[]A\A]PuIEHxuIED`DHHvLHL $z_H=A ,kff.AWAVAUAATUSLHXH<$Ht$(HT$ dH%(HD$H1HD$8HD$@MtCL;0t:A@ ]KD$A E1HD$fD$A AHD$ADLt$ LD$(Eu"LD$LLILD$ALLD$KC|$@LD$IH$I$A tbA0t\L@DL¤Al$H|$@ID$AD$jHD$HdH+%(bHXL[]A\A]A^A_HH@ ID$f.HT$@Ht$ H|$(8AEf Ht$8"HDL$4Ld$8DL$HD$C % D$@EI!AAPfH\$8Ht$I|$L$HStmI\$L$fD%A HD$A =0AEƈD$A&@HHsLbHt$Ld$8[fDcLD$II A1'\f.AVEAUAATIHUHSH}JEID[HL]HA\A]A^^Lff.AVAUATUSDHdH%(HD$1AF AHII͉ H"L 3H$HAF ك EEt3AMDHKHT$dH+%(uCH[]A\A]A^D%P=uIHxuIFD`HHvHRH$Z[H=Q gff.Ht?UHSH'@H}111IH]HHHt H݃mtH[]HHtGff.@HGHHtMHHyuAy:u;H`@u/HtHHHHtHpP H@1DUSHuJHHHֺik ItH H}HE11ɺH5i-JHEHH[]ÉH=91efATH HHcH>fE18guaxeu[xtuUxpuOxruIxouCxtu=xou7xbu1x yu+x nu%x uux mux buxeu xrDDDA\ÐE1m< wHI D$QH NHcH>DQ3H nHcH>DQ.H HcH>DQ5H HcH>DQ5H ZHcH>DQ3H HcH>D8W3H HcH>DQ"YH Z HcH>Dgs[E1exxnnxddPh.sNxeDxr:xv0E1xe#xnx tDDfDE1g1(k_ exnxdxpxrxoxtxoxex nx tDDnDE18g]xeSxtIPh)s3xe)xrxvxb xyP E1n=px ox rx tDDfE18gxextxpxrxo{xtqxogxb]x ySx nIx a?x m5x eDD#f.E18g xextxnxextxbxyPav;nE1x ax mx eDDsxxenxtdxpZxrPPi7o:xt0E1xo#xex nx t6DD@E1E1x_xPxAxCxKxAxGxEx _E1x _AGddjE1aE1QE1AE11PE1e$oxcxkxextxpxaxix r)DDE1E1E1xextPh*slPe3oVxcLxkBxo8E1xp+x tDDE1@E1q<HD$E1xrhDD@AoE1xc1A@"HJ0HJ8pE1BP%EAf.E1xqDDE1xo3DDE1xc DDE1xrDDuE1xehxw^xiTxnJxd@xd6xi,xrHDDE1xu xoxtxexmxextxaYDDDE1xrxoxtxoxtxyzxppxeDD^DE1xoLxcBxa8xl.xt$xixmxe}DDDE1xextxnxextxexnxtDDDPE1nx"vxavxllxbbxyXxtNxeDxs:A@+HS0HJ8p E1BP%EAE1x_xCxLxAxSxSx_x_A@wH0E1HP8с<<SG@PEA3f.E1xNxIxTxCxHxExCxK DDDE1xaxnxtxaxrxrxaxyDDnDE1xe\xtRxnHxe>xt4xe*xn xt9DDDPe$E1iPe-E1mE1xeDDPq,e*E1oxrxtDD~E1xoqxigxnDDUE1xoHxr>xkDD,Pv*E1a+lxsxe6DDE1xpxexnjDDPE1i%o%axsxt{DDPE1eL#ihxl^xlDDLE1xu?xm5xpDD#Pa"E1e Pc8-d-E1axdUDDDPE1i$u$axcxkeDDPE1o)le)lkxoaxbmDDOE1xeBxx8xtDD&E1xixnxdDDE1xNxIxTDDE1xhxoxpDDPa,!E1hxexn~A@oH0HJ8pNE1B6BP%@EA@E1xr xuxnxcxaxtxeDDE1xexaxdPl<-pxixpvxeQDDdE1xeTxtJPlX)p )g+xr!Pg[/n6/exnxtDDDPhE1yextPg+pxwxexnxt5DDofDE1xb\xmRxcHxl>xo4xs*xeDDE1x_PF%L%DxAxTxAx_E1x_AG$E1xUxTxOxL~xOtxAjE1xDAG$VDE1xoDxr:xm0xl&xixMt+AvAF|$DMt AG < Htuvyu1ME1ME1@At$fDAvE1@AuE1IfArE|$ rH?-H("H H HH0GcPHD$H@n@HUHHT$fHE+<6PHH<LT$(t$ 9>t$ LT$(LT$ IHT$LT$ H9tOHELT$ HD$ H9D$LT$ t0HELT$ HD$OH9D$LT$ tHE@xu*t^IHB HtRH 1H9J<HHt5Ht0HcHHPLT$AD1DD PjAPXZLT$AwwBAG|$@LT$VLH1LT$DAwE1RHLT$19LT$VL9WLLT$E19LT$fDLLT$9LT$fH'fLLT$E1P9LT$H=71Ht$1HLT$ouLT$H8H5[]A\A]A^A_s@HG8fDUSHHn(HtMEtGH]H` f.wHHH9tH;Htww8H1[]UE11ɺ SH5OHdH%(HD$H1HHxHr/Ht5P H1t u&HT$dH+%(uoH[]1@ۍkI t/HH $HcH9s rHHHHGH $B@fAWAAVAUATUSHEx~L/IHLAtBLHwOB‰HcHA HHEBIE H[]A\A]A^A_ÐI} HtMM.DCHH 1LH=1WKAWIAVAUIATUHSH8G HL$DD$\$tbÁ\$ u,tOMwMtFHD$HD$(IwHt$H{HD$HD$(D$ L%1D$$E11I$H$D$wv IH@ L2IHxAG %̀AG t*I@\u!HH(HtA f%f-fwI $fLx%IGH$I$IHh(Ht LHDd$T$LLD u,A t$IHH IGLpI@]t H;h H8[]A\A]A^A_DH|$DIGH@AG IƁ HZt$ H\$(Lt$L%11AN I4$@lj|$$H4$  t 1L*H=H1Hf.IHHL$ML$HT$MLH,HIGHxZT$$t IHHH1HH00HD$HHT$(HƹHED$ K ~fYH8[]A\A]A^A_fIGAG E1@1AAG LCHNHx8IHp H9t>HcW;VD L HH81Ȩ@H8LL[]A\A]A^A_Q1IGICIGHXAUIATIUSHHJ dH%(HD$1% =t^HH&K L $HALLA LDD:&HD$dH+%(u#H[]A\A]HHRLHL $:fAUIATIUHHSHo(HAL[LHH]A\A]%ATUSHL` MtVH@8HA 1LHcHHPDD PjAGHXZHt,LeMt#A|$ uQH@]L[]A\fDH1L MI$HH/1HI$ID$H@]IOHH8Hp LHQHcIDD AA$H@]tHx8-GH`\HL`8Ht H}tAD$HH\L[]A\Hx8FH`\HL`8@#I@PXHH@]uH@8HH=Hp 1HpDfAWAAVAUATUSHH|$Ht$ L$4dH%(H$%߉D$% D$E1HHHq1H(HUD]E|$Ƀ0DL$DHHDT$(EEADE1E1q9DT$(HSL HA1HI9<Et$ D$(A xDЃ0D$8A@t AAKDD$LHHLAD D$"H|$ ttH1H A8t$H|$ "* H .1DHT$t%GHT$H HfH1H9(ME<HHcH>DL|$ H\$MUHN1H@8)D$MH j1DIH JcH>@IIM^HvHD$8*Ll$M9tD$DT$LMHD$@E1 D$MD$H10M\$8<'t"IM9?M9vAE<:uA}:uHUL9l$ LML)HZ<:t=L\$`H@vHD$@IHLLHT$(EHT$(I:D:D$ڋL$8LHL\$(DE1E16H]LHk1HI9FM=Ay bHT$(DD$HLHHLL$(5 LL$(IAHh HE5HEHP H$@E4HUHB H#JAELL$(DDT$(VDT$(IfE1M$DHH/EH|$ HH4;H HiKσ@V? H1H9(D$4  |$4<*t<#H=19;A'{R{G{V {O{U{TfD;S{T{DCI$H@(@H@P AO @I{XII bI  H5QH/t H5EH/I$HH1Ht$XH=0mL|$XI[D|$8ID$H8HEDD$811LL=/IIH5H//I$HHIH5$H.ID$Lx(MpI$E11ɺILLHH-L=1IHoHzH1HHǂ8HHM1H)@HHHzHHHǂHH)HI$HHID$H@ HD$HH|$E11ɺS1y:HR1H\$H\$Hl$LxH HD$LMLeL"E1E10LH(HtH f1H8Hq]HH;l$uH\$Hl$MI I  H5H+D$8EIH5H+uID$HH H IN;OOKBI$HHID$Hx H E11ɺZ1.9I  H5H+qIH5H*D$8]I IH5vH* It;PENhIYHNCODINGH9FwI I` I # H54H7*E1-LH^!fDI  H5H)@D<~HҾHcH>FЉD$8/I$HHID$H8HX 1EHLs7;+; D$4  ID$Lx(M- H3E11ɺDL,7AO |$4H=1/fDI$HHID$H8H EH1L6D$4 t A!LHH1IT$H8L:HT$.HT$HID$HH MLAwd Aw3ID$H8H)H5I D$8|$4I$HHID$Hx Hv E11ɺH15ID$H8HH5ID$H52L8H1H81AHr1IT$H8HT$HT$HID$HH M8Aw AwH1L8ID$H8HL-D$8fDd$EBH˳182l$D$41H55ƒt!H5!g- t H5K-HrHEDT$(HILSIH=1AWR!H H H={ HH@DT$(Hh I$HH"Hõ1H@8dL$XHD$LhM9gHD$@Hй1DHD$ HT$(Hx'HT$(HD$@I0H1Dt$H*EY@9s|$4Gc ZIuua<;Dl$D HHDT$(EADE1E1!DT$(HI+H^1HHH9x  |$4N|$4  |$4 H@@E1|$%A1IMDH5{ DT$(<IEDT$(H@xHxILD H5]1DT$(b@HLL$(2E LL$(Ht$ 1HH# MMH|$@D+J4;HH%IKσ@? 1H\$H1SLk%@=@^T LL$(LL$(H 1LL$(: LL$(HBHx:*HEy AHUU0HHT$NHT$DT$(J4;1H"DT$(ZHHT$8DT$(DT$(HT$8'1L1LDT$8L\$(="Ll$L\$(DT$84HHSH\$ HSH~H\$Sуu? 4E1E10H1L-LH;ZL A|$ H3LAL"HIT$Ht@HB 1DT$((M9DT$(LE1+1HD!oH@HF,H@ E1|$@AH@}E1|$$A1LfH@M LPH@Lx(Lk.H5HB DH1AVAUATAUSL(MIUHHL1HDHvEe IEHAEAw7AwBAAuIEIEIE[L]A\A]A^EtHH=g1"DHL51I4HfHI| CH)IuA  H=:#AM HH11H8)HCH@ Ht@IUHIEH@@<L5Υ1IHHIIEHIEH@IEA H@IEAH@IEH@ AE % @AE IEL[]A\A]A^DI#IEIEIEL[]A\A]A^@AU{r;CHcHfDH~HHHDHH) 1HSfDH@ :H@IEH@AU %_AE uu AE IEH@1fTDD4DL,VDD4DL H~@L&AE zDyff.AWAVAAUATUHպSHHHH<$HHL$dH%(HD$811D$4AHȁK}7>=w&E1H @."HH1!HHHHeHv1111HHD$H1HHD$ H111HHD$(H1H"HމD$HȢ1L8L=IHL$4DH5oLHp@H|vH<$tH<$E1Iع$DHIDl$4H\EIc^HDD0|$11IAH"IHD$4ƒ,=„t z<Hث1Ht$ IH|$H0H91Ht$(H8Hҡ1H0Hc|$4`Ru }Hc;H5n1LHH uufHD$8dH+%(HHL[]A\A]A^A_f. E1H`8HHuHHH1HIHH H5IHCLLhHC@IEH\IEHp0HDIEDLH5wHL$4Hp@HtH<$H<$E1Iع$DHHc|$4`H|$ HevalbyteH9E}s`2E1H0`HHHDHH1L9tM9tA@t I@PpLcH@@ uNHס1%@=@HH7DIIu~fDH41ҹX HHAD$t I$HP Ht@HGH8tnDHt G v? DHGHx uϾ k HGHx(u S HGHtHxt11 AWAAHAVAIE1AUIHAATUSLHdH%(H$1H/1jjH8Y^IHt9H@HL` H$dH+%(_HĸL[]A\A]A^A_fuLM^AF Ł H$H|$ AE1HL-%LLHL$mHL$LHH$: D :JIMPAF 8 )IFLx u MAG#IHJ HR<MLu$LIHі1ځ DE1H8fD Ht$"LZLT$IAF % DE ÍuH|$ DuH4$J ?AL LLHL HB8:E:H<$H<$I H9fDىLL IHR(HB<L1LtIMnLR#щH1ff.ATAUHHHDH]A\ fDAWAVAUIATIUSH(HGH|$4$DD$@[Hx Ht GL5'1IH@HH@ HHX(L=1b HH=W1HГ1HHBIHH2HH+HHVHQHH1H=e1HvH4H7H1IHvIH,H+LD1Dl$ HHtO E1E1H5ACHHt+HHt#P tH@x @LLU<$[HDh$D$1ҿ1t$L1O HHI E1E1H5HHHHP 3H@x H1HHHH1H;{H=ě1HH+HH1HH$H)HfHD$HHEH+H9IHHHmIH=b1HH0HH+HHFHBHH2H=1HvH4H7H2IHvIHHH([]A\A]A^A_<$[qPEHKH([]A\A]A^A_f.HpH~@H|$Ht$Ht$4H8HpH~@1Ҿ IHPHBH $H $sfDHHH $H $Hz$AL1H= J$AL1H=> 11AWDAV% AUATIUSHHXDD$4ADL$0EAHt$HL$HAD$H}CHHP HDXHufDHvHHzxXHzHFHzP;HzX0HHHmHzXHzHMHzPHzP̐M1! HuH[HDAWIAVAUATUSHH|$dH%(H$ȃD$D$XHv1H@;AAHD$@ tH@@tuHL AD$ tctCI$HJ Ht6rt)1LL\$H$H$L\$OAD$ %AD$ H4$赞L$&@Ld$f.HLsvME1MD$E1D L$AHk1D$\AHD$PH$Hp1HHP H kl1E1FtE A <|$UHv1L5jr1HIHD$8D$(EH p1HHp ffD@"D$ u'HcB( HzH4@HH@D$ Hw1fƁ)$)D$p)D$`HHD$p$f% f$D$ <.D$ AC|$AHu1L5cq1HIHD$8D$(H.w1fƁ)$)D$p)D$`HD$ HD$p$f% f$B$HBHYH@ HHH(H p1b HL=m1L-"w1L\$HHDL$@HBHH0H Hu1H:II+UHHWHVIUH>HHH vp1IHH1LMLD$0SHn1H8OHD$`LD$0H m1DL$@L\$HHH*s1tHNn1Hj1HH9t$@Lo1Hqn1IHIH;II+UHHjt1HHD$0L)HH;D$P|$ L$HT$H$H0MXAIPAI@EmMHEtH<$I@ HWIP H $LHHHIMaIMLc Hu1IEMN H$L`D$ <t<u @M MHIMHPH]H n1HM+MH1IH js1H6LNHpIuH8HHAD$ % = LHH$L`0KH@UUUPHHPYD AD$ WMd$MrAD$gfDh#AAFDLH$L\$sA;M}zsIcMdMD$MHe1D$\E1HD$PH$DH{D$XHwMH D\$0LD$LL$H4H0H<ºHHc#D\$0LD$LL$Lk1EI@ PL<<fC@@\R@E1F|$ AD$XD9EHD$LpA~H$L|$ L\$(HpLDL$ DL$ L\$(HJIGAG@AvAv"f.1Ҿ L\$@DL$0IL\$@DL$0HPHBrA|$EHD$LpA~E fDDT$E|$D$XAA9DA:DHNyDIcD$L$fH'LMwE1D L$D$AcfDHe1L MI$HH/j1HH-f1I$H ID$HEXHHHUXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ Hbn1H8HH8Hg1H;8Hd1LLD$L)HHHL$HHcLAL$ HL$LD$DM(\$ LDːHUHcLH-sl$LD$\$ HM .CDD$EfHT$PLLL\$@DL$0L\$@DL$0Lg1IDL\$HLD$@DL$0L\$HLD$@Lg1DL$0fz(AC [IC@MHHJ  1tHHx Ht x<tH?L$L$IAC  IC@HH@HD$L-{@  H`1L@0H u@H:HuHDЋD$XH5w0ASMATH=1{HH41HHH=E H1}DHf.AD$ % =LHL$$@AD$ % =sLHH?f.AD$ % =[LnH@AD$ % =L>H[HD$L9'LHI/f.AD$ % ={L6fAD$ bLH+$HH^AD$ tID$@HH@1LLD$LL$LD$LL$I,z,H?k1fƁ)$)D$p)D$`HHD$p$f% f$uzH]1L`0@ HD$@  H]1H rL-HML@0I$H@ I$H@ I$H@ eI$H@ I$H@ EI$H@ ( LD$LL$LD$LL$ M:I$HH@HHID$80LD$LL$LD$LL$H+cLL$DL$L$HHP(D$XLjDL$D4IcMdM-HB\1D$\E1HD$PD$H$\cLL\$H$OH$L\$HbHH(MH1fzTI$Hx LL\$(DL$ zL\$(DL$ CH|$qL\$(DL$ LZ1L;$$rHAHcL$MHD[1E1AD$\HD$PD$H$[|$BtQ<iHcIDHIE1AHZ1D$\HD$PD$H$fD<@JH .kHcH>LA M9HuZ1L\$D$\E1HD$PA H$HHD$HD${HLbxMQLA MH|$HY1L\$ HpHDL$H$FDL$L\$ @ ILH+$HHAE }tIE@t2HH@t&1LL\$ DL$DL$L\$ *D$\E1A D$AHD$PdLbXM8HY1E1D$\A D$HD$PH$%LbHMHX1D$E1AHD$PD$\H$LMLX1D$\AA!HD$PD$D$L$HD$LxAG ~LHLM6LbPMHX1E1D$\A D$HD$PH$(LbPMuLbHAMtHW1E1D$\AD$HD$PH$LMt|LW1D$\AAHD$PD$D$L$LbPM HBW1D$E1A HD$PD$\H$VLMLW1D$E1AHD$PD$\D$L$ LM\LV1D$E1A HD$PD$\D$L$LbXM^A (HLbxM"AH|$:H4V1L\$ HpHDL$H$DL$L\$ HNj@ % =tnL\$ DL$L\$ DL$ff/ALH III$HHt@HH@(H$L\$HD$PD$HHHD$AA AALbXMH+U1D$E1A HD$PD$\H$?IEHH@HHIE80tLd$IEHx L;,$H艡L\$ DL$yAMC?LD$D|$XMk),AH==o1vLA M|$H ^1L5"[1HL$8H I@|$(L-WHD$H@@"HHJ t`1tHHx Ht x<tH?IHD$@ H@@HH gH@HLS1LB0H?S1Lb0nHD$@ u%H$S1H gL-mHgL@0L-m#fAUATAUSHL-V1IEH(E tHE@t HH@uuE1H[]A\A]@HR1DHHp HHuGtE tH蔇IIELH1[]A\A]DH E gHW1H R1HB %tB#uH9OHOOLHDʵH5fLѪU fH5L觪C$;+@H5L|CT%n =f HCHHxHSXH:0ff.H(A\$AEt"L%6LLsHQ28t EtAG % =MHL1[]A\A]A^A_pH5L藩C<%n =f&HC0Hxff.@(3H5aL?E %n =fHEHxHUH:1f.@(fLAH5èU zڀ wH[1LH4fVE @H}y1H=ּLH5!I=Et;HEPHuHPH)LA1HH5NLH1,HEHuLAHPHH莿H5.LH1E Au\AuH5L臧ZfIGH[]A\A]A^A_E Ho H5L7QfAD$H5LHHBIIWH@LE1H5A\$ϦE1ۃkdZH5L茦_ HQ2<HEH5L@(耥#H5}VL2 1H=IHE@]qH@8HvHtAHE1LHH HcQHqDL AL AHcA蛮HH5L1פzH5L艥AH5~LeHUHR H5L1f L-\L轖HELH5f@(0^LcH5aLդHEHLH@H@HH5LH1ͣHH5LrEH5R^L1茣/L"f.H=L2AUIH ATIUH1H5ۛH艛LLH]A\A]fDHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0͹HD$dH+%(uHAWAVAUATIHUSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1H$ Ht$D$HD$HD$0D$0HD$ "H:HNj@ % =Ht$%HHD$HA|$u= HHH)I|$HHXHHlH)\$AD$twI|$H5^E<$AxAL-HDDHI|$HI#D$IE AsiDI|$HT$HAD$HD$(dH+%(u-H[]A\A]A^A_fDHHoH@HD$ֻfDAU1ATUHH=SHdH%(HD$1HI HH5tH1r1HHDK D% =IH"HyDK H$HHAE1LHAHLAeI-LHH1$HEHp8H91H褬DK D% =H"HݑDK H$HHALE1HAHLAɨILHZH1舔s Hƚa1HH1^HD$dH+%(urH[]A\A]HHsHPH$@HHD$dH+%(u4HH51[]A\A]鸖HHsHPH$ 藹ATI1UHSHHH讓HCHHB HrE1EAH؃0E1ɺLHD$H5-HD$H 9H0gH5@#Hv1ɺL觚@HD$dH+%(H(L[]A\A]A^A_AEM1ɺLAH5EH؃05f1ɺH5LwDI_IH؃H H5Hǃ1U2E1IMoLMAE1IH4$MoLMAsE1IH4$IGLHD$dL|$=f.E1IIGLHD$L|$fDAPDAhDAAH1ɺLHD$H5"ŘHD$H t"H0tTHH5fDIH4$IGLHD$L|$EH5H HEIIGLHD$L|$@IMwHG % =Ht$͉HT$HHE1E1h@LMXH5^ Z"IWMwL1H5[MH5-1LM菗H5 HHwHPHT$ffDAV1AUATUSH_0H=HkL+LsIHtjHLHE1h@E12LH@Im0XZMx'L-fHLL1HHHu[L]A\A]A^fDHHkLs H5]蟖pf.ATUHHHE2HHB2HH9B(dE f%f=HcJ2%H41H=E f%fDjf=_v@f=uu#H}襼H5xH1dH1]A\f.f=HC2Hx HH艽IQLH5H1 fwbfxH}(9ILH5.H1͌Nf=fDG"fDHC2H4f.G#@NAWAVAUATUHSHHDa |$ Ht$fAdH%(HD$x1fAHB2LL Ћt$ HT$1HLHfEu HEHHHT92HH߉H5H1蚅HuHHL$ E!@uALMM|AA"qIA(@!@^H@HQH9u@LMMt fEME E!E#DE HB2%D4BfA;1H=͡DT$0A襸DT$0H\$(Hl$0DIHD$DfDd$ qsYH&:2LAՁ<0-u HcҀ<t3DH5QL)ӺόALH592蜗fEWH=@<2H GAAffAA_H =2LA%Hf.1H=/IE"<<<H5LwL-h<2U"H\$LM}`MAIM9tAEAtIuHIM9uE!IH\$m =   @ IL cHxtMNIHT$t$ HHLr1?,f.fA NfAHE0LBLHT$t$ 1HHE"fHD$xdH+%(N HĈ[]A\A]A^A_f.fA A$Rffw+Ha mf E"tDl$ Lt$Le(AMMVAt$!LHD@L AD$!@,Md$MuDfA=fAfA3wH.EJcH>fAġfAfA'YHEJcH>fA(fA,HE0L|$HHDt$ LE1L%~HD$ H@LO_E"AXLM0L/HE0Lt$HHD|$ L,LL1DHHLDIL1HE"mfH5L'-fH5WLE!fDH5'LE!fD H5LE!fDH5LE!qfDL|$H5DT$ L]DT$ L1H5As~DT$ fE1Le0M3M,$ML$1HHT$t$ LHmMHT$t$ MHH1E1ILL=6HLl$MIHl$LIDsMH13MLLt$IHXZL9l$uAF"LL|Ht$|$ HH|E"WH5zH1uf.HT$t$ MHLnH1DT$kDT$HT$t$ HHL1DHT$t$ HHL1"UPH1H5uH5zHzHT$t$ HHLM1ݾH:&SA11DA=1eED$@Ń@C  %@@H =@@ HI  |$HL1b LhD$+ @" C @@@@ H2D0E4 H|$LH@(bC U |$|$  C Ё Hk  AD$0EHE1t&DuM|$LH1La|$1HHLjaCc|$HHPEG HL`E1E1hHL$0HLHT$PmAXAYHT$@I9v |IWH5L1cC H5hL1|cHDt$LHиHHD1`|$ @@"l$0&HHLDHH1m`C#HHPHt+D$8HLt$(DL$8DD$,H|$ H^_HHt|$HL!x|$ @ D$HfHcH>@|$ S %=|$  H5%Lj|$ \D$ 7 C > D$0zH5׶Laj\@H5L?jvDt$HKL1H/D^HLDH&HH(1^HLDHHH01^HLDHHH 1^HLDHHH81q^HLDHHH@1V^HLDHHHH1;^HHHPHt1HLD^HHHXHy Dt$H̻L1D]D$8HLA~HHHPXt$(DL$8DD$,A\A^HHH`Ht|$1HL]HHHhH1y 'Dt$HuL1Dc]D$8HLA~HHHPht$(DL$8DD$,A[]HHHpHt|$1H1L]HHHxHy Dt$H%L1D\HL$8HA~LHPxt$(DL$8DD$,AYAZHH H^|$HֺL1~\H|$HL1_\AwvXAwH$dH+%(O(HĘ[]A\A]A^A_T$H5dzL1L^AwwH$dH+%('HĘL[]A\A]A^A_xH5'LfC %=H5LffDH5ϲLfhf H5Lwf;f|$S H Fƒ AD$ 6D$ Ѓ Vȃ  H5kbL1W]Dt$HLHoDkHLDHHH1bZH|$HLHH1FZCtHH@H|$D$HHcH>H@] xC tyH=y1辐HNjC !LHsIPAHHHL < #E1m|$H|LH1|Y@HDt$HpLHH DjqHP\9HH(Ht 1HDLD%YHHH0|$HQ1L YHHP0Ht|$(tD$LxH@HH8@]|$HTL?`HDt$HLHH@D1XHLDH'HcH`1XHLDHH\1jXHLDHHX1PXH@\HHHcD1HL+X|$H9|$8L`PM`I$P\€\L$L|$HسL1WfH2 HLbPHL9EDtHuLmDH$dH+%(#|$HĘHŮ1[]A\A]A^A_VWfDH5Lwbf|$|$ @H-|HSH|$LHɮ@(V~HzSC |$HKL1HV|$9|$8D$8HHSLHD$t$(DL$8DD$,x]A\Of|$뉹H5Lzaf.D$0S \@C %@@=@@HHPHzBtBHbHHHH |$HI1LU|$HrL1UH@C HHRHzBEBH~HHAHpxBBH~H~S H ED$0ACHE1E1HhHL$0LOaXZJ H5HL_,|$ C < F%=  1H=t2E1HHHH HcQHqDL AL AHcA4hDt$HLH1DSHLDH>H@ HcH1SHLDH0HH(kHLDHWHH1SHK1LHDSHCH(HLD1HiSHCLDHH1NSHCLDHޯHH12SHCLDHүHH01SHCLDHʯHH(1RHCLDHHH 1RHCLDHHH1RHCLDHH1RHCLDLNrHHC1~RHCLDHH@1]RHCLDH}HHHHHAHE16RHCLDHgHH8L^ЍJ |$HL1HsQLu-1`HDt$HvLHHD1QHDLHgHH 1Q|$8HcL$9HHp Ht$HHxHL$HHAL|$0EI1HH@pLPD$(|$(D$8LHD$HLDHL4HHL1PHLLt$(DL$HDDD$,L$8%IY^H9h|H9l$uL|$0QCHK|$1LHPHHhA LV|$L1HLOPHC1Ht-HHJHH HDH8HHH9sDt$1HULDOHLDHHH1OCL$8|$9qHHxcHD$@)ω|$HSH|$@H,H|$G/D$HD$X|$HD$HDwHEHD$(sIċ@ % =$ Ht$H"L7LHT$XHHEHE1E1LHD$8hHL$0z[IOLDH1NAYAZAD$  CtHH9h0uH5L1QT$(H5yL1mQH2H9 LTD$8HDt$(DL$OLDD$,HHT$@_AXHmHl$D$S H uH[H5mLZDL%2fAI$pAfDII9A$AtIt$LcDt$HK1LHHDMHHCHR H9H)H52LHH1?PHLDH HH 1dMHDt$HLHHD1DMHLDHHH1)M11L}iC @| IH lHxtIGHHDt$H̥L1DLL$8|$9mHCHD$H[HHxMHcHD$H<D$(AL|$(DAE1D$8HD$LLH\N$1ISLHDLt$(DL$HLDD$,HZYL9p|L;t$uL|$(HBH5L/WHH@%H=H5LVHL%42PMt$@IM9CA$tIt$LaܹH5LV]IMGHBHt#A|,HHuHJIIWH@MG|$1LHfKH5jLWH-1DLpDHL9tEAtHuL`IMGHBHt#A|,HHuHJIIWH@MGDt$1LHDgJH-2HK HLHLDH9LE13JH9k |$L1HJDt$K81LHDIK<1LHDIHK@1LHDIH{@H5LE1VVCHUH5L1gD?Hj|$HLIHHH(1{AHQH5$aLNH-u1DLHL9tEAtHuLCWIMGHBHt#A|,HHuHJIIWH@MG|$L1H@|$HݠL1@C MH5_LKC cHPHD$1LxmH5kL1E1CH|$`1HsdIHHHx1DH1HtDHHu9OHcƒD`A9DLHcH9vE1Hl$H\$0LLfDDEtBHHwLH ]_H5HD1SBA9tH5H-L1=BHA9})LHl$H\$0EfEt%@IcDfAD`*XAu߉ ufH*AfL I*L$0f(\[Y^XD$$ED$|$HL$0L^Yɬ>+H|$HLHP1>1H=)^LuHŋC  Ht$X"H@;HT$XHƋC HE1%AHHAHL,R|$HLH1=H|$H;LHcH81=1CtHHH0|$H"L1=1CtHHH|$1HL=Ct$HBL9BHtz8tH5L1"@ LCCrHHh HD`HtI$@]1L>HH@ HhI$@]L=HH@ Hc@DI$u@]L=HH@ @DHHD$I$@]L=HH@ LcpI$@]Lm=A@] I@HtHHH)H)IHIJLJH=>U1ZlHCHHB HDBMKM1Hމ1HL\$R/L\$HމH1MKMC-/AFRH1Hމ/AVAFg,D1HtHމ.AF1HdHމ.AF1HVHމ.AF1HCHމm.AF1H/HމM.AF HHމ1-.M^ L\$RML\$E1E1HH<IIsL\$ HPAC % PD:}HۏHH1|$ -L\$(|$ 1H6HAK-_AXH5ЏH$6D$H}IV(t$hHDL$HDD$AXZL\JATI"_HLE1jHE111SXZA\fATISH^HALjHE111PAH[A\HtG u13f.3fDr3fb3fAUATIHHR1H8H@1L/L(E^HLLHA\H5'1A].fDAVAUL-91ATUSIEHt[1L%fHHt:IE,tH91L4XH]LHL1.Hu[]A\A]A^IH~1AIIAH8IH HBHzHRM9tEDI3HH IHHH1H1H HHHH1HI3HH1H M9uLOcM>AfDEAI0L EAI(L EAI L EAIL EAIL EAIL EL H1HH HHH1H1H LHH8HH1L1HH L1HH H1H HHH1HHHH1HH1H HH H1H HHH1HHHH1HH1HH H1H HHHH1HHHH1H H1H1H 1HA H&H=Hc4H>r3$\r3$Xr3$Tr3$Pr3$Lr3$Hr3$Dr3$@r3$<r3$8r 3$4r 3$0r 3$,r 3$(r 3$$r3$ r3$r3$r3$r3$r3$ r3$r3$3D$DFISIEizID3A(y$NDA+9AAIA)A A1DDAAD)1M9wILJ1MIIM9ANLGMGI@tA+8ND HtVHtIHtRщ[)11ȍ41 1Ɖ) )11A@AAff.W t$1tHGP HDDHG1PuHx[f.AUPATUHKHh8IH1HHH$HP0HtyHLj AT$@I AT$@H@0HHH@ hHcHHwvLHLAO]AD$ID$HLA\A]f.AD$@11L-8F% AD$@f11L-F11f.LHH 1~f.ATIUHHHB\ĀtKff.AWAVIAUATAUSHt$ dH%(H$1,Lx@KLxE IH8=LLLNAUHv2uDAUIt/‹%D=Dt.uAE%D=DH5L"AELINjD%@=@uBHH%@=@t=ELL5$ffA t-DHAHvALH-D}HEuHL)HIHiH?HHHH<H=oD HI;HDLLB8HOM IH;AULLtDʋDD8HH4DDt HI>H<2L|$LH3菙I>LLr:8t9t$ I>D>y@AE%D=D(H2L|$H3L$LE11L-2HdH5LL肙t$ DLì>/H$dH+%(!Hĸ1[]A\A]A^A_HLGt4HcPHH DDut LkLA A> }&}1IEH9}2E%D=DEuaEbH5Q2H=}1kF}E9E1W:Ћ%D=DKHuFHsЋ%D=Dtff.AWIAVIHcAUATUSHdH%(H$1H2HHD$H>280wHbHcH>E1H$dH+%(cHL[]A\A]A^A_ÐHa2;H M9tIMoG % =p Ht$("HD$- ЃHAHO Ht$(S#Ņ;7 MM)MoIM9:INL)HMtD|$f8tIIM9I}G tuj$AI}G zH;L@ }DEu-uDH)2; LL)HxIG % =wAHD$IIoG % =7 MA; MI)IoIL9INAL)HMl DtLGAP j% =Ht$( Iǀ;' HT$(HvH1LHE t$DL;tIHI9lH}G WSЃ DHGHt3H@Ht*HxHt!t4;AV E 4I n@Hq2; IoI9IG % =?;1 MI)IoIL9INAL)HMlf.tLGAP % =jHt$( + Iǀ;oHT$(HvH1LFHmDL tIHI9H}G WЃ HHGHt/H@Ht&HxHt2;A EM K3I r@H2;LL)H8Hi2MgIoIHI9XE1H9L@;H MI)IoIL9INL)HID L|$(HD$ftLGAP % =2 L Iƀ;YHT$(HvH1LHLLIHH9l$AH}G XЃ IHGHt0H@Ht'HxHtI1;AE@1I o@HI2;XMIoM)IL9INLt$(L)HMlGf.Ht$0L36xD$H%=@u~*1IHI96H}G % ="L ;IHT$(HvH1L*H!H228aLIf)D$0)D$@G % =;HD$0HD$8AD$ % =L;HD$@Ll$0HD$HED1a;;IHF28sHt$1DD$DD$Xf.H;LH@HD$(H28Ht$1fDHD$I/LL$MH ZHXH5_U1I7 :f. I}G {HnI9.IFH)HLdfHI9H}G t>tH2H2DHY2HP2HH@ /@I]GSHHHt$(Af.HH@ @HH@ HD$HLwH@HD$(HD$I".LL$MH XHWH5S1I7 f. %=G 0f.HLH@HD$(HLH@HD$( %=G 0f. %=G pf.[H}G H928Ht$1H}G H}G ҃ LfH28Ht$1TpH28Ht$1,GHAHw4Hl$(HD$DHHH@HD$(IG % =7ŅD$҃ OL!f҃ _LufI$H@ .HD$f+LL$MH UHTH53Q1I7`fDHD$+LL$MH UHTH5P1I7fDHH@ @H28XHt$1GHٹ28Ht$1lH28HHt$1D7H28Ht$1Ha28Ht$1LGH}LGAP "HH@ H28Ht$1LH}LGAP *IwH=P15ff.AVAUATUSH@tZ%u1@u=SIu0[]@A\A]A^fDcD9ub#{[]A\A]A^Ð-tDc-A9tDc D9tCH11AŅD#{[]A\A]A^Dc 'DL5#{[]A\A]A^@HcH0HDHIoHcIHD9btyLW5nfAUATUHSHH~G % =tz$D,VtxHEHmHxG % =th1A&V[Rt@H[]A\A]H@(D,VuHE1HH@ E % =H HHDD[]A\A]-E % =tAH1HHDD[]A\A]L@HDD[]A\A]/HEHp fDHEHp vAWAVLvAUATIUSHcHH~dH%(HD$x1G % =*p0D$ HŁ\$I~G % =80MnE1AAƁW\SAE <E11ujH$$WH$K\SAHD$xdH+%(*HĈD[]A\A]A^A_@IEHP E1}HH@ @HD$ Hh \I|$Mt$G % =/IDl$ AE ApE% =1Ht$LOLL$HM9H?2LLH=JLH410@,AD$kE1A HL$Aƺ11AL|$`M1AxDF1AEMEDIELxIEIUH@AU %_D@AE LD $#D $fDt$ HщD1]ADVAkfD1L^-HfDAhAE E\<vi uGIwu,IEH9pr"IUfHLh @L)H1LAE 멾LAE DLAE IELHLL$IUf.LxAE A #f.AVAUATIUHHdH%(HD$1G % =,HI|$Ml$G % =+IAE % =HL\H$IHLjr D xuDLLHT$dH+%(ubH]A\A]A^fHHh J@HL` AE % =iIEMuHPH$k!H=jJ1p-AVAUATUSHHG % =*HkIE H{G % =E*IH{ G % =*IH{(G % =c*HËE %=t 11HD /M&Iu Eu HEH9psrH*&HDALLvIHxAHEIT$HPE HU%_DE HEH@E@H28u}[L]A\A]A^ÐHuf.HHX $@HLp @HLh @HHkL` E |11H|kE11ɺt1H2jHJIAff.AVAUATUSHHHdH%(HD$1G % =(HH{G % =HL$$H)IHLH*HHH9LHIIMcKHD$hIII9%HH+D$|$EMILl$  AIUHBAE AE fHL`Ld$XAE  Ht$` L^Hl$`HAE Hݩ tE1H9+HfA|FIH9uHt$X1L}AE (@=1Ht$`LAU HHD$`H, JH=ˢ2HI# $-<$ H\$I1E1H9Lt$E1D-H=2 Hc4!H.HKH9wffDHH9SDHHLF?A0H HwH"H)HHHT$hH=HT$hHLw Lt$hH\$hH94LH+D$<$5AIUHBAE  AU IE1H9v)ADGfxIHH9uAU @L; fD<$LL9+LE1#DIf9tHHH9r HALOfyfIfHvZ|$tSH$@  HT$hHLE HD$hHIIfDH11HHs]HHD$hfD$Lt$0E1Hl$8[f.H5Y2ú H!H LD$INL9rDHI99HHH<>?H HwHL)HHL$h@AEHHD$hHP($fDIEM}HXH\$`f.IEI}H@H|$0HD$`DIUHRHT$X2fDHpHEH8G % =o%HD$HAE H'fH*Y$ qXX !8f/H,H|$0HD$8H9|$1E1H\$8LH0HHLE1L9w;IHHH9 HALOfyffIHD$HAE fDƒ?HȀEUHD$hfDIUI]HjHl$`fHƒfHH H*XfHH@ HD$HAE qHD$hItGfVL11I}H\$hIS|$}HT$hHLHD$hIHHI<$tI9tH11Ht$L\$HLt$hf.HD$hA6HfDCD|FDHL)IEHPAE &fD@0H6@@0H@IEI]H@HD$`@f.IEMuH@HD$`f.H2E1HDh#A H9AH=2D H!HHsH9r4@HH9#DHHLF?AH HwHHH)HHD$hHv0AIHH9KHD$hfA|VI@\H,H?cDHL$hHT$pE1HHAHjH$ZYDL\$HL$hHLHT$pHAE1jH$_AXL\$f.HT$pHL$hE1HHAHjLL$}@1I@HH@@GH:Huff.AUATIUHSHH(H:dH%(HD$1G  Ht$"H;D$IŋG E %߉E HB tHԖ2HB8u E HML$LC1HD$LHPHT$ 6XZE@|$tH28HD$dH+%(H([]A\A]@HLoD$HRHT$I[1>f1ҾL!7AE % =t9HDLIE1AA D?IEMeH@H$uH5a(1E1AD,HHAT,HHAD,HHAT,KHHAD,KHHAT,KHHA,KHH<1@1@1@1@1@1pAT,WH=,'1 H=;'1t @AWAVAUATUSH(dH%(HD$HHh@@ItH=j'1+ HxE HHt$HIŋE %_DE C % =tHIHLp8Lx0DEAFDAAtH1HcHHL9LIc1H|$HDHL9r HL)H9sTHH)L9ITLH$E}HEH9PoLmH)1L^HEH4$HpADMHكD!HA" AE@HD$dH+%(H([]A\A]A^A_@H=%1rfMIcLA1LÃHcLHI@A t8AtAwANLHCD=ANIGd=WA@E1H5$LGd=CD=LHCD=LHCD=ANLHANCD=LHCD=pHHHT$@H|$HT$IsfDH$H=@HL` @HULmHRHT$ B1ҾHuE +D1@HDH=#1AWAVAULcATIUHSHHHdH%(HD$81H9q11HmC % =Ht$ HHD$ E %=t 11HXAD$ % =[Ht$ LILt$(C WL=2I@8SLt$0Ht$HD$0H|$ LfAD$ t.I@8u%Ht$H|$(LHD$00 ÄLt$(AU LD$Ld$HL$ %_DE M11HHL$L$XHL$L$HM9HEMFIT$H9PL`IkHD$ H¨A^A_A]uzI_HH@HD$HCSAD$ H2H@81Lt$0@LA^A_A]EHo28HD$8dH+%({HH[]A\A]A^A_A]tF u11HDC %= Ht$1HHD$ @I$Mt$H@HD$11HQE1A^FA_A]IHT$ J|#fHT$ HBHHD$ HT$(HJHL$("CH9uH|$(@.LMIA^A_rA]HT$ H|$(jHH@HD$HCHD$ IT$Ht HD$ HPHHT$ HT$(HzH|$( CH9uHT$L9vxH9t$(L)K4&1H%HEHUH@HD$ LHHD$ HPHHT$ HT$(HzH|$(2CH9uHT$L9wHT$L9vH9t$ tJ4!L)1H}fHEHPnHD$ HzH/f.HD$ HVH@LfHH @HHHL$H$,H$1HHEHxH)HHEHL$ fHс28E11ɺt1HH]IT$0IIHNML#I H L MHH L#OLJMHL#OLJMHL#OLJL9uLJIIHNML I H L MHH L OLJMHL OLJMHL OLJL9uIINHfL M3H I LLJH M3HLHLJM3HLHLJM3HLHL9uLLLH 2H=bJ41f.AWAVAUATUSHL%?2L-`2I$IEZ"L0u-HU2HHcA(H4@HHqHXB f%f=f=t_1f=@E1LbtjI$@#Nt-LImD 2]I$HH[]A\A]A^A_@B#E1L<A1<@uI$ImHH[]A\A]A^A_A1Yy,t*B f%f=&LfB f%f=LqI$D@" ~@#HPH2HHAFIHxHht LHH)ŋC Hك2:HkC IEHfH2HH]HHHH2HH-2HH HCHEPHSHfHUP@@ @0@@HH2HCHHyH8Hځ2H;8Hb~2E111kHHH߁K PH@HkHMtAFLp@IEH@CH=1DI$ff.PL1aHu`H1LHu\{HHH8eHfDP AVAUATIUHSHPdH%(HD$H1HHtHPH^{<HaSAA@A@HDFAD6H H^v,HD$HdH+%(HHPD[]A\A]A^AńHl2fo Himply asD$8 "%sHD$0"fD$A%H=HtHL9r!HHL9tHHH0tH<E1IIDD$ LHLAML$IAf|$ uDLmHL+IHT$0H31ɿL$L$E1IILLH)H~@EH 2 HD H9LMH¿1L$H5(L$NImff.fAWIEAVIAUMATIUSHHX$D$$D$ dH%(HD$H1D$<HMtAH+H}H;L9rEH5j2A H!DHHML9rgHL9S9HIH<>?I HwH%H)HHL$PEIAA_I*Hl2A=HD$PHDHJ0H9H\$ Ht_MHL$0HT$8L1H5HE1H\$(HD$ HD$(AuHl$PL9HD$@HtH+l$H(M?IGH$dH+%(PHĘ[]A\A]A^A_fHMtHHLHD$)HD$Id@L1DL$LD$TLD$DL$|$IL$Hu |$)HH|$` 1DL$H|$跻H|$DL$HDIMAH5K.L1讶fH|$`L 1HDL$H|$KH|$DL$HfHD$PAA HdIL9VfHl$ H\$(E1HD$ HD$(|$Hf.|$JHxH]HDA\ZL$HDAuD$LtEuHT$PHL9sH0H DL$H|$`AH 1H|$(H|$DL$HfDfoD$K"HD$P)D$`f)D$pHHD$8HD$0fDA%%A4AQ'H5HcH>11LAHRLHl$HHHHHH H HH)H9sHu'@H@}yH9s]H8g2H1fH9s2HH43HwHH)HHH9r\$H9D؈\$T$HA\ T$aHt IFH9jH|$`DHT$XHL$PE1LHAHj,LD$hXZT$H9T$HL褼HHD$HoHD$8HoHD$0AuHQHD$8HD$0Ht$MHHI)Ht$(H؃L;t$vNHt$(H)t$|$K"A"y"fnvfDHD$(E181HO}z1HHHL$ʸHL$HJHwHfHHUH9r%HH#UtHҍBHHHl$H9r@HH9}yHL9l$2MDL9t$AFIj11PAE1LL蓽HEZYL9DIWM/H9sH<3HxH!?3L B"@,MI$HHC3HLr@3I$H ID$I@XHHIPXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @AD$ HD$N$HHBH?H,H=3H8HLH =3HHAD$L L HH-?3HEH8ȔHmIH A3H-?3HHrH1HcH HH3H IHML)IHL$IMKMI$HHBB3HL>3I$H ID$I@XH;HIPXI$HI$H@I$H@I$H@I$H@ AD$ ID$% @I=AD$ bHD$L\$HxI$L\$HB ID$I$LXHEI9v3L;n~LnO,IUHEIL9I?LI4$MD$HH~LoL9|O,I}HtwwfLhAD$ 1fDLLHD$(MD$I4$HT$_DH+D$HHEfDH+D$HHEgfDH,Hi;3E1H8HÇH T;3HHx LD$LD$-D賗I1H5 蕡HE@HD$辣HT$@kI*( LD$(L\$ LL$荠LD$(L\$ LL$fL\$ LL$L\$ LL$I9( LD$/LD$DH5QD3H=1kff.AW1AVAUATUSHH@3HH@Hx(0HH?3HHcB H @H HBH< LbHI$C HkE <HEHr H90tHL%i93I$HxtI$HHxOH0<3HHh0Ht{HCH]HLh EHtdHHHf.CHMtI>t8HCI<$L<LFI$I>LHtGH8 H9uH?3HH@Hx(H s?3HHRHR(B@u"Hs;3Hx#x4HH[]A\A]A^A_ËppH?;3Hx#yH?311HH@Hx(sH(Ht} t$H;3Hf1虦IDI$HxTI$EH HhH衠:Hr8B]tHH H=HD1HHp HEI$H=Hr H1AUATUHSHGt)H@PHp HtPneu~wuHKHcAD tE1E1DL^fDH43HD$1HkH-3H8HtwwH\$HyHD$ 1Hǃ@t!HHp HtD@ne/~w%DwwIEH@DHzG % =t%HsHE11AfDHHwH@HD$0HA@ $蛆I ̏Hx袒蘒莒d脒z HHA)3HHHHS+3H33HHPXHff.SE1H11ҾH=e{HH\HH\[AWAVAUATUSHH<$HH*3HHH@HH@L H)3HHHHH-3HH-n*3HH HCHEXHLH HHUXHHHH@HH@HH@HH@ C HC% @C ZI<$E1]DL;xLxNH@L@IH'3IEEA$ IIxHtI-u"I@H@(HL[]A\A]A^A_LD$FLD$H$3IHcH9v}IMH| Hx(LD$L9/HYLD$IxILD$t_IeHGHL@MI@IIH@(IEIA$MIDH!$3D98}HCH@8HHDHL` H"3HHt x ~LD$˛LD$HLH5Ѳ1LD$}lLD$4LLD$背LD$LHLD$@3LD$H@H@HqHHx(Hs\ATIUSHdH%(HD$18|$LH5&H1xhuHD$dH+%(u&H[]A\Ht$kyfU1HHSHdH%(H$1Ht>HHt6}/HXt,Ht'HH=X.}xHH9$u-HCH9D$u"H$dH+%(u'HĨ[]HNHH=L1腙SHH HtwvwHC 1[Dۄf1雇ff.1Ҿ1~ff.H}!398|ú1Off.@HM!398}1Ҿ1"fH-!398|1Ҿ11ff.@AUATUSHH 3tRtm1Ҿ1识AăǾ1蕆tptlHD[]A\A]H1Ҿ1[]A\A]XqAătD1/HD[]A\A]ÐIŋt3qŃt!Ǻ1AЅEAE5*AVAUATAUSH83tAtTBAŃtzǾ1lt_t[[D]A\A]A^Ð[]A\A]A^fD3dAŃtD1[D]A\A]A^IƋuDcŃt!Ǻ1A_APEfAWAVAUATMUSHH$ H|$Lt$0H $LL$D$$0L$@D$ H$8HD$dH%(H$1HHHtH<<.<>VH^AH|!Ȁ-„t EM#Mt$LDT$rM9DT$t Ld|DT$D;$E $DDT$dbDT$H3IcH8ЂL0A~ IHc$Lp H@ H3H8藂Hx HMc|$ HLp t6QAƅH+Lct$L}(H@1f{{LL`LAH$(Hk߅t#Hu E=Hj(MtrfoD$0foL$@foT$Pfo\$`fod$pAEfo$fo$AMfo$fo$AU A]0Ae@AmPAu`A}pAH$dH+%(6H[]A\A]A^A_@DLDT$}DT$D$H%=tSH<<DHT$,H$DT$D$,~DT$Hƀs`D$H%= @H$n<<YfDHEHH‹%D=Dt|$0Ƅ$r' Ƅ$b& - $D$t$ 1LE1PE1H€HD$Y^D$H|$uE<:tt%@=@1f $EqEHHƋ%D=Dt$A0@}H3@-" D$$Ee|$(Ƅ$w2Ƅ$b4$HT$ LxHD$1}Af.HLLjUPAR$P$P$L$LD$PHT$HH|$XLH@H$dH+%( HĘ[]A\A]A^A_@#T$0T$@D$8T$(@u@<<$LMM9$<-}|AH- H@38 |$0Ƅ$r Ƅ$b4$t HT$ LD$GwD$HD$IEƀ|HEH‹%D=Dt1lH|$HLD$MD$L1f.HD$2fL1VOHfDHi38LU>Ƅ$wH}|$(Ƅ$b&‹%D=DuGHH‹%D=Dt-$t$ E1E11PLH|$3}HD$HAYAZH,$AA1ENU:@@ f$ HT$DH=1~LIH)cf.% =Ht$xJIMLT$xIv+IR1LLT$PLD$HQLD$HLT$PH'IzLD$PLT$H\yLT$HHt$PHBL袂Isf.<-#HIEH}Ƅ$aƀaU HUI9v A|IEHƀ<EHƋ%D=DuBHHƋ%D=Dt|$0Ƅ$rƄ$b@-u z@D$LHH)1蒂E11E1HD$xHD$x1LPj{HD$_1AXD$;LLV$HD$1A|$8Ƅ$tID8|H5 1LD$JLD$hD|$@Ƅ$tA|pH28/EAL͈$f.|$8yƄ$tlAxD<$E8H51LD$0HT$[LD$0HT$H5 1D$In 1D$HD$A=D$(HoD$EH|$Ut 1%D=Du)DEH%D=DtD $EEH0H OL1ҹHH)DT$xXDT$HsP cH@HVHPHILzHT$MnLDT$ XLil4JDT$ HT$I9MDT$HT$ zDT$I90tDT$HT$ I9]Hsu IEƀs$011T$(1LL$ D$fL$ D$HHD$A1A!|$@Ƅ$tHH@HD$xLG6L1H)E11E1HD$xHD$x1LPj~wAHD$_1AX<$E%D=DHD$ H8G @hEH0H HD$ DT$H87mDT$HAIGAGH9w+f.HH9tH DDtEH%D=Dt #HHH%D=DtIH51WGtЋDDt<:HoG<$HD$IEƀ-_H|$AA1D$BrD$HD$IEƀ-1'EtЋDDt<:DT$ Hnq<$DT$ HD$IEƀ--H=Z1wD$(HoHD$iD$1MHD$@LD$0HT$IxHD$@HT$LD$089@L$HD$jiLL$L$H H˒1H54I7D1E1HD$DT$VDT$HD$ H8G % =qD$cD$HE111t$(D\$(D$E1E1Lt$ HQ1HtHD$HY^D\$(D$A!ø IE<$ƀ>"LLDT$ OD $DT$ HD$IEEƀ|1 |$@<Ƅ$t/1Ht$xHDT$oDT$HT$xHwB$EAɃHD1Ht$xHDT$koDT$uD$E.D$gD$ 1H5*1LL$XLD$PHT$H9TuLL$XLD$PHT$HAx'D$EHZ28H5ǐ1LD$(DT$SLD$(DT$D$L$t$ L$E1E1LHQ1AbrHHD$A[ZD$D\$(ExsDD\$ D$ED$D\$ 1 HHP HD$8LD$(DT$uHD$8LD$(DT$*1HIEƀ<1h-H=_1sIEH=%1sHADEL\$HD$DL$ EtEu(HcE1HHcILH>IcH=,1-sff.fAVAUATUSHHHHHAI|M-L@(L9AMA eH{YAAA!HHCH@(Et;H=-MYCH5E1HIEHP 1[eHD[]A\A]A^E1td HD[]A\A]A^fDHCAH@(HD[]A\A]A^f. NH{Y/DLdHHx(XAAA!@HCH@(T$ bT$ ‰E֍q@~ Ɓ ʅAAA!H 2H2~@3BH5lE1H1 dHD[]A\A]A^f. MHE1Hx( XE1fDAWAVAUATI1U1SHH8H ^H{ 1ҾHD$ x^H{ 1ҾIe^H{ 1ҾIR^H{ 1ҾHD$=^H{ 1ҾHD$(^HHHx EHL$AIH9H@HD$G % =\H L@11AHD$H8G % =(>mHD$MHH;D$EHD$ HtlHHtdHHHt$E1DDnyIaI&:_1HD$ Ht$DDLD$HHHDND@IHL$DDHp!NH8D[]A\A]A^A_HHp I|$Ht$(`D$I|$LHt$(|$[DHH@ HD$I1DHpwmt`&_@H`8WH=>HIHp1 nDc`IƋ&_IHp@hHxE1PHLD$A&_IHp@u1DLD$lLD$HA8VH=HHD$ HHPIHp1Zmf.IHxGHs H|$6IHt$HxrHs H|$LD$LD$HD$ H|$HHpRLD$Hs H|$LD$yLD$HD$ H|$HHpVrLD$l1DkxoA>UHL$H=IIHHP1>lA&t _Hs H|$LD$LD$IHxFLD$qA&t_uIHx^FsfAVAUATIUSH~ HH1ҾYH8G % =%iIMt$MtgH28uH]2u1LH?H} 1Ҿ@YH8G % =hHIHH9t)M[1]A\A]A^DHLh j@H} 1ҾXLHHh RI$H@(ID$MtL?1Hiy\&t_uHDLvg[1]A\A]A^HHX ?ff.AUATUSHHG  HGHHhHL-1HULZHHHx HLUHA?t$HEH@ HEH@8HEHP@HPHHEƀ HD[]A\A]f.HY2H8HE1t[ HD[]A\A]DE1tf.11HAQff.AWAAVAUATUSHHL-2dH%(H$HGImHpH4$Ht"H8{BHHt H[H?2H8 H$HtHH 2H8HGH@HtHxt Ht16HK2H2HCHx(HG{DHH@HHvHCHx(A HHZL5P2A>^HCH8HHQQHCH8G @|% =lHt$H2HL%c2I}I4$EH=2HH%D=Du@BHH%D=Dt|-u5HBRfDPHHыDDt|HT$HE1E11Hf4UHCHx(GcHHHH$IUH'H H HtH2H8HtHHx}H=6}CH%L1fDHBRfDPHHыDDt-PHHыDDtH1H5vXLC1AHߺH5@HCH@H@H$dH+%(H[]A\A]A^A_HHwH@HD$HCWI<$Ht$P(HxOD$h%=t?I$H5,1MH1[H@H8f.MI$H5ĀH1Mf.HCH8H";fDHD$PHT$HE11IHHD$kA>H|$HD$hH52t$l%t$t$pt$=H2L0MIHHn2HH +2IH IFHAXH*HHQXIHIMMH@IH@IH@IH@ AF IF% @AF A9tTA9*NLϾ*LL$|SLL$HHD$(LH~GH<1LHLHT$HI4$HCMU1HD$0UHD$HCH8HI2HHD$8G % =1-I/LLD$ ]IHLD$ H|$L)LHPLH|$H5`~;fD$(HD$Hx4|$(D$ gfDD$ EFH5&~D1H.HE1E11jH5}jPH|$X 3H HT$L\KHO;LH?KH2Hc8cLH K;?HcsVLHKH=}.wDHOVLHJH2H80GH2LI@H8HpHt$JLE1E1Hw2H p1UHH@Hx[HAv:AvH<2HH@H@HxHRH52Ht$JH20Hc28MD$9D$luD$9D$pH=2T$t$8dSHCH8G pI$H5Yz1R1H-:I}^H[2H=2H0F7?HD$p?HD$pHD$08HI$H5zH1aR1H7-AvAvH1H1tVH@H8I$8-H=/puFf.HQ2Hx"H2L9 1LHH}H3tH}?HNH}D(HFD+H}3pH}7;_H}?HLH}Hb7H[]A\A]øf.>V8H}]D+11f.Ht7G w+HGHt"H@HtL@MtL0HǽM HHHHt G v蒽mM 1HHGHtH@HtL@MtL=3fDATUHHt`G wTHGHtKH@HtBL@Mt9LHAkLDžxEEuHx;HDH]A\UfۼL HH]A\ÐLH;UHSHHtN:t[H\2%D=DHH{:,H+HHDHH)HH)uH1[]fC2HsH8Ht"G f%f=H2%HH5s,1bJHT$HH|$W:DHH@HD$HGHHQH H|$HT$Ht$#HT$HD$fDHt$HPHfH|$PW1GH"JfAUATUSHH2dH%(HD$1H@"L`(H2L9  H2H8M?AT$ uH2AH81fDHH2L"1@Hw2LY4H fHT$dH+%(H[]A\A]Ð@#<HZ2HL AD$ @oI|$W Iʀ vsH21E1f0Ho21H8H2H8?I}HFDž2H52?Hl2D f% =HL  H$HL%2H2HI<$H>I$H;LhH2fG f%f=H 2%L$H$HvH1H&HHxH52L)7H2( >Xt2H"6Ht%| uH52Hup 1<@IT$H}LjH21f:H2H8L"1I>MrI}HUIEHx0HT=(GfDH2_zE MDI$Il$HPH$ifЃ Hj2L; tHF2f BLM AD$ 0H)2fDLKILHRnH5j17a H2g^CI I|$O %=u vmAD$ JO IfDHY21fH 21H<D H;2IEff.AWAVAUATUSHL%2dH%(HD$H"2HL(I$@"tjHEOH3HHD$HHEIIt$1L?It$1LH>1LLI>E1IHtHHt D@ A AE1MtIHt DP A AE1MtIEHt DH AAH3HH$H)HW|$L]E=EH3HHEHD$HEtIUHB!MHD$LIH\$AwAwH ?3HcD$HHHDIf.HHH@H1HHG80HHx 1fH;=!3H<$H<$Ѓ sIEHrD1A(IH3H=R1DL$L$NSHf)L$DL$IE@I}G)ID $P HHxHq  TD $_HDL$D$@H;(D$DL$! %= AE SW HHDL$L$@H;(L$DL$HHDL$DT$D$9DL$DT$D$HuL}AE H=L=SH]HD$HEHHHx(HJLcIEI}W %=1ML8TH5 QLyAfAUATUSHH3H-d3L-3HHHH HUHcH XIEH)HuKHcHfHHHR2HHHx u L1HHH@HwHHG80ufDH;=3xfDH|$H|$H=PEH5IE@AWIAVAUATUSH8H3H-3dH%(HD$(1L53HLmHHLH IHcDxHH)H%3HHD`"Au/HD3HHcB(H @HHJHD`AH3HL)H5lIMcJJ<-HHAD@ HEA 6E1L|$f%smHH  t Bt$IfHuHA DHpA uH@HH)HGHILLIEIIEIHDHE~,IEIH]HD$(dH+%(NH8[]A\A]A^A_IAt7H3H0JIH]z,AAkHDHEDAH5cwH5 H}AHDL|$EEt1ƒ A D9rHDG EA t]bHAE1L|$pA 7DLLLD$.LD$IHAAH5SH5LaB6ff.AWAVAUATIUSHHt3L-3H63HHHH IMHcH4PHH)HHcHL4HBLx MKH$3H(HHMHH3HHEHEHEHHEHH@ x-L@Ax^CHHsI$@]H@8HHHp(PLHE11ɺPLHuuIEJD0HH[]A\A]A^A_LH58E6HHVfLbHT$6 HT$HfH׾ HT$8HT$H@Lx @H0,MH5mO@ff.@AWAVAUATUSH(Hg3L53dH%(HD$H3HHHHH IHcL,D`HL)HMcJ13HHp H5.83Hպ3AVAUATL%3USHI,$HHH H3HcH PH4HH)HHcHHH.,L-71ɺHLM.H{E1E1 L )HtH@ tLpE1AF < tcI,$[]A\A]A^IH@HI9s1LL HHtHHtHl3HH)H~)HUAF IHtL/HHfHH`HHH=61z2H56.2ff.AVAUL-%3ATAHI3USHI]HHH HcH3HHHH)HL3HL*tn1ɺH5^6L,tTI~E1E1DH'HtH{3HI][]A\A]A^Ha3H0HI][]A\A]A^H=511H55;1ff.H5V8ff.H5'8ff.H%3ATUH-3SHH]HHH HU3HcH PH4HH)HHcHL$HH)L~)tr1ɺH5%5L+tXH=Md$H5H Hf0H LHHc%HHH][]A\ H=41J0H54/ff.AWAVAUATUSHH3H3H-Y3HHHHIH HMHcIՍBHI)IAXHIcLHLsHck$HH3H{HHH[]A\A]A^A_s L8Hc0$HEEMcJo DAVAUATUHSHHt$GHEHT$1H@HHHHHHt$H9rHxu4H1[]A\A]A^DHEHH8tH[]A\A]A^DHQ3HHUH HH3HHHHBH[]A\A]A^þPIH2Ll$MyHT$LHLl$GH̠3HHHHHk3HL5(3HH HCIFPHHfIVP@@ @0@@HHީ3HCHHyH8H3H;8H31DHHHHK wMt:H@HtHHX@HH@H4$'H4$Hc DHHDHfHRfDP ff.@AWAVAUIATUHSHHA3L;MIHH3HL%3IH IGID$XHHIT$XIHIH@IH@IH@IH@ AG IG% @AG HHH=H<HUIIL` IMgHPHߧ3HHD$HxH3H98 H3H 3E1HH9L@HD$H$ HD$H$@L$L$&fDHD$H$HD$H$@H$H$:fD3Hi3H3HHJf IEHx5)I( ]AWAVAUATUSHG Ht-HH 3HPftHt zIAH9HEHxE@L5ɚ3HXLmIHHxH3H98&L%o3I>EI$H,M>Ht.HI|IDHtwwHuHEH@HUHEHJ H9tH)HMHHBM9>IM>uvvuH[]A\A]A^A_ÐH@HMHEHQ H9tH)HUHHAH[]A\A]A^A_f)fDfDHH[]A\A]A^A_f. IHxH3I$HJ2ff.AUATUSHG HItGP}IHt5HΕ3HSHHtMHMLH[A]A\1A]HELHHpH[]HA\A]1H=HCHHEIEH,M&Ht(HEHHH/3HcHM,$HkIIEI$H]H[]A\A]ÐHH5LfAUIATUSHH3H-q~3L%3HH}HHH I$HcHXHH)Hu_H3HH)H~>Hw3HcHM,$HIIEI$H]H[]A\A]ÐHH5BLfH3ATUL%;3SHH-}3HHH I $HcHH XHER(H)HuEt%u$`I$HcHDHE[]A\HcH=1PH5$@AWAVAUATUSHHG3H}3L%3H8HHHHH HcI$DjHH)H}3HHR"u-H3H HcQ(H4RHHqHR*D<McMAHB3HH)HL9'HcH0IcHL$H H,YL4H@J<0Ll(IHHIEM,$HIHIEI$HuLl$MNlRy,ujf.HGH1H5McHcII$H9LHM,$H{3L(H[]A\A]A^A_fD1H-McH5I$NlLH5I$@IcHt$+ff.AUATUHSHH(}3L%q3Hz3HHHH I $HcH4PHH)HuDHc¾H IHLLHpH[ Ift$Hp(F!@t*LnMtAE!@t IE@!@t`HL[]A\A]fHv(F!@uHL[]A\A]HHX {(`HH5E1E@1ɺ1Al$"L@fEt'LLLH]A\A]HH@ x(tHH5E1AUIATUHHSHB % =HÀ{(1H= IHLHLHs HH@Ht[HL%"s3HHL1[]A\A]ifHurHSy3IDHr3L`0HHX {(@HH5E1%@Hz3pI^H=1f.AUATUSHHx3L%3H-]v3HHHH HcI$ZH HUH)HHcHHL(AU uptCсtHq35f.PPuIUH;Ow3uEDHq3H0HI$H]H[]A\A]LpI$AU HxH;s3uH5ifAUATUSHHw3L%~3H-Mu3HHHH HcI$ZH HUH)HHcHHL(AU uxtKuFсtHp38DPPuIUH;?v3t H;r3u@Hp3H0HI$H]H[]A\A]LXI$AU HpH5\ff.AUH1ATUHH=HHH=I1HP HAՁ A t51詺HDHHt]LA\A] fHxHH=p1fAWAVAUATUSH(Hu3L5}3dH%(HD$H{s3H(HHHH IHcHD`HH)HHt3H@#HPHq3HL,H]K )L$L$E1Ɂ HD$L@tHw3H@8u fDLL$LLLmC AE uS%AE @oLmIMcH~r3JHHD$dH+%(H([]A\A]A^A_@Hv3HB8u fHK /% = Ht$H謸K HT$Iǁ HH]z3LMDIIM)LL$I9A DuLL$MufDLL$MIC DuLL$KI,H L{HPHT$OHeu3H@8;I4H:I9:H|9fDH yy3DtwH z3 IH)HT$L9AyIHM)HLtz3A L9<<<HT$MHH=HL)HfDHDIA /w5Hc H>HDIAvr tmtxtsH)H)I"fxuxuHDHHL)HmtHuHDIAv uf.HxuH멀xtvfDHytYfH:xL+I~BAOAAAu0A?AD L tw3ADjHfD1ҹLHt$HT$Ht$MBf.A"ADAGI$HcHHEH[]A\A]fHo3H52EH 1 f[f+fsfDcfDSfDHf3H@#tPHPHc3HL,H1L~AE@u7HEL(HcH=1課f.{HMIfLHH5Zf.AWL=AVL5AUAATUSHQ3H!H7@fE9w LLHHL{(H0MteLH1L1HD#wHtHb3HH€x uHHx@HtH5vuL{(H0MuH[]A\A]A^A_ÐAWAVAUATUSHXHf3H-m3dH%(HD$HHKd3L HHHH HcHEHI)H d3IH8IcATCD%A]D$ L%?L|$ GfDLL航ILLdA>:tLLQ9\$ HUHcL,AE % =uIEMuH@HD$ fHD$ HT$8Ht$(I~HT$LHD$HD$8tH|$8HT$?.tLH=1RfHD$HHt$0HD$8XtH|$0wHD$8HT$8.t]H9D$u|$(f |$0fw{_9\$ HD$HdH+%(upHX[]A\A]A^A_}Ht$@HxDH|$@5HD$8tLH=LH=1nH=_1`ff.AWL=zAVML5AUL-fATL%UH-SIHrN3HfD LLD$QHt$HHE LK% =H1LL$6LL$HE1LLLLL$HHS LL$HHL; 2_3P(L; d3|MtH1LHHLC0H0MtrL{H7L-hI9HL-HI9HyL-/I9ǸLEHEH\ tH})H5d3HL1[E1H=]A\A]A^A_WAUATUHH $HH={dH%(H$1HHH=H@L(HtEH~<|L`uiMt,L/H̭HtLHLH[3LHH0 H$dH+%(uH]A\A]If.@AWAVI(AUIATUSHHLHT$Dg HhLH(HHHL)A|/)A LADH{IIEHt(H9sOHmg3 HH9tg%D=DtH9r!fDHH9t?%D=DtH9s(1HD$HH[]A\A]A^A_M.H)DHHH=d1~ff.ATIIUH(Ix(dH%(HD$1Ht$HT$Hl$H5H}uCHt$Ht(F tHD$dH+%(u1H(L]A\HH=c1HH=z1ff.AWIAVAUATL%Z2UHMS1H(Ix(dH%(HD$1Ht$HT$Ll$H5kM}LUuQHcHt$H@A|tHtYF tPHT$dH+%(uQH@HIDH([]A\A]A^A_IvIHuLH=1LH=1fAWAVAUATUHSHHFILCHE11LxJ D$H*\3H8rE111ҾH=UAu0H}E111HQ G11LxHLxHHXI11HHH@@ IHE<%t 1<@@Ǎ|? 1l1HXHD$WHL$1HC1E1LIL1HH[3HHt@DL1HY|$IE1H11cHH\H[]A\A]A^A_f.w0H HxHcEI2LH=ff.AWAVAUATUSHH8$8HIHFL'HC11Lx. HZ3H8XE111ҾH=;As0H;E111H8 .11LxHHXLxHI11HHH@@ɤ0 Ig1HD$HXH ^3HhHL$1%@#H1 HD$1H@HH1HHLLjLD$I11ZYHHX3HHt@DTL1HI؉E1H11HH\H[]A\A]A^A_DH=S0IHLHcHp>LH=jH=1\ff.AVAUATUHSHHH8$HCHx HPL*IHt(j1HAjE11>Y^HHCHtEHh It`HCHxkIj1PHAE11XZ[]A\A]A^Ðw0H HxHcH8DHqU3L MI$HHZ3HL5V3I$H ID$IF`HHIV`I$HI$H@I$H@I$H@AT$ %_AD$ u1 AD$ I$H@ID$MfDLAD$ f˰I0 ?H=1IH=1H R4H8HtwmwHQ4HH^4H8HtwHwHm^4HHZ4H8Htw#wH-R4HY4H}HOHZ4HEH8HtwwHY4H-T4HH}HY4HHT4HEHHW4H8HtwwH V4H8HtwvwHX4H8Htw_wHR4H8HtwHwHT4H8HtwrwHQ4H8Htw[wH]4H8HtwDwHY4H8Htw-wHV4HHU4HH9W4HHQ4HHUS4HHQ4HH]4HH#Y4HH5U4HHgV4HHYP4HH+R4HHU4HHR4HHQ4HH T4HHMR4HHX4HH@H@H9Z4HHV4HH-T4HHY4H8HtwwH[4H8HtwwHN4H8HtwwHN4H8HtwwH#V4H8HtwwH T4H8HtwmwH9Z4H8HtwVwHX4HH[4HHM4HH.N4HHU4HHS4HHY4HHO4H8HtwwHuO4HHQ4H8HtwwHP4HHS4H8HtwwHR4HHM4H8HtwnwHM4HH"Q4H8HtwIwHQ4HHcU4H8Htw$wH-N4H;U4H}HHZ4H%HEH-V4H} HO4HEH8HtwwHO4HHON4H8HtwwH-X4H'N4H}HHEH-HO4H}Ht zHEH#T4H8HtwBwHT4HHW4H8HtwwHW4HH=X4H8HtwwHX4HH^S4H8HtwwH=S4HHK4H8HtwwHK4HHpR4H8HtwwHOR4HH R4H8HtwdwHQ4HHBV4H8Htw?wH!V4HHJ4H8HtwwHJ4HHS4H8Htw wHS4HHL4H8Htw wHL4HHP4H8Htw wHP4HHM4H8Htw wHM4HH@I4H8Htwa wHI4HHU4H8Htw< wHU4HH:Q4H8Htw wHQ4HHCJ4H8Htw wH"J4HHR4H8Htw wHR4HH%L4H8Htw wHL4HHNM4H8Htw wH-M4HHI4H8Htw^ wHI4HHU4H8Htw9 wHT4HHP4H8Htw wHP4HHH4H8Htw wHH4HHT4H8Htw wHT4HHH4H8Htw wHH4HH5T4H8Htw wHT4HHF4H8Htw[ wHF4HHoM4H8Htw6 wHNM4HHQ4H8Htw wHP4HHaR4H8Htw wH@R4HHI4H8Htw wHI4HHP4H8Htw wHP4H-sQ4AL-NF4HODwIA t+I}MHtwwIAtrHAIH}IHtwwů롃7H=Ú1@HJ4HD45DSfDHG4Hx@HH;=XG4t H;=bP4H-G4H}HHE@ľH}0HEHHtw wE1E1DL%F4HKG4H5ذI,$H@0HI$Htu uHN4H8Htw wHN4HHH4H8HtwwHG4HHD4H8HtwwHkL4H,O4HH9D$<~wHN4HgF4H&L4HHtHPH51NHJ4HHc@ tHPH51$@kHHE4H8wg wHD4H-4K4HL@wHI$L9t!H}IHtww fDHyG4L5zHHLhDbImHtCtHEHULL}HH1~HLMufDA9|HcIlfDLHF4H8HHGH@wwHzA4HF4CHH赡HH{0C C8藡C<H{HHC0CPxHCHCTHN4HkHCHHKHCCH9uHG4HHHG4HH@4HsH4`$H;@ HK4HH8wHJ4H8cHA4H;THE4HHHXJ4H8H)HRG4HHCHt&fDHH@HuH-G4Hf.HH[HxH- G4H}пH]HuHpA4H8踿HAF4H8詿H:D4H8蚿H D4H8苿Hl@4HJD4HB4@8H2F4HE4HHH4HH9F4HHVK4@HxHH;HuH*A4HHHHh/DH}(H]Ht}gt H}xɾHH达HuH@4HH8Ht%P Hx~荾H@4HH8{H@4H;lHH>4+/H辙8Hp>4EH)J4-H-w>4H}HE8H516 HD$H=FIHHe>4H0I48$87BmHZHcH51迯4HcH51褯*qILH5ΩH1褍̧֧§A踧讧褧蚧萧膧|3rJha^xTJ@6D,i";`ܦҦ)ȦN辦s账誦蠦薦茦,肦QxvndZP F/f.yH1H=;HH& HHHH!O<0uH-4@4D$LEMtApx ApxG=LWLT$ MDIA<$uLL)HD$ HT$1LD$Ht$ HA jxA蔈HT$HL$0AXAYHI9 HHD$ HT$nIHEHH@I$IT$H@AD$ %DAD$ H =48 I|$11HطHvHӍBHH"LeI$HBAL$ H=/賆LHCH|$ H|$I$@HwHt$| IHD$(dH+%(V H0L[]A\E1H1H=f.H648hH1H=H1@HYA4Lg}H>4LgjH ;4LgWHPB4LgDHB4HV;4HH|$LMtApApHH0H Hw=4H8G tHHxRHLd$H=4H;貴H|$HoHl$GH 9A4H@HrHt$BH%D=DuH)IHzH-<4H}Htw2wH144H=u/L`Le耄LHHD$L`HK:4LgH@4LgH@41H5HD$H K@4L`Ld$@%@=@ILd$A$%@=@t^H=4uLg?HH|$H|$ 4H44tH>4@Ld$LGLD$G H ?4ILD$A%D=DtL DD HuDDHfPHH֋DDt@t@-uIHL)LH@Ld$1A<$-IHJ54H;<4H-=4LC@ML;44t I9uB@Hk@H54H-44H;4LC@MI9tL;=4tL*H|$HGHD$Wt:=H;4J?/:Hk:4Lg7H=4HoHl$H24H>4Gt/H =4HH|$Ht%D=DuHJ14H;ʰLd$I)I|$8LHB H腴HhHH֋DDDHW< uHT$HH< tH<-HDI6HD$ Ht$ HT$1ɃL$HAAj腁^_'H/4L`LeH=/1&IHPHT$x- H=ǜHLd$L:H ;<4LIIA$HNj%@=@u"fHHT$2H4@@t@:t@=LLH=E H\$% =1"HyHH=lWuuuH)IHzu H|$ H|$D$HEIMWH>;4%@=@HH5zH|$H=hljHD$H=D$豲H|$HT$Ht$ H1AA?0L$H1HHD$(jIHH@DH|$0H|$XIZH H=ܚHD$5HL)LH躆HD$H5šHHP1HT$˅YH=HLd$hÿsHú̃HH"HxVHu-1H=蒱HEILH|$}ߗLҗH|$E1H賗cH-48%E11ɺt1Lj D1MO!H=™1ѫAW1AVAUATAUHSHHt$LD$dH%(H$1!1H74D HH,4H(H94D(E LMEMA9Lt H;uLMHAtQAD$HUH|HHsH9tI9u1H9HsHH9wHH;uHH9uH-4LMtI8HCH9H9v I9L)DkH+94D(H748H24H;H.4HHH]84H8HtwIwH<84H=}-4HHj64H$1D$H44H54HH$)"H_54H$DŽ$Ƅ$HH/4f$H54D H^*4H(H*4H,4HH?HHH.14HH HHCH-4H@`H(HH-4HJ`HHHH@HH@HH@S %_C  1ҾC HH=H@H?,4CHCHH)+4H! H 44H=H HH@Hx HtwPwL-+41H5wI}ܪIEHSHt@HB K H=̖蕅 HX HKH54HHt@HH=HHEH..4HHt@H H=/HHH14HHt@H='/H /4HHt@HH=^HH諄Hd(4HHt@HH56H=2HH1H.41H;:LI@H8H}Hv.4HHXL+Mt"AE O AuAu1H=藫HH)4 H=AHHH2*4HP(̃ H=qH@HP HL,4H蟃H= /H@HP H<.4H wH5*|HhD$9HD$0D$;D$:HD$(EL5L}A?-AG~IHH561As$[f.AH@H@HtHHx(Huf.AHEgH#48H0.4H=vDExIHHLHLxMcAH5.4H‹%D=Du%f.AGIH‹%D=Dt-E71HEHl$HIfDH.4AƋ%D=Du!fDAGIIƋ%D=DtA-cAWH?.4IoI%D=DEtE HDtsHI fDH-4%D=DAGIuAtH"48u H%4E7EHl$HHU'48ZH!4H>'4lH+4H|$(HHtHAHHD$(H{!48H,4H=mDE[IHHLHLpMA>H+4H=DEHHt*H衁HߺH衤HxHt 11Ϗ FH=蹏 9H=ؖ裏 <H=荏 /H=,wHh 4M<A>H*40H=L5IHt*HՀLHգH@Ht 81 H,*4H8E1AoH&4-e@fHH*'4HHx0Htw*wH@0Hu&4H8MH&4HHt@HB0HO&4H8- AHD$(8 H|$(H5If< ueL脒IH`AeHLHCHB(q|H=sH=fHHJCH@HXwsHP4HHHJH@HXHƀ>.HHCH='HB((s1H=ǃHHJCH@HX薚H4HH!48 H4@t H4:tqtH4HHtJ  tH 4HHtJ 6 tHZ4HHtJ `  H!4y H=EMHHtBHvHHHhHt!H5HeH4T$E1AvHvE1H51X1 %.k9Zs9~}H=&4Yff. s8iHHQӀ2w HHrpHVӀ2vHxH5Cy9cH{HHunH=x{{I={IMkuHL[uAa{H|H=1y.gH@H(HH 4Ѓb H5ߊHsE@H|z@H=xzHLt$[1HRHHRHHzHHH cx1qHV 4HRHHRHHHz(HH x1qH 4}HRHHRHHHz(HvH w13qH 4SH=1sH5HrH5oHhrx^sH)E1HH=[w1譇H=V1蟇H=1葇H 41H0p~1H=_upL$H$v`H$L$E1IH$H=1%DH=~H=v1H4H$DŽ$Ƅ$HH 4f$H=e]1辆zH=u1詆$H5luH=f1菆ff.@AT1SHdH%(H$H4H|$D$ H4HHD$i,H4HT$DŽ$Ƅ$HH$ 4f$H 4H@ H4H8H 4H4HHHH (4HH4HH $ 4H1k~H4HT$DŽ$Ƅ$HHv 4f$H$4H8 H 4HHt x tHH5t13VH4Hu4HH9$AH 4fHB4HT$HH$dH+%(HD[A\DH 4HT$DŽ$Ƅ$HH 4f$H4HT$DŽ$Ƅ$Hb4HHP 4f$kD$ 9H 4H}4HH9HZ4HS4H8HH9t*HtwwHt@H!4HH4uH 4H0Ht H 48taHh4$DH@H@HFHHx(H>1f.aMfD{a5Hw4|$ \nH=)wH=Y1ۂH 48t?HH 4L H. 4HHtx tuHLH5pr1S10hH 4 tH4H8tH 4HH 4H0HH4|$ @[|H@H@HzHHx(HreH 4H74HH9u{;f.H= 4L 24L4HHLII+HIRHPILMINL C4MLHMIHJIH4H9b1XH5L 4HHHHlwH4HHH54HHB`H4HHg4SfsH4t'tc%H4u+rftEƉ뿃Hc2H=p1Q#fH4SHH0HtH 48[YH4H 4HH HHH4H[AWAVAUIATIUDSHHHLx@MMw(MjALLjAAHAL#^_IMtH[]A\A]A^A_DLLlH@PHHP H@@<HHHcHHP1ALDD Pj蔀ZYHsH|$xH|$IMw(MiMw( f15f|H{Hsf.HBWUSHH4Hx4HH+HHH HcH 4HHHH)HHHH)H 4HH)H~DlHHEH^lHEH^H+H[]f.HHiHff.AUIATIH=ULLHH?RIHtuvouIt$(F!@uHF(HH@!@uL]A\A]DLHnHtE!@tHE@!@u1ɺmLIiL]A\A]@HhfDAWL=kkAVAUATUSH(H 4L-4dH%(HD$1D$ HI]HHIH H9 4H HcHI)IIcHH)ӍPHcL4HD$AAF ue`jHI9tLHHfH[vAt`HkHI]HD$dH+%(H([]A\A]A^A_fDVL3tHtL|HVHAuLd$IuH5lLptT$ DL5zHHJJ`DHH,E 9QLXtIFHHx |$ H1Lz Mtr<ILzHLDtHcJHL$HHB HRLHLHI L1HAEtIEHp Ht x<tH6LH=_{1hqH3H=z{HH41Dq@1ɺH5uLl&LMHH`3HxKLHH=Vz1pH=pz1pLMLHAMHfFt>HHB Ht2R3I}H;8H3L%3HH,HELM H@LuNHツIFM DLeUHH(E HH+3HH}E E1tJ(tHEA@t#HH@t1H=Af.Ha3HI9EGS[D]A\A]A^HuHF1+IH SE1[]DA\A]A^@HEHtH@AH{E1HoHE80A_SIbfDRA[]DA\A]A^ÐHh8E $ JHHEHx AfDshH"H 8rH;-)3A[pfDLLVI, RkAUATUSHH3L%D3L-3HHHH I $HcH4HЍZIUH)HuPHc1HHHuLHH=ek1gff.AWAVAUATUSHH3L5 3L-3HHHH IHcH HōXIEH)HHcL3HHHH H3HcH2PH IHcL HH)HulB tfHJA Q < tJDIDHH@HtHQHH9wfDHHtJ HH9AvJDIPH5*yXfAUATUSHH3H3H-]3HH3HHH HcHHHEH)ЍQHHcD@L$HAwxB trLjt0A}YL+H2MIEL#LeH[]A\A]ÃHcH<΋G % =tDǃAEfHH@ H5[Wff.H3ATUH-{3SHH3HHH H HcH4PHEH)Hu/HcL$H@ tHx~2HJD HE[]A\H5WAUATUSHH+3H-t3L%3HHHH HUHcHXI$H)Hu41HcXLmHHL1IIEH]I$H[]A\A]H5DvVfDAWAVAUATUSH8H3dH%(HD$(HR3H(HHHIH HcHL$H 3HLoutp7H=)`1Uf.detauf~ilù~suIHG HH+%3HHG 1|t#HG@{HH@k1IP'L9DAFHHH)LmAE ~I}G H< 1H3HcT$HHDH Z3HHD$(dH+%(5H8[]A\A]A^A_@HHwH@HD$ inpue~t[IHG HH+3HHG E1t=KtHGA@tHH@t 1%AIL9fDf~utIHtkG iHH+'3HH=G tEuPtHGE1@tHH@t1j%AoA]DHHtH@E1H?HtHG80A*f.HHH@AHE1HHG80A@HHx AHHx AE1H;= 3AH<$H<$"fDH;=3AhH<$H<$fDLf-H8P (H@HHHHEHy3I@HL`M&HD$H\$]EH3HHEE}H3HHE(AFfwTf. vUtAf%fv fA!uDH #4%HL,dHH IL 1H59:WAGCH=>9M@IGAW#U ff fh @AG"fAt.fA$t'fA#'fA!'AGCfDAG Hf%#frALH;|$ hH[]A\A]A^A_ffA tAH %u6ILH5!81 8|$ hH6H1h[H]A\A]A^A_6f}#:HEHIG:Lff.ATUHSG"@Lg(1AD$!@1H=L:Le(AD$ f%fuAD$"@tD1ɺ1H=1L1HE111HHIb=AD$Bf11HE=11H4=It$01LHH=AD$ Hf% fAD$ H+4HID$AD$" E"AD$"E#AD$#9H?HC!@t!H[HtHC!@uGL[]A\f19B1H .LHH7IAL$#HIC!@tAD$ f%f=H4%H4H=k!1)1HIL[]A\H=mQ1Hx-HH5I51=G f%f=tjHS4%H4H=.1I)HIL[]A\Ð{*L濟HH8HLIMtAE f%ft"M~(AG 0AN#E1L111L41L?HH(A E1LL41L?HH'AE^1L41L\?HH'@FSfH=NJ#HfH=?.1EE1E1 LL:HHhE HEH@H1HEHEH@HH-f H-4Ef9t f= AD$8ƒ f uAD$8@uAD$8uAD$8f"vKL-4AEu;I|$@L54HL9„tH;=4t @,AEMt$@AEf&ZGc]f(AD$8f.f&Yf=&Af w f= "H5-M16fH1Ҿa1H8G % =@H= fDH0@HHnDH111H8G % =tb@H»HH=LfDH?HHDHH@ S@HH@ AD$8H-4H=u1hBH=q,1ZBH= ,1LBH=+1>Bff.AWAVIAUIATAUSHHBH=4*11811FL1A"H# IMtL1"IAAt /ƒHSH*@/ƒHSH1HuiƒHSHHtN1a"HH=Hŋ/vHSHBHCf:HHtH"DILLDFH[]A\A]A^A_(HSHBHC+HSHBHC3HHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$D$0mHD$dH+%(uH04AWAVAUIATIUSHHHPHE1"HHL=4E1A%D=Dt-HCHHA%D=DtHtaH HCHHA%D=DuHH)PD1HA LHq;IH]LE1H LH~*L1I:1HL꿡HR* H=ICHL1[H]A\1A]A^A_L/H@HH)C1HvLH:I9ff.AUATUSH^I@"tIT$(B!@AD$"H4H8H4H(HHUHH4HHEE111HEH+HWH4H1[LH9u_uAD$"t(I\$(HuDH[HtH诶C!@uHL[]A\A]H=,IHu/AD$"@{LH;9AD$"AL$"4L1ID$1H$L1HF@Ht$11Hh$H@IH[L]A\A]H~#= H=UBAE111Hƿ1,# fH'E1AUATIUHtLG Mt G1H1IAFtIHx Ht@Hb1H)HLI`$LH5AHIuH4IEAD$#AL$" ƒȀEAD$#HL[]A\A]A^A_fHtUf=~I\$(HtLHHC!@tH[HuDHt1@I|$(G f%ftL轋AL$#@gfHtH_(1HǂfHC@ HP HAHHH@(p H8fHq4HP8с<<@P H5=16*I|$(LHLHHd1HJ.H@HNfDL=  L;1ҿH1'fDH!4L0fHP(H H-H@HP(LǾ -H@Hx ] H-H@HP H=1'6ATIUHHdH%(HD$1HtN!L (LHHH$L$IMt4@ f%f A@ f%f=tVLL¿6IH41HfHǀHD$dH+%(uyHL]A\f.Ih(HtE f%fuL1ɺ1$H!L$qLLƿ@6HxH#IY')AWAVAUATAUHSHG"L5M4u#IHD$LL;v A,td@EuK11HwI1fHǂH[]A\A]A^A_À|$tA;1H@ 8tA7Hf @uAwI@fHHuEEGD$f.ADD$H= vDD$HAGH54Ћ@@AAAWIGI‹%@=@ty&AWIuEIA7@wHHuEEXDl$fDEvA*&|$/AH;H5m 1|$;HEtHD$H{f=tf=HSmHYHE땐AWAVAUMATUSHHT$X|$Ht$0HL$PdH%(HD$x1H4HD$`HD$pL8HFILrPH4J8fDC t(LrPIH,HJHHIH1HvHC1uHcB`HHҺHDHHxH4HHH|$H`SHD$XD$HD$Ht]Hx(G  Ht$`"IHD$H@(@ % D$HD$H!H#Ld$HD$PHD$8HtH! H#HH4HHt  HD$L I@`HD$(C1 MH4HH@^AE f%fI@\MtI$@\L1HH$H$HHD$@H H$E1HHD$Ht8u H|$8xE1Ll$hMt_I$Hx0"s0H; Ll$`4DD$HT$LLH L,$1LD$hHLLM0Ld$hD$ MJIL;pP C1 Av AvIH\M I$H<$P\ E1Hx@t AHp(HxHсL@PAd$ MA J\H\II $H@PHAPII $@XAXII $H@HHAHIL@PIHxHII$HI(HH(IHp(I`\I P\EC I$LLHxHEdH>4t H4Aw8 AwHIJ4E1HD$L as0H; O3Ht$PH|$X1H-u IH= LH#Hy41I"f.@:uJHC{:t0HHŋ%@=@uHC@:uHCf.I9HL4@=tmLLLL)GAmt!H=24LHL[]A\A]A^A_H5J Lf.HLLL)HD$L H5HD$HsLHPLH5\CH=1AL1D)H= AH= 1AUI ATUSHH34HL`HHhLH I,HHhHDL9t6HLLL)H;HH[]A\A]DH=ytH1[]A\A]AUATUSHHˢ4L%4HI,$HHH HE4HH)H~~L-4HcLLH H= HE  H= HE HEH4HHDI$H[]A\A]fDHHHjAUIATIUHHH}dH%(H$1HxD$%=@t8I$HEHRHPHH$dH+%(u,HĠ]A\A]DHLLHATUSH%4H;Ht HH-24Hc4HEH9L%4n1wI$HHHHUH=;4H54HLHH+HIPHPHH8HLH=O4LH8HEHI $HHH9uQ x1Ht4~1H4H8H?tHHB48#H4HfH94AVAUATUSL MSI$HH͠4HEI$AD$Al$ L-h4IDHhHITI$HI$H@I$ H@I$H@I$H@ AD$ % @AD$ \fDL-4HL4ITHHIDAs=t AFH)I$ID$L[]A\A]A^DHzHHHDHH)1Hf IH@I$H@AT$ %_AD$ uC AD$ I$H@^HT4}DLxAD$ 뮐T4؉HfD1fLHHʟ4HHf.HH4HHf.H4uHH|41H ff.@HHz4H:t HHHff.H4tfDAUIATUHSHHŞ4L%F4I<$pHcH) HcI$HL,HcHHI$HhH[]A\A]H~HtH@HHff.fAWAAVAAAUAATIUHSH(D$H4H8HGLh(MLH I tHHx1EtI|$LLIIMtAwAw|$EMtAt$pAt$H([]A\A]A^A_fIl$}.../W1H=/@HP HxHq gHuLLHD$LT$/IMBHPLLD$LT$HI$Il$LD$HRHHL~f}..$HL1LT$H=At$LT$HŃ^At$H48tQLT$ ALT$A9H”48t%E11ɺt1HLT$|LT$Ar^IAr @H(LL[]A\A]A^A_GEHELxIALLHEI_Mt/D1HHsHHtBHLH4H@Hh(E H+@u% E H[]fDHEu H+E fPHHtH=1pAUATUSHH4H|4HH+Ht@H- H=Ht@Hʂ4 H=oHHt@H4 H=LHV HHt@H4 H=HL-|4H@H8I}G /L%`41E1E1*I$^I}1fpG@J H=L-~4H@H8I}G I$E1E11*I}fHG@ H=RGL-|4H@H8I}G to*E1E11I$I}fPG@urH;Htw~wH+H[]A\A]f.1I}1 I}1I} 4fDffDk~fDH1ҾMH4@,H 4HH4HHH{4HHPHH @|4HHH@HH4H Hy4HH4HH4HH|4H` H?~4HH}4HHc}4HH/H|4HH4H_~4 H{4HHz4H4|HAWAVAUATUSHdH%(HD$Hx48L5i{4L%4H#z4H<4HmHULHރ4H=\H @H=w4HH}4H HH}4H HH4H9D {ƉH$H=4HpH,v4H4H1HfǀƀHJv4H 41 H=v41ɺH Hw4HH-x4LmM IEHEH|4HHsy4IEH IEHCXH HHSXIEHIEH@IEH@IEH@IEH@ AE IE% @AE Huw4L(LmM IEHEH|4HH IEIEHC`H HHS`IEHIEH@IEH@IEH@AU %_AE I 1H=AE IEH@HAx4IEL(L-411IL[11I}N11I}0AL=t4A?L5Ay4I>H=|41#HHu4H8dHHNI$LeM I$HEHz4HH I$ID$HC`Hv HHS`I$HI$H@I$H@I$H@AT$ %_AD$  H=8AD$ I$H@Hw4ID$L RL-#4Hv4I}Hu+uIIEHb  Hs4Le@linu@xHM I$HEHyy4HH I$ID$HC`H HHS`I$HI$H@I$H@I$H@AT$ %_AD$  AD$ I$H@H{4ID$L I$H@HD$dH+%(r H[]A\A]A^A_@HY}4HtL5u4HHkz4IHH{4Ht4H~4HHw4H|4H5|4HH'}4HHy4HHx4HHq4Hjf2H8y4Hz4HLw4HHz4H[HHqw4HH;v4HHe}4HH{4HHq4HHp4HHx4Hpx4Hz4HH}4HHgq4Hr{4Hz4f:Hr4H)x4Hp4H t4HHw4HHq4dHr4H2u4Ht4H~u4HYx4H{4Hos4HJo4H|4H H+r4HH]u4HHz4Hz4Hkp4Ho4Hv4H y4Hw4HVr4HHP{4Hv4HHer4Hss4HHn4Hs4HH-o4Hz4Hq4H u4HHs4H{4L%v4HHn4I$HHz4HHv4HHq4HHa{4HHo4HHan4HH_y4Hr4HHm4Hr4HH5v4Hnv4HHo4H%q4HH#n4HHr4HHx4HHm4H<Hy4HHq4HKt41LAD$ LAD$ H0n4HH L5q4LΌLx4ENHuespemosI3EnEVE^IHmodnarodI3FDI@HarenegylI3I@HsetybdetI3FI@D5sboxAsboxDhashAhashDDҁgoodAgoodDDށfastAfastDfD 1) 1)11)ƒuDD11D1D1DƃDDξD־ 1) 1)11)uM$M$dMω DωAIAD1AAA1 D11AQM9uMM9uL5jp4A1 111I>A@  LmMIEHEHq4HH IEIEHC`HHHS`IEHIEH@IEH@IEH@AU %_AE  LAE IEM.H@Ae IE肹>LAE 'p9Hu4H$H=HHtgHsHHsHhHtFHRHHHu+H$Hs4 1‰1Љ1Hl4 H=NHHHHHHhHHHHHw4$If q{I UIP [/I( cLAE HHIhA<$H5)uQH=b1vH=HM ;1H=213HfATUSHPHT$0HL$8 LD$@LL$HdH%(HD$1qHPHZ(HHHxt&HD$dH+%(HP[]A\fHD$p$HD$HD$ HD$[HT$ƍH $H,2Ht/Hʉ$L"HIt$hHH LH$/vHD$H(HPHT$H@HBHD$ HKH@HX(HT$fHo4AVAUDoATUHnS8tEv H=H~f4HHH@HHHHGL@(ML芽E~uMcNtL-f4 @HL9tWH}1 IHLH@Hx(AE@t Hh4:t t AL$ tLHUL9uHn4H8t,HHH@Hx(GHHx[]A\A]A^fD{H߾=H{IHtUHƹH)It$H@H8oHAH];-Cx<-uf!H@H8бfDHm4H8@[H5]A\1A]A^@t[]A\A]A^D H@L@(7AHff.AWAVAUATIUSH8HT$dH%(HD$(111HHhh4H8Hl411HHHLHq4H j4HHd4H=ISHtH@H3k4H8H2ؽ H=0HHCn4H8HHGHHHGHX HE111EHH'd4H|$HHD$H9D$t HD$HH!e4L MwI$HHi4HH-|f4I$H ID$HE`HGHHU`I$HI$H@I$H@I$H@AT$ %_AD$ M Ht$AD$ I$H@ID$H.HjDHH>uH+t$H87Ld$L|$I}7LHB(HIH*m4L-xIHtHLHL`L1H|$E1E10DLI\H8HtoL'$E1MDHH.HL$H9L$tLIoIHt]=HIHtH9tIE1E1I)HHDEHI|$1Im@Ld$I$HxAt$VAt$Hf4H m48u@HD$(dH+%(1H8[]A\A]A^A_DHtHD$HD$L@HD$(dH+%(H8H=L[]A\A]A^A_DL`AD$ fDLHHD$ HD$fD1L莳IHImHcEHD$ HI}G % =t}KIŋT$ E1E1 HHE1[IM~1HI肺M9uI>G % =t31ϩHHTGHLh HwfH}G % =tjHt$~H.fDHHHD$H(HfD H@HX WKIHHoH@HD$ ټI LfDUH |$Ht$dH%(H$H+f4H1HtB$D$$HD$@HD$HH@HHHl$HHD$Hb48Hyd4H9(H_4HL$H9cH^4HL$H9nHh4H|$81HHD$0^8Hg4HT$0DŽ$Ƅ$HHgb4H(c4f$HHHHb4H;KH`4H|$ H ;j4HH+HJHc4H8HGH(HE % =Ht$("HHD$(H$Ha4fHf4HT$0HHD$@ZHeHHH\H$dH+%(H ]fDHf4HT$0DŽ$Ƅ$HH&a4f$H[4Hg4H-g4DH0f4HT$0DŽ$Ƅ$HH`4f$Hlf4H8HK^4Hdc4H|$0HT$$P$'H5kH1kH|$ ~@He4HT$0DŽ$Ƅ$HH`4f$Ht$H=_47$fHEH@HD$(fDHa4HHt x HH51詪H*c4He4HH9誷DHt$H=]4诰f.Ht$H=Dg4菰|f.H@H@HpHHx(Hh[f.1)H@H(DiD$9EHab4H"e4HH9HZ4H-[4H8HEH9t*HtwPwHt@HZ4HH#\4HtouNAVAUATUSG"tHG(@!@tH@Ht @!@uEDHP(B!@tHRHtJ fft []A\A]A^Àb#[]A\A]A^G HX5f% fG HHGkL%$L5H@ A%E,AAAt H}|E HƉ‰fA t-H5-N5F8t f%f ЁfE HHEfuHE(`#[H]A\A]A^fHxCsD&HEnff.fUW"HtHO(A f%u1A!@t HIHuH]YfA f%fuA# tA! uHoR5ʀU"H0a#V8vutFPuHA(HxzATI@"tx#tLA\Hx(fG t1ҾةfDG!@tHHtff.@Hs@"t!HH(Q fAf@tfft$HA!@HIQ @I#@Hff.@ATUHHG"G Lg(f%MtrAD$ f%f t_wrff Ɂ‘fE Hcf% fE HU5HHEHH]A\ffDf=f=uϿtAD$"tI|$(G f%f=uG"tHt@ f%f=uH51zpDA|$# t>ID$(@ t3H@@ w#H,R5H=H41RHګLHH5HH]A\tvAD$"tnI|$(G f%f=G"Ht9@ f%f=u+H5D1舯Tf<ATSHISAD$"t~I|$(HttW f%f=twwff%fwTff f ЉHHtWHIпH H5HD1赮HL[A\f.f=tHL[A\tH51qH5ɪ1UAVAUATSHI@"u3n1HϬHHHL[A\A]A^@H@(@!@tLpMtھH=ЙlIHIt$(1ɺL L1=1HNL1H@H*HVfLI腰HL[A\A]A^fDAD$"HL[A\A]A^DAUATUHSH_ fG"wHHL`(@"t3Mt.Md$Mt1҉LjAD$!@uLe(Ml$(AE!@tRIEHtI@!@uU fft@"<t)HH[]A\A]P ffuqfL1ɺ1蟲LgU HBff% %fU HP5HHEH[]A\A]{L$%(=@"\ffwflfa,ff.HG"tCUHSHHG(@ f%ft@HHH(Q fftH[]fDI#@H[]DHB51Hž} H˩HH0Hff.ATUHHG"t\HJ5Lg(H0AD$ N8f%vfteftL:HH]A\@AL$#@H9B51H 1HHHD$~HD$H]A\ÐAD$# tID$(Hx:AD$ f%vaFP]Rff.fATISHH_(S!@t5HsF f%f fH~C H A5%fC"@K#uxttHSHtkz ff u\fr#@y@tCK#AL$" ȈC"HBL11HCHB]LI"HL[A\f=6Hv0F f%f  F#<HL[A\"At$" C"B# ȃC#bHG"tfH藫貝1HHff.@AWAVAUATUSHLw(AF!@oInIHE(Lh(G#AU f%fw+fv;ff%fw-H HcH>f=vLf=4ffbHI5H4H=J1KHcfDf=G#AE# AD$#IE(@ f%fZL1ɺ1菭IHF5HB8<<PEBR;1H5`9记Ad$"1ɺLLAD$#@tLHԩHL[]A\A]A^A_ff=AE#LAD$#蹖H}(1ɺ1跬+fAL$"@LLL藬tfG# fIE(H@(@!@^HXHS(G#0B f%ff=AU "@G# AE# AD$#IUIT$u IEIT$H?51HH@H@,_fDG#D1@1LLիIDLHHB1HGHBfLz(IAG IOy H1@]tHx8HL$ITHL$LHH1Hp vH=1hAWAVAUATUHSHdH%(HD$1G"tLo(AU ffH=OIHE"\wIHLL1譗1H辢L1HlHHD$dH+%(&H@[]A\A]A^A_xHD$dH+%(HH[]A\A]A^A_fDMe(AT$ ӁAE# DI$MD$H@H$M,Hv A8:M9xr sfDM9vcALI<:uA8:uA@/LIpLH)IHIf.1ɺ1HLm(fDMD$I$M)LH5GLhI$Mt$LhLLI9LLHAD$ IDLIHLA \$ E"с tVL跰HuAT$  HL L4$IA|$DLAD$ AD1҉ݖIE(At$At$E"f.AT$ Ax:*LH=;1@1L膄 HH 1t Ad$ LLIwFLLHAD$ IDI$M|$LpL4$ LE"dHH 1誫H=ӝ1HELLe0[Me]A\A]A^fDM"H(H"LwfDLwH45H=H41hATIUHHHt t!HHL]A\DLHsH"I蘇LᾀlH3Iff.UHsH]HǺ]ff.fATIUS8zHljfH?G"g#G Lg(f%HG0 HcfG H65HHGHg35HHt<uH+5H[]A\蓔HT35H=%H41 f.AWAVAUATUHSHHW(B f%fHZ(L%Q +:H+CALHA1H~HLk'LpLLBzHuC L% EAA fA|:t`HuD1LAIH覓L1H[]A\A]A^A_YfIHL[]A\A]A^A_HKL1H)I| HL$AYHL$IHtHHvLs H5{K|5t>Hs1LA L1H躖II\$0HڒXDD1LAτL1H}IA}SUPEufA}R:{A}:pHvL1HHtHGff.HtH;=H)5tH;=W25tPHff.AUATUSHH 25Hj)5Hs)5D SAD$ E1XID$H@afDID$LxID$@I$Hx(GHHP H@</H:lID$xBH 5NfILL$0Hx@߀LL$0DL 5I9HA\bHL$pMtMv(DD$LLLL $9]AD$ L $u2L $MHT$pLL@jl$L $t AL$ I9HtwwI11H{WaHHEaHuH=U\D$'HDH$:H'fHPHHDH$nI~(G f%f=HW(1B!@IHOLARHJ4LIHt8DP fff@@ufu HIHuELZfEEIFIHuAN"fDIFAIH$E1AH8L54E1AN8L|$AG@ÉD$MHMAG@ELYXM#GAV81E1E11 @ PSHT$AHHD$HX8Y^@CHD$H$HXXfHL$Hff=f=@@yHQ(HtR fftf t f;HD$H@8H)Hx HJuHRHȃH)HH\$H|$HK@ N{ HHƁY_+He41HP0TH<$1LH,cE1AF!@&IA@HLNH|$G@D$G@EEQLQXMbPE1E11S1HT$AAYAZH\$H<$HC8U_PfHQ(HvHS(B f%f=B"HB(f@ @!@HHHA!@|A f%fHB?H<$@}fH<$A@K@HH$HEH@(H(fDH^(Lj(C % =H$"HH=H$Am % =BH$"L=Am H$H$HD$HD$[ HDŽ$H$HDŽ$H#H$ HDŽ$HDŽ$H$HD$8H$ HH$(H4HDŽ$ H8 HDŽ$${HDŽ$HT$$$$HVNHD$8HD$`$$H$H$GH1HYHD$(@u HHxGwH\$(HHiHH\$(P0E1E1fo$Hfo$fo$HCfo$ Hhx0HD$0 p HP0H@HPjƄ$MHD$ H[HD$xHD$pƄ$HD$DŽ$HD$H|$ L\$HHHD>H$H9D$8L\$&HD$E1E1$H$MHDŽ$HD$hH\$X$@LMuHH|$$BHAH|$$HCLd$h$M?M9LIFH|$(HNIHxHH)H;|$sHD$0HHD$@H)H9J HFHHDHL+IsH9HFHD$PHD$ LMI%HJT=H9HFHD$@L9I"D$@H  IHI9w,I)III)H|$H9|$8MHL$`H9L$XH$$H$HtppHD$H#$ud$tZH$H9$t=H|$Ht3Ht$ LD$01f.HHt I;/HH9uHD$H#HD$($HPH@0:Hl$BHHD$H#H4HHHHH.4HL%4HH HCID$XHHHIT$XHHHH@HH@HH@HH@ C HC% @C HD$(H HKiH|$ HpH߁H H,iD$pAaH߁H HiH$H9L$hv&$tH|$xmH߁H HhHD$HX(@H|$XH9|$`x$D?HAH|$X$M9LIFIC@$KD>L$HD$xZ$LT$xI $IHAHH$;HD$P̃HºH"Iv"LH$IÃIH"9$Ht H HUfHnHUfHnIv)LH$_IºfHH"*^HD$H#_D$pD$pHD$0L I;$HH9H;|$HD$HpHHD$(Ht$@@u HH9Ps?H|$(HL$H$HT$0bHD$(HT$0L$H$Hp0HD$(H$HL$H@H4Ht$0H9L$@b H|$ HrT]HT$HHD$ HL)H90 H$Ht$0HH$LiLAH$N .J<L$LLL$XHD$ L$H$IJ<LXHD$(H|$@1LL$H$HHL$B0t HH4HD$PHrIH\$0HM}HD HD$ HDHD$@HD$8E1@LMI1fD(Sf/D$p$D$pfH=!4LT$HI4Ht6LH!HcH9vHH?H H9uH9t$8Ht$Aa>XVH<LT>HLT$Ht0H!HI9vLHH?H H9uH)L`fDIHD$0IL I;DM$_HD$ HDIALH)HHT$@HT$0H+D H9D$@ HH9H;|$Ht$PH|$0HAHVH;T$$HD$ HDHD$@HI9M8H;|$HD$HxHHD$(H|$@@uHD$(HH9Ps9H|$(HHL$PL$HT$0'_HD$(HL$PL$HT$0Hp0HD$(HL$PL$H@H VH<LT>HLT$XHt3HL!HI9vfDHH?H H9uL)Lp2H|$HL-&H?-AH<BtnHHl$HD$L)H9*L,HD$0HYLLL\$PH4LD$@NHD$ H|$@LH4NHD$(HE|$@HD$0H\HD$ L|HH$HD$PfɃHH"*HDHHHD$@H$uHú̃HH";D$@YHH9H;|$3Ht$0HAH|Ht$PHVH$H9 D$@1IEH@HD$H$IEH$HH@H$HCH$bLiHL$0LHL$J4)H$IMHL$ H|$@H$J4).ML$IH\$(L8HH$H$D$PH$ H$̃HH"9t$P|$@fH|$HHD$῀$H# $ H\$K#UHIHC($xf$fED$xfAHD$(p HD$(pH|$ `\$"H$H9\$hH<$GH|$HGHH9H̃HH"HD$@HqHH9J THH9HT$PHH;|$sH|$0HAH9TII71 )IH$I@XHd4HHt@E1111_{ HHuH@HHD$Hp `HDE; EA1Ld$8L$IM9AHfHIBHM9vqA6tL4@A0HM<Ht-DIF!HcI9v@HH?H I9uM9v A?HM`BHIL6I1H=GH@(^IH$IHBHl$HԔ0r0HHJ(H)H9ILHL HyHz(I4H9v"HHHJ(ODIhH9HGIL$;L9LLF11LZLLL)Hm2I9t7HL1111HLZLLL)H12IHBHl$H$HB(@ D$% =^H$H$"#H$H$AwH$HD$8AwƄ$H$+H49*Ht$%F@$PE11E1SHT$1"_AX>+H$H$H9\$hH5?? 1K%H<$%$HD$H$HD$`EOALAHMtHt1DIGD!HcI9vHH?H I9u}?HH5> 1$HD$($HPH@0HHD$H,HD+H=[H=>@ H;|$b$HA>HD$ HDHD$@HL93HH;|$fD$@HAH$HHYH@H$H$H;|$Ht$0D$@HA1HtH$H|$(H1L\$DŽ$ >L\$HD$HHD$(HP0HAHHD$0HL$e.HD$HL$@@LHD$ H|(HD$῀$H#u$NIHHD$L@(Hl$L\$ E11D$Ll$xLU@L9s ATIL>OH$D$P HH9$qYfDH$HDŽ$HD$hHD$XjHt$0D$@1H|H$H|$(A>HHD$@ H9f!LIHHD$L@(XFHt$XA-D$@yDAWIAVAUATUHSH|$ |$ hfA!MfA$ZRH=:NAG"x"AW#@:u IB1 LE11H1=IDe Ew fAfAfAfAtCu?AD$fv4fAAAG#(<fDf>~@ti@udH}(HU0B f%fuIHB(@ t?HHx u5H}*HE(Hx(p*Hu(H1ɺm@H5=D1HI9HEE!@uH fffvf_LHEI9tpHf=cHm(HEHm裾LE!@ILuM<E Hf%f=uΐfcDI9u@tH5H5H[L]A\A]A^Ð@tH5H 5H HfH}H}(u`G f%f=u[Ha@HE(@!@Hx(Hm(+H}(G f%ftH}(HsHN(H(u"tt*tPHcH=Z.1NcKATISHHG(@!@uH@(@!@Vf.HXC!@tJfDC f%f=u C"<tHo1ҾHP/C!@lVH[C!@uHL[A\ÐAWAVAUATIUSH8dH%(HD$(HG(@!@uH@(@!@%VDHXHC!@t HmE!@uHE1IHtHIAT$#H5AT$#@8 H5AD$#tH5H 5H2H91t@AD$#E f%ff%f%fw"AL$"C f%ff=XMHL$ HT$1LLD$^IIE@\Hx0Mt8HT$ LLT$HT$(dH+%(H8[]A\A]A^A_fDD$IUB\u"Lr8ĀtMtL"IMu@Lh(fDDAL$#ID$M]E#HAD$#%M\DAL$#ID$HD$(dH+%(H8L[]A\A]A^A_'MHC(@!@HXHC f%f{L{(c#I?G a% =Ht$ HHD$ H$H<$+H\5Hr8v`H5H|$@H|$t=H5 @H|$t(H5?H|$t?_H$I@ D1H)I?HG tH I?Htwv>wIdHH@HD$ HH$7BPu,5H5XH|$DAWAVAUATIUSHxH 5W dH%(HD$h1H}5H565L9H 5ЉՁHf%D)ff>e/fYf\uL585AF8DH5HHt $M4$LML9tFW ff<&ftfffHHaHL9uI$HD$HHX5I$1L5o5HHu5I6H@ $e H `5H5y5HAPooIoQ oY0oa@HD$`HD$HH15H55)D$)L$ H0H5)T$0HH5)\$@)d$Pu H55a]H 5II|$LHIHtH|5HL9A@ t%A@A@ Hw54$D(Hz5L8H@5HH~5HHL5H9p ELL$3L$A@ tLH+5HHvL;5t A@ L1+(H! I@HD$hdH+%(YHxL[]A\A]A^A_f.fUjf=6f=fL55AF8T@!4yAF8.313>fDfHG(HP(B f%fHB(@f|f%fL55AF8GfG#(<(Hw(I1H= :H*Af#f.HG(@!@rHPB f%f\HR(B % =EHBHHrHH9rDHH9߀Pu G#@fL55AF8o2AF8|M2e62NfLH\2YAF811H5HLpI.HtE u@u1H= 2HH 5IHD$4$I$H5D(H5L8H[5HH5HHg5H;p {f_ qHOAD$! LL$/L$1A` LP$I(11H-U H 5%_DE 7HDH 5#L=I4$Ht$L$^ L$]1LD$sLD$H 5H(.6H5w5H="L>H565H1jBf.AWAVAUAATUHSHyA݀ˀAGAEaHE f%fAAf=t:E!@^HEH1ɈE!1Hf.fe"L=35McH}(CYG!@t#HGHtP fffDAt)E Dff% H5fE AHHE]"EtM! HS5HHHt B<0=Hf5BI@ %D9HL[]A\A]A^A_H5HQ8pGˀHE AAf%f=f.LuH1ɈE!1HE-HMHp0L1H/fDC#tI|$uDQ8ID$@AD$ HƉ‰fA t7H55F8t*f%f ЁfAD$ H}5HID$fu ID$(`#HL[]A\A]A^A_AQ@@AANHE(@@I5f111AAHTfDL耸HD$~HD$H#hK+H 5H=J41>fATA1UHXHT$01HL$81LD$@LL$HdH%(HD$1HD$p$HD$HD$ HD$!H&@HT$H$Ht+:HƋ$/vHT$HBHHD$HuHDHT$dH+%(uHX]A\.2ff.HHtD1t,@HtHDH1@,H# HAWIAVAAUATUSHADfAMH-5HcD05H@ f%D L%5fG KL(HGDG"DG#AG!@u IAG!H5HHt <DH5H8It[H[]A\A]A^A_@AA`A``M31+IL(*I!@ A%\At I}AE HƉ‰fD t.H5Ϳ5F8t!f%f ЁfAE IIEftHL[]A\A]A^A_IE(`#fDLcD3IEZ'H5H=gH41L;ff.Ht'H讴hHH#1ff.fHž5AVAUATUHS0@t"Hs5H;A[]A\A]A^G f%fHHtH"H5H5H-k5HH*HHHH31p[H5H5HrH;5HZ1Ҿ H= H/IH;H5HHHHl5H;H5H -5HH+HHb5H;Hm0HH)HVHoHGLH[]A\A]A^#@Haz!HHHM5HHcA H@HHAHB<<躲H;L-#5H IHHEuM! ,9H3L1ZH5HHH\@ Eu[]A\A]A^ÐH;(fH5HH[5H[]A\A]A^1HHH Ds4fDӦ$H!$H;D>Tff.@AWAVAAUIATIUSHHH!L濴g@"M$HMDL1LHLD$E#g'HmDH꿵1HH11IHI>LD$ILEL ?E11I$LϺMu#HEH-5HUH<E11ɺL W?L#HUHCH<HSHEHЁH AD$ f%fC#AE f%fAF#{#tAD$#u^tAE#u+{#L;tA~#uI?tmHL[]A\A]A^A_Iu(H=m 1*HfAe#It$(H=D 1*H=Ad$#AF#wDLfDLpI LXLD$nfDL@HHHW f%f=f=@@u-Hfv$fft@f-fv6HHfD1Ҿ\1HHYfG"1ҾG"'HH{"H@AUATIUSH"Ho(E1E!@tLm1ɺ1L$1ɺ1Lr$HLH11LHHM$1H1L>$E fft]C fftHL[]A\A]fDC"@uf% fC H5HHCHL[]A\A]E"@uf% fE H5HHE{AUHATIH5USHLHD M,$MtLL11L꿛HHHBcP"h# P"HS(HH[]A\A]LIff.ATI #L1H1I!LHP ffP H5HpHPA\W f%f t,Hf=tAf t;G1HH@Hq5f fW H@XHGHH=J12UUHHwHsH11]NfDHI5H0N8vtqH 5Hcŋ t)HH]fDB f%fuB# tHB(HT$Hx]HT$tFPu|DW f%f t,Hf=tAf t;1HHd@H!5f fW H@`HGHH="131UF Hff uf%f fF Hʾ5HX HFr]HfHG ff tB1HHf% fG H^5H@HH|$HGHD$Hf.ATG If%f=t LA\HQ5HQ8vuatYAQtSH=rh1 1H HL⿡H1A\H H=,LA\ff.HH151Hr HHfDATIUSHo(HE U!f%fRM!AD$"ʃ@@tt HEHuf A|$ LHt+AD$"AT$ ff-t(I\$(HuDH[HtHC!@uL[]A\ÐuU ffuE# t uH5H2N8v&utFPuHE(HxYAD$"@HAD$"ҧIl$(1LHH)1HLHHC!@HC@HmHDHh(IgI\$(HuH[HtHC!@uAD$"I\$(HufDH[H1ҾHLC!@uUHu\H=HHtC1 1HH1H@]HH`1^]HAWAVAUATUSHXH<$Ht$ HT$dH%(HD$HB < O% =H|$Ht$@Ht$@HúH1HT$@LxHHHT$@HtCH=5@ H΋ DDt A7HT$@IHHHHT$@HuAHhLH)HD$@H$Lp(AF!@uIF(@!@3Lt$IfDH$HD$MnAE!@LDH[C!@uI9I9v|HD$0E1D$@E DLAM11ҾL AF!@MnI9L9rH|$ 11H=h HƁ 1H(HD$HdH+%(H$HX[]A\A]A^A_u@tH=NHLHAM=DLl$(HMAE1Hi<@<#$<H5HcH>fD$HI9\$}_L9E%<:wHHH|$ 11KH=h HƁ AE HAf%f=f=u fwfH|$1ɺL1HQH|$1LHIM@AE HAf%ftfuAe#LM胢fDAE HAf%f,tftfAHt$ LDHH |MHEsHE1<[uDEL]HH) AHD$0HH9H<]EAH<[8<$uLHL$8HHL$8HtjfDH|$HH_Hp@] tH@H\3HH)HHt$@:@H\$HH[HpHt$@AE f%f=f EHAf.AE f%fEuH M\AE f%f=EuH 8AE f%f=tyf tsEuH eAE f%ff  f=uCf=t=EGLHuH HAe"H|$1ɺLDT$81HCH|$1LHHD$(HD$0DT$8HELt$(HhfIE(MH@(@ f%fHH=1)HHt$ LD|Lt$(v@H|$ 11HT$H=H1t%AE"@`H nH|$1LHFH=n1/%jELt$(B < t t kuff.AWAAVAAUATUHSHHHӃ%8EEDH@ ff% fG HF5JH_(HGDG"DHJG#K!@HkE!@u H}E!HG(@!@uPHG0HA5McHHt B<8xHT5BH8It_HL[]A\A]A^A_DH@HG0Ht`!HG0HxDHxHIK! @ %D9uH5B,@t I~AF HƉ‰f t H5#5F8uMfuIF(`#HL[]A\A]A^A_"fH݈G#f11H?f%f ЁfAF H5HIFfDDIF=fLH5H=J41u"DAUIATUH:HRLI'H?L]HA\A]hAUIATA0USH DH@ ff% AfE H5HЈ]"Lm(HEH@5]#IcD,HmAuH HL[]A\A]A^A_@H AL$! HxLImHLD[H]A\A]A^A_ @El$"EAE9 "WAD$ f%fh'ExE f%fhILE1E ہ÷f%fhHAf A#DJ#H51HT$HT$!fDHr(H=1HT$HHT$b#HB(@ IEE f%fL M fff$wHHtM"M! IDf%J ff<ffHzQRfDH ^5L-ϥ5 H5H IEDp$H$BH fHHCH5H1IEDp$@AD$ f%fhdE1HUHLKDx"AIADx#I$HRIEH1LM,$LHc H 5HHt <H75LHZ5L4hEDEDHEIHE(HSH ff@@!@6HHH)A f%Lz(MAG fLH+5HH@AG tIG@HH@x1LHT$+HT$\XLz(MJAG LH+o5HHAG GtIG@HH@1LHT$HT$f.AD$ IT$(fB!@Hrfgf%fhExEt$"A`M#rf.L(HHdH꾀1HhfIHH@HHIG80fDIHH@HHIG80IHx IHx L;=5miLHT$}HT$L;=5LHT$ZHT$H~ ffF"@R"fff|ftftH=19LHb5H=3H41HHT$HT$H $HHff.fAWAVIAUATUSH_ ftPH٢5HHt Ӏ<H5LcLBH8IHL[]A\A]A^A_ÐL(1AG!@'IF(E1Ag!IG#fL1IHtIMF(A@!@KAX M`fAD$!@IF(I@A`!Ad$!ID$AF"L1LD$5LD$M`(Mx0M|$AL$!@MGAg!fA@"H5HHt Ӏ<xHǙ5ILDABH8HtyMIID$IF(I@A`!ID$Ad$!H9L1LD$11HLD$I%D@ f%f9vHH5F$AAt HzaB HljƁf t4H=h5G8t'f%f ȁfB H#5HHBfHB(`#DIGHHT$蛎AHT$cS@ f%f9lHh5F$AAt I}AE HƉ‰f t5H55F8t(f%f ЁfAE HA5HIEfuIE(`#HL[]A\A]A^A_^fDDHT$v HT$HBL蠍AO IE=LǁhH)5H=H41JH 5H=H41AWAVAUATIUHSHH7IH HHhH1"IHI$H(HBX"IƃX#IEHIHE5LHHt HV5H]HLuLHL1LLL1oL11IEI$HH[]A\A]A^A_fLLM! HH[]A\A]A^A_f.Lx(MtgAG LH+ 5HHAG t?n tIG@t'HH@t1LHu @LMIAF#(<(HOLGAL$ fff$wHHtAL$"AL$! HL[]A\A]A^A_@H1H[]A\A]A^A_;HѿH1fHHMLLHIHx  DL⾀1IMIv(H=1NHAf#@IHH@HHIG80L;=A5~fDLH5H=hH1Jf.AUHIATUSHLfv#P"x L? 11HHL1HHHE1I1ɾC H=f%f fC H}5H( HCLe!HR5HCHHH HL[]A\A]f.AVAUATIUS1LI1HI1H"1IH5HHL1JH[L]LHA\1A]A^L1IŁ~ uz18IHcHiVUUUH )Ѝ@)Hc1HdL1Hw [L]HA\A]A^ H5Hcŋ%= 1L@HICzL%tAM#1St(AM#@!H1mn@h#I[L]A\A]A^@Ɓ @AM#kfL`t51I;H#AI#ofD`IH#ff.AWAVAUIATIUSHtdDHσ@%HHLI˅1H/HL[H]1A\A]A^A_fAHKMAD$ f%fNL^1Ҿ%HLIDLD%H-@+LI 1҉HL@HH[]A\A]A^A_@AE f%f=f=H51Ҿ&L'HI H$LIHLD&H>IDAG#M~AU f%ukI}ugIm(AE"Ht`E L5rE!@tMHmHtDE f%Pfvf uE#@tLf.f=tAE#MmAD$ f%f=YAD$#KAU E1fff ?Il$0M ffcMHLL[]A\A]A^A_@Ae#kfDL0LDHDAL$"@L LI1Ҿ%H`LD1H@AU f%Hfv f MAE"M>AD$ f%f=*AD$#@1,I@E ffE!@LuMAN f fAF"AN#AF!@INHI fAf$IU(B f%ftnI01ɺHw(It$0L1LAL$"@I(1ɺHw(LMcAL$#Ad$"ZL[]A\A]A^A_HB(ID$HHB(AU#@A T$#AT$#AE# AD$#H=U.H}(O H7H~ t5O Hc5bIEID$HIEAT$#낋wvw;HcYHE("fAUATIUHSHHF f%f=tH1IAD$ 11f%f fAD$ Hr5H ID$YHڿH)6HIH@(H!@IE(HXLkc!HEIEHLL[E1]1A\1A]ff.fAUHIATE1UHSH(HT$R fdH%(HD$1Ht y"/f<f fu BfGL11H1+HHD$H#1?HHHL$1HT$HD$DHEu\HD$HtHH~H@0HHD$H9_"9H"HT$dH+%(IH([]A\A]fDHHT$H,HR0HH9|$MHG(H@0HHD$fA fRAfhHN(A f%f4AF"AE f%A!@fHQHB f%ft f=<B"@A"<~fL1+HD$cfu I}$AE"AIM(H4Wf%"A f%f=<tftfJHyyfH11tHK@11HLf(MAD$ LH+5HHAD$ e|ctID$@tHH@t1L%Ht$IV fH<$H<$IHD$H@0LHD$hfHt$I$IHt!H@HwHtID$80IuLH9fDLa(MAD$ jLH+݂5HHEAD$ tID$@t;HH@t/1LLl$jAU AfLl$HfDI$Ht$Hx %L"FL;%.5Ht$Ll$AAU fhf=5f=+fDLl$I$LHSH@HHdH%(HD$81Mt%AG IIHAf%fCf=t%HD$8dH+%(LHH[]A\A]A^A_fM_(AC!@I[HtHD$0E1AIHD$HD$ LHD$C f%ffDC!@I>LEHG(@!@MaE < [Ht HM9&e/,$M4$Mt#ALM<$LI@HCHUHHC f%f3H{(G % =Ht$D $詺HL$ D $H HprototypH9fxe(HS(Hx HqD $R 9H{(D $IHtwMwLC(L$Mt DL$DL$L$lLD $IHI>1ɺHD $=DI(G % =Ht$ 貹HL$ H HprototypH9{fxe(oIW(Hx HqR JI(HHtwwI_(I@HHHHGHL$ Iw(AͺHfDHHHHGHL$ >I~(G % =Ht$(¸II(G % =Ht$0虸IH9u+Et&HH{:L$HP賿L$H-IG(H#H5"DH I$H@(AAP S1APMt$HHL$HM4$H fK1HHH% Hy HEHpHHrHH@HD$0LGHLwH@HD$(AP % =Ht$LD $rHL$0D $IHC(P H51D $ D $/HBw5H8H5NHHIHHL$DL$H$DL$L$IHHHL$0M@`ipI ff.@AWIAVAUAATIUSHH~y5HHt MI|$(`@{#2fD8AHAD8u.D8%뢾L|HbHS"S"AD$" ЈC"듐AUATUHSHHi5L%h5C8€fA<$S8t C8E",E Lm(f%f=bFLN^E#S8HUHHUC:tu{Hk5HHRHz Ht`ҶA<$I%E1ɹ$LIH5&L1_gHu(1HHM#ȃE#t!HH[]A\A]DC:tdHm5H2N8zvutFStfE#]#H$?H`[H]A\A]f1ɺ1HH8荵H-.q5LH@ Hf%f bfC H HC(HCHC0HP ffcfP H HPHC0H[]A\A]fAVAUATIUSLo(AE AU!f% E1fAE!@[1ɺ1LIm@D$Eu4HD$HdH+%( HXL[]A\A]A^A_f.AAuAtAD$ f%f=Hh5%H4H=f%f=Hh5Ht$H4H=C1tHWD$Af,u eLMVt$ 1H@E1AF!@tMnEAl$#M AD$ f%f=H h5%H4H=1ѹ1HfD$ ==AE Aff,f%f fff Hg5Ht$H=sMH41=1HsfD1LL11AHL1LIHMMmAE f%f=tf tLLH5LOw2t$ 1L虼AMuDAM ffef[ffnLHD$@f bH^5IUHH@HL@0HD$@MWLD$(BD$ LD$(HHD$0H]5HHʀAT$"AD$#@#yAL$#yLA\ʀAT$"AD$# փʀAT$"H=1UHSHG"@u;t&H_(Hu@H[HtHwC!@uHH[]HP(B!@HzW ffuHD$HD$H[]@ATHP"It#Hx(G f%f=t#f=tmf=urHLA\At$ H|$եH|$G f%ftH+`5HHttAL$#@fʀAT$"H=1hH=!1Zf.ATSHH DHHw`IUH~&AT$AAAu? 1H 19f.A@A苿H H=*1ff.ff.f.HG!@uHGÐATIU8SHfH ff H]6fH HHX(L`0HPHt%@" H[HtS!@uHCS![]A\HfH:tBH9tKB!HR@uHB"tHB(HtH0H1H@!@u!HH:uB"u"HH9uHfDH@HuDHR(f.rfAWAVL5XAUIATUSHG EAA{f%}ft[IELHp苚@H5HSHDAMAVDLAT1AUH H[]A\A]A^A_@Lw(AF u;t&HFLHp@H5HL5a@HIvE1IIE1 LMHPhIELHp趙XZfAWIAVAUAATUHSH(dH%(HD$1HHW(B f%f Ff=1E11HD$L5H$Mu<<wtu EudAG!@MMAG f%fuAG#(<(=MG(A@ PuIHzutI$Iw(11E1E1H@Hx jjEZYHnHUBtHHB Ht z<tHM0Iw(ILEH=1fHR0B f%f f.HO6Hr1H8˰L`HMLE1E1 H51 IHyHx lH@1Hx YfDIw(L1jHAg#HD$dH+%(H([]A\A]A^A_D% =tvH4$LǺ"LD$LD$HHt$H9}tLD$A@ E1LD$Apv5ApIG(fE11IIxH@HD$LHD$觶HD$KH=ģ1ff.fHHtO"ff.@HH=V6HH0AWAVIAUATUHSHH=S6gL=M6M/M,IEIH.R6HHN6IEH IEHC`HHHS`IEHIEH@IEH@IEH@AU %_AE  LAE IEH@IE轼M'M9I$IHkQ6HH I$ID$HC`HHHS`I$HI$H@I$H@I$H@AT$ %_AD$ u| L AD$ I$H@ID$LH%MLLHH[]A\A]A^A_錰@LAE LAD$ rfD $GçI 蓧Iff.AWAVAUATUSH(HHt$HBHu-xH(H5a[H]1A\A]A^A_)fJ0HWHHH)H\$HtH\$DxHIcHH9DzIcHHD$D$1L-EymfLH5ؘHNjD$P1耘HD$N$IiILH5ϘH1JD9\HL$LcAHN$D9 HcHHDD$;DD$LHH5!1MHI9wIPF‹L$Q)‰T$T$MLHH5Η1苗L9H5H1lHH9H5H1C\$DcA)^DLH5hH1HD$N$I/H5QH1D9H([]A\A]A^A_fDT$E1LHH51谖 H5H1蒖CDHH5H1oHCGfH{HJGʉL$H]HD$HPFD$:fDH9vHD$H9 fUHcSHHHt)X"HhX#H[]HHt$蓒Ht$HfAWAVIAUIATUSHH(G HL$DD$ tcHWJ E1H-tZH LLL LLa< ~#Ku;H([]A\A]A^A_'L1E1Htӿ#tMHHt$LH|$LxHt2H5P6LAHыDDtAIII9uAHLpLM)MHHHMt6H52P6IEH‹%D=DtHHL9uHoD$ 3C H)I̩ D$ nLLLH-DIMAU qD$  H5ܓL蠬MDLH5֓L1H[S ILH5L1軚H5LrMT$ HL$MLH5u1vH(LH561[#]A\A]A^A_鲪fHHoLaH < JD%A] HELH A] HAL)L`DH HjHLaA] tJl%@L9LLHYq%@IE8&IM HxHqHIfH C61H@tHHx Ht@<wH5"HHD$AE LT$MIEH@]H@8LHcPHpD<Ɂ谙LT$H5LLT$bLT$MH5L_f.H5lL7fH5(HcH1LHHD$DLT$/f.HLLNDH?L׺LLT$+LT$Ht/W 1 w#HB\tHB(Ht1Ҁx HD@1DHtG uH1B\tHB(Ð1DHGATUSH IHCL`HC@@uHHx(HtGHCu_LHF6HH@0Ht HH@ H I$LHB@I$`\H4@6H0HHHL[]A\@ H` Hf.HHP H`@<~)H:OHCxv5HH66fD| %Hzu@蛙fDATw IH(DID$(ID$LA\H@6ATI@8G#G"@W f%fHO(1A!@tHqA ff%f A"u~ff_tKfbtEf]f`t}f^fat}L)RfetfcLRH!RLEL3LH57!1LA\DF ff%f wF"ueLQLQff.@HO(HQ ffCtDA#uHQ(B" ufO"@@fAUATIUSHw H_(W#ffuW#H?6@8 AD$#S fftHL[]A\A]fDLk(AU u t˨t+C# t%ffffbf1ft ft1fTR s#@ LߕHHGx tAD$# uH@x C H{(f%fC HG6H@8HCHtwwELHk(C#e H[]A\A]fDAAADGA uB D @f Lޔ)fۤOH8LH=1.H2H ff.HHH-<6HH@HH=6H0,fDHHpPB HHIHHIH LAt8IB1uҨuHBHt@HH@HH@H@H@HLIE~IcHIMDAIHI)f.HI9tHHtDR0D8Q0uLL9uHr@HHG f%fu.G#u(G"t"HW(B f%ff=tfft1HfHB(@ tHx1 u@HQ\utHuHA8fDHzt$ ct$ H1HB(H tTtHx u1뇐1҃HDTfHQ\€t H;tH H"HHyu HyH(1J# H=]1覶fDAVIAUIATMUHSG u%H:6IImA$[]A\A]A^]NHtHP(IHP IU@ ؃A$[]A\A]A^fHHHdH%(HD$1LD$CHD$dH+%(uHfAUIATIUHSHH;596H[66E11ɺ]Hp]L胭@uMLh(Hh L9t0EPP ڃPH[]A\A]fPf.Hx Htww`Lh(Hh L9ufH9t;H56E11ɺ]HpQ]LԬ@uLh(Hh QB _H]H[]A\A]\@HD$HD$o@"fHO(HQ u-t2H1HyLFMuRQ HVDQ Q ցLDuH1H~HH;~sHyfB|tfDAVAUATUSH H4L-m;6HI}t;Hj11PI}AE1HߴZYH []A\A]A^H66L MI$HH;6HL576I$H ID$IF`HHIV`I$HI$H@I$H@I$H@AT$ %_AD$ u) AD$ I$MeH@ID$LAD$ ȐI@ OHsH=<gAWAVAUATIUSH(HdH%(HD$1pH蘌IH96H8HtvjE1E11j1LPAYAZHtWHxG % =8vHÅ#GH rHcH>DH86H8HjE1E11j1LDz_AXIHh0詣IHËG % =Ht$|HT$ILrH$LHHMH$L茵HCHA;6 H8Hj1LE1jE11Y^HtkHxG % =NHt$|HT$ILBHT$LL$貫ML$HHT$L HCI|$HH76j1jE1E11H8L}~E1E1HxH 051 XZ6fu4HuHHT$dH+%(H([]A\A]A^A_wRHXpHcH>1@HHX @HLHPHT$[L1~uH=`1aHLHPHT$HCMHC(=HC -CHCH1:6H0 DH<6H0 DL16~`ff.AVATIUHSHHF!@LvMLumDH[[C!@u1ɀc!HCHVH@E!@ugHfDP!HH P!Mu`O"Ho(H1HLDH[]LA\A^H'A!@d11E11HH@@!@u@AT$!Il$ AT$!HuHHGG %=uGH.6%HIDt=t= uHo0H*e!H}@HLw({fDC!@HKDMtCHH@1'f.L1wfDHF1E1F!HO(G"HuGG"H|$葝H|$HE1E1E!Il$AL$!@O"DHH=T1%DHH:6HG f%uyG"ƒ℀H}ftfHH}HEG"H5}xG H 66%H4H=}1虈HH魨DH}ftfHsH y}HEf=uHT$nHT$H@H(HJ}G f%ftfHH %}HEf<@O fft,E1f%fwSAG! uGG"uAfHft9H56H1H5xHD@薛HɐHW(1B!@tHJB f%fhtÐB"uA ffhtf%!f= t_HB(@"tEHG f%f=H@56%HH5!1Hw@ f%fhuÐHI(A Ɓu%P=PzHAH;/6FH;,6\f.薚Hoff.ATILA\ff.ATIUSA Hf%f=tFH W46%LS H=Ƀ1HL[1]HA\'HϾH 46IAVIAUAH1ATUH1H0vM D` HfA ftBH36LDLH=T1]HD]HA\A]A^釥HHD$NHT$I@ATHW0IB f%ftIT$(B f%fht"LA\@B# tۃ׈B#B"uAD$ f%f=t*H26%H1H51!uLA\ÐL裘Hff.AWAVAUATIUSHH8T$HL$dH%(HD$(1HL$H~RA-w(H0H-3!fE1L546E1)H26HJ4譛t$IIK4HD艛uEH(6HcAAL=xD EAA EDAt!EuE3A)fA~At IcAD\EXAMcMcCBDE؅t#EtA@H|$uD_E1fAfD$=l?6IcHt$LDHD$Ht7(31H5LHD$Ht HD$(dH+%(H8L[]A\A]A^A_fHPHymH59wLsHD$Ht뉐=i=H  yHd==H5vL HD$H$.-1rHH'UH5zvL豎HD$HIcAAD;f1藰IcAPMcD[A@HcHBD$D@A@D%t#,tHcD@HD*D]HD&A@IcAD; I H|$txAPH5ruL詍HD$HH5EuL|HD$HHD$E1(yE1pE1HtE1HtՖDAWAVAUATIUHSHHL>Ew\EAt]F {IG(H$HsHEHD$H;$t 葦u;Ð[H[]A\A]A^A_@^tH$AuiIG8Ht HHx(tIG8HH@(@9EHH5-t@^H tHDHL[1]A\A]A^A_ъHwHtL;AG]H}wHHx(tL;AG]oH]wHH@(@lL;AG]H6wHH@(HHx AL;LAG]BHwHH@(HD@f=Nf=vXH{07xH{HH[]A\A]A^A_vffU H5XHcH>ff`t?f=_H{(HtwwH{HC(HvHCH[]A\A]A^A_@G"?fH{(#fw C#@ UwHHǁCCmHCXH譧H{8HCHHtwwHC8DC"ff%fvffHs(HH0HtwwHC0Ho0LeLmMtLgvMt M9tLUvHMvHo0L5WLmLH w]IcL>E1H}L}LL0H Ht"HE8A@DHC0HxufDE1HHH@AApDG#-G"@#HHHY @H0ubHHH蛸A@iIH};fL0H twH1HA@@HfH{XGfL0H t^HHuH}LeL@HwwHIL0LmH"HfG"Q}qfD} Hwv(w}[}Hpx}fG uSHwC Hf%fC Hy6HSHHC[ff.AWIAVL5EdAUL-}mATIUH?SHHs f%f=fuHCH-HS"usH6HHt u[f%f=]f=@@uAf=t;S"fzwmLJTIc L>fHQHI9tC!HH[@uL9uHL[]A\A]A^A_fHq6HAf=f=v0gff6LUIc L>ffAIAAA C#-C!@MHCL@ f%f L-1]f=`0f=7-ff>w0AILI@`LuR@/L6HcA@f>uH{(s @H6HcffH6HH"'AIA!uf=`aHS(HuHRHHH$H$B!@uff3AILI.Mu{H{(HnHC#\C#MH艀@ f%f=oC f%f=H6%HH{(W ffhu9G"t3f=C Ef% fC H@6HHCfH{(G!@H6C# H"`H`HE~C#~f=RHI6H,H{(G f%fG!@tWHGHtNP fJfvf u6@#u0@!@t*HPHt!B f%Hfvf u B#wfHfa{#zi@6HC(@ f%Pft #fH^K#%wHS0HjB f%fXHC(HKp ff8H@(H+f@ HxHx(H@0w fft H9p ffɀK#J#H# HK(HA(@!@0HPB f%f-fB!@HB(@!@H@HsB"@t@!@.H@A!@ݒHILI(AA!@BMAM5AH fft f A@!@Ax#@!@p fff IpH9pJ#AP"HL$P"LL$cH|$cL$A@ f%f=bLcC f%/fC H6HxHCVS#LC(E-LD$$7$LD$ A@ RH&cH\f.CCHdHC f%0fC H6HHCC f%1fC H6HHCmC f%2fC H6HHCG@t C#@8CH{dHyHH9bLH=_1}Hmc#HbLh`H{H9HzHHf% fC H6H% =LǾL$fxL$f.rszAf.jsz1A@ )1Ix(HPaL$fHH(Hq ffIx(w ffHq(H9w(I@(S1H=uL$cL$ E1IIIpLE1HPPhBLT$bH=ZH1RLT$ZYArH$vVArHo`L$M.L:aH5b-H1T LH=Y1H$L rff.AVAUIaATIUHSHLHH6HHt utU"ukE f%f=t]U"f=f=v$fqf%f@bHcH>Df>FH}(UE#@ 1HI9tOHEE!@uH ffw(fvf_LHEI9tHfcDI9u@tHW6H0 6H[L]A\A]A^f@tH,6H  6H Hf=cutHm(HHmf.[LE!@LuMtfAF AuIFH-HWE Hf%f=u@HE(HE(@!@H@HTfHm(oHt }蛈kHE(@!@Lp1AF!@tI~:HH6E 1Lf%f=1裴HH5`H1QHE(Hx(G!@HG@!@*]e#ATUHSG f%f%fht[H]A\DHW(B f%f%uHR(B f%fuˀz"xſ茇tH) 6H6HHDb$HttB$1H5L_:lHD`$mfDHW(B f%ft[H]A\:f.AWAAVAUATAUHSHH6HHt HL-IL5JS Ёf%ffwf%fFwhIcDL>f.A+C"As#AtA 0E K#C"unH9t{C!H[@tC!@uHC@ f%f=CѐE1C"tH[0.fDIcL>EtK"A+H[(AfHH[]A\A]A^A_f.EWK"NfDC">A+4H[(AAs# HH[]A\A]A^A_fDK"AH[(HAAAK# ȀK" AԈC#H[(HC(1@!@HXAt\A+tVAAABS# ЀK" C#+C"ȀC"fC"@uC f%fC H 6HHCHC(Hx(f.IDM9t/I]AE!@tC!@utLkAE f%u#I}t[M9uH(L[]A\A]A^A_f-w5t-K fftfwffwLHvIEE#DƃAE HN5%Bffv(f7HQ 1ۺD$ &%SHAE H s6HcL$щflA}"H54MxHJ6%H4LH=NN1WHx"f^fK?D<>1@H<51?tOt1AM"uۉȃ AE"w`AU ɐffEAE"HZE1AE ffvfffw>뻅 uAM# AE"H5H8AM" f%f=qAM"gA@3HL51ۺ H151ۃAEE#D$  1ۺA)AtIU(B!@t΃ SwHDEHzD11YaL袅ZI}(DLAE f%f=f=AM#H*5?L1u A @% E/EۃHt5IUHH@HDAD$!Md$@uL9uH6HHt|$@8uJH5HP8с<<@RH5YS91gAE f%fL NAD$"hH 5HcLf% A|$"H4LH=R1*QHBqEۃv IE(HX(A@H51ۃ%Hd5D@3HL51?I](1Hp5H8AM#ABI}(1Ҿ1:T3hAE f%f=HJ5%HH5gF1@AȀEE#AI]01@AE L% FfLcHwff2H=s>Hc H>Hs5HP8с<<[O@P EH5O=116eI](AEE#HQ5IUHH@HvHIHI(AD$#0q fffHAID$HAI|$(oZAd$"AD$#ID$(H=K1JHjAD$ f%f fAD$ Hw5H Ad$#AL$"0ID$AL$"@0 AE HR(J f^Hz@r LBH=I1L#mHd5IUH=LJHH@HP0H1lID$(E1@!@L`H=VK1lAD$ f%f fAD$ Hm5H Ad$#ID$AD$#fAL$"@IL$(q ffA|$"@@At$"At$#X@mH=J1)IHAiHLH=H1lHR(J ffHR(J trHz HB\D$ b1119H5H=HD` HHcH1A wHDHhHRHzHu6DA6Hz(G % =tNhH‹=?aD)1HHHDHH=_H1jAt$#HHP fATISHHG(W"H!@t)@rHHHI(I ffuhAT$"1@!@tHXH%5HHt3H@\t*Hu#DH[Ht1ҾH0KC!@uHL[A\H=IHHt @ I|$HE11ɺH5k/>HHA@ 5% =LYH‹E@% ЉE@@!Iu7AD$8I1HE@% E@@% =tX E@fHH@ HHP KH\GH5H=9H41ZAUIATA0USH,DH@ ff% AfE HT5Hf]"IcLm(HEH5HmD,Auhhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhh%}6D%ż6D%m6D%6D%}6D%m6D%6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݿ6D%տ6D%Ϳ6D%ſ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݾ6D%վ6D%;6D%ž6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݽ6D%ս6D%ͽ6D%Ž6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݼ6D%ռ6D%ͼ6D%ż6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݻ6D%ջ6D%ͻ6D%Ż6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݺ6D%պ6D%ͺ6D%ź6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݹ6D%չ6D%͹6D%Ź6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݸ6D%ո6D%͸6D%Ÿ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݷ6D%շ6D%ͷ6D%ŷ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݶ6D%ն6D%Ͷ6D%Ŷ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݵ6D%յ6D%͵6D%ŵ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݴ6D%մ6D%ʹ6D%Ŵ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݳ6D%ճ6D%ͳ6D%ų6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݲ6D%ղ6D%Ͳ6D%Ų6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݱ6D%ձ6D%ͱ6D%ű6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݰ6D%հ6D%Ͱ6D%Ű6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݯ6D%կ6D%ͯ6D%ů6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݮ6D%ծ6D%ͮ6D%Ů6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݭ6D%խ6D%ͭ6D%ŭ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݬ6D%լ6D%ͬ6D%Ŭ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݫ6D%ի6D%ͫ6D%ū6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݪ6D%ժ6D%ͪ6D%Ū6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݩ6D%թ6D%ͩ6D%ũ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݨ6D%ը6D%ͨ6D%Ũ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݧ6D%է6D%ͧ6D%ŧ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݦ6D%զ6D%ͦ6D%Ŧ6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D%%6D%6D%6D% 6D%6D%6D%6D%6D%6D%ݥ6D%ե6D%ͥ6D%ť6D%6D%6D%6D%6D%6D%6D%6D%6D%}6D%u6D%m6D%e6D%]6D%U6D%M6D%E6D%=6D%56D%-6D1%! % %  H%( %! H%( H%( %! %! %! %! %! AC"L1Ƀ1L\$JH\$11HTL\$HP(I H IS0HH% %! %! H% 1Ƀ1LLL8MH-6LH@ f%f fF H HF(HFHF0H61ҿHH6C f%f fC H HCH%( %  2L$% %  H%( %! %  H%( H%( %  %! % HBB!% f%  1% % % Hv6jE11A11HPHt$% % % H% H%  %  11LHL$1LLH% %  %  %  %! %  H%( H% M鯂 H% %  % %! H% H% H% % % H% % % H% %  %! H% f.fH=6H6H9tH^y6Ht H=6H56H)HH?HHHtHy6HtfD=6u+UH=z6Ht H=Π6d]6]wHIx6HG1O1u8>@HHRPHt-H HIHHIH HIH<G1O1tG uDC+ ~~NߺHH HtWfD(pN6w@HPH 1w;H u1DHtG f%ff.G f%f= w2E1f=v2ff%f&w!HHcH>f=;tE1DAtADf.H1~6LJu6IHxU~fDW t8H~6DO$Ate9D9AA !D9AG„u-IHH9p~+H@Hvl-aAHsx!u#xef.AHD[A\zH(W"mf vDuHD[A\A wDHG(Hp(F V"%fu$f@fAD fv|=HG(@!@HXH1AC!@tH{AAA„tE18H=/DAff.fUSHHGBtHPHtG =tu'Hr6H9t H[]@HH[]f:6HHtHp(H@HуH H9t uH<HHH}uH}(HE(jG Af%f=f t@%u7f=tt5HW(B f%fuCHz(Ht:E111ufD@Hq6HWE11H8u1ff.fAUI ATAUHSHHS f%f~w9fGf5ff+H[]A\A]f=w:f=v$iLHHLuWf=H1[]A\A]HfHЃ1f1BfDfuC"tH[(1f.HHHAfDEAI0L EAI(L EAI L EAIL EAIL EAIL EL H1HH HHH1H1H LHH8HH1L1HH L1HH H1H HHH1HHHH1HH1H HH H1H HHH1HHHH1HH1HH H1H HHHH1HHHH1H H1H1H p6HA H&H=Hc4H>r3$\r3$Xr3$Tr3$Pr3$Lr3$Hr3$Dr3$@r3$<r3$8r 3$4r 3$0r 3$,r 3$(r 3$$r3$ r3$r3$r3$r3$r3$ r3$r3$3D$DFISIEizID3A(y$NDA+9AAIA)A A1DDAAD)1M9wILJ1MIIM9ANLGMGI@tA+8ND HtVHtIHtRщ[)11ȍ41 1Ɖ) )11A@AAff.UG % =t,RHH}VH}MHE1]ÐHHh Hd6AVAUATUSL MI$HHi6HI$AD$Al$ wsHHcH>L-e6HRL4ITHHIDAs?t AFH)I$ID$[L]A\A]A^HzHHHDHH)1HfL- e6IDH#HITI$HI$H@ I$H@I$H@AT$ %_AD$  AD$ I$H@'ID$ID$I$L[]A\A]A^fID$ID$I$L[]A\A]A^fIRI$H@I$H@I$H@ AD$ % @AD$ LAD$ @fDHT4DT4؉HD%1fLATIUHSHHHX(HHM#@HEHf6H;HHHt6P fff@@ufu HHHuMt0E f%f=t I$x\[]A\?[]A\Ha68tH`6BHb6.@AWAVMAUIATIUHSH8O dH%(HD$(16f%fwyHѝHcH>@G"@L(LU#LHƁ HImjLE1jE111LA[A_HU"E11Hm(Ht.MLLHD$E!@D$Mj1LLjE1E11$Y^HxHËG % =NHHD$(dH+%(H{H8[]A\A]A^A_fHmEH-V@HQe6H8HD$(dH+%(vH8[]A\A]A^A_W"@u^L(LSLH}#IyH LjE1E1j11LLAYAZHnM Hi6LH=sH41Hd6HT$Ht$ H8诰IHtSHt$ HzID$ tH LfftUf%f=tKHt:w1E1wH@tAt$vqFAD$tL[]A\Htwt$wHHt6IpHǽfD1H[L]A\@I[L]A\lgcfAVAUATUSHHHAE1E1VfDf,f D AH\6HSHH@H@1tgH Z6L`HHS f7fff@@uftfMufiLc(MuE1[L]A\A]A^f{#uH[6L MtRI$HH`6HI$ LID$HHGEtHEH\ԷIff.@HHt8@P fff@@ufu HHHuff.H\6AVAUATUHSHHt HHx0t[H]A\A]A^L`(M3@]tID$LmIL$IEHtqAD$ Av9}aAEf9vXD)HHHTfDHH9t/LMtIL1HHĦH!II$HIDC$fD9sIfk"fwf}HcHfh"Hfh$L`I$HI$C$D)HHT(fD*fD*LBfD)k$J)[L]A\A]A^fD(@@(A@"@@IH@HL`(HH\ID$@fC(CP11fS*Hs0Lf%fK$f fCPff.@G!u tPSGHHHH)G HZf%f fG HHCHtHHC[fD髷H{蟷HH荷Hu[fDATUH-a6SHLeMt)`H}bHX6HEHH{3HH%HuMt []A\f[]A\ff.SHHHHݶHu[fDSHw(H1H=ë6H边c#[UH5HtH5Hyu]H5uHat}_u}tܐH5[HAtH5MH.tH5BHtHH=M1]H ff.fAWAVAUATUSHHwb6H D IIWH a6%@=@IfA;f=1fHE1HLLѿHfH[]A\A]A^A_H47HH9/AD$Hb`6DIaEt$A_QfAHUU6LMtfA<$$_XH4V6LDHIW6HH Q\€H Q\H[]A\A]A^A_fHT6LMtIDEt$L=Mftf=L=QH0LEEIHAH^w$AHL$H=蟤HL$HtwHaMD$EUHAV@A4$DM1H=H蛮HH f= E1ANLLD1H=GH}b@;H;P;7X;`; h; p; x; ;.;;;L;;;;;s;;;;i;;;;;;;k ;s(;K0;8;,@;:H;P;;X;`;lh;np;x;S;>;I;;;;;v;; ;[;;;;c;5;K;;!;; ;#(;0;8;2@;H;P;X;`;)h;p;x;g;;;;X;; ;!;";M;;;;;#;;;;$;; ;c(;0;8;%@;&H;P;X;>`;h;'p;qx;k;;^;f;;;;;;;8;$;L;);;b;*;;_;/;+ ;(;,0;8;-@;.H;P;X;`;h;p;x;3;;;;;/;0;f;;;;N;@; ;;;;;;}; ;(;0;18;@;2H;P;3X;`;h;4p;*x;[;;Y;;;;;{;4;;C;y;5;6;;;.;;7;8;| ;(;90;8;:@;H; P;X;`;h; p;;x;<;=;;>;v;;-;?;;@;;;l;;;A;;;;C;A ;B(;0;8;@;H;iP;X;`;6h;p;@x;Y;C;;;;;;D;;;E;;;F;;V;G;;;; ;H(;I0;8;@;,H;P;JX;K`;h;p;x;;;{;.;;;^;Z;;L;j;r;;m;M;;;N;;; ;P(;Q0;8;S@;H;P;)X;`;_h;p;x;l;T;U;;i;D;V;;W;X;;;;;;;;;;<;J;Y ;"(;Z0;8;[@;H;\P;X;`;7h;p;x;];;<;[;I;G;P;;\;;;S;_;;`;;;a;b;; ;6(;0;%8;c@;H;dP;+X;e`;fh;p;gx;;;h;U;};g;%;j; ;;w;;;; ;;;o;H;k; ;(;b0; 8;%@;H; P;X;l`; h;p;x;&;#;;n;;';;o;;;p;;q;;r;/;;;I;;Y ;s(;t0;8;u@;\H;vP;X;w`;|h;4p;x;;C;;;x;1;E;w;";;];;y;#;z;;T;{;?;|;} ;(;~0;8;k@;H;P;X;'`;h;p;x;X;;^;_;R;h;; ;E;;;;;;;5;;;;; ;(;0;8;@;H;P;X;`;0h;p;x;(;;;c;;;=;q;;;;X;;T;;;n;;;; ;(;0;8;\@;H;P;tX; `;h;^p;Hx;4;;;D;;&;;;;B;;; ;V;;;;;;;Q ;(;0;J8;@;H;P;X;`;5h;p;jx;;T;;;;; ;;;;;;;;;";4;i;,;'; ;(;0;8;K@;H;P;X;`;h;p;ex;>;;c;u;G;;W;;;;x;;j;;;;;L;;;_ ;d(;0;8;@;6H;P;X;t`;h;-p;x;;;;;`;P;;;;;;z;;;;v; ;A;;; ;f(;0;8;@;,H;P;X;`;h;p;x;p;c;f;;;;/;;;d;;;{;W;;;;;;; ;U(;0;08;@;H;9P;$X;`;]h;p;x;;;;1;;{;;;;;;;;;;;;;;;a ;"(;0;&8;@;H;P;X;`;h;p;x;;;=;;;;g;O;;;h;;;;;;U;;;; ;(;0;8;@;H;P;YX;`;h;p;x;;;;;;;;;;;;;R;;;;; ;;; ;](;0;8;V@;H;eP;X;g`;,h;p;?x;m;T;;;;;;;;;;;;;;;;;;; ;(;Q0;8;@;H;2P;X;`;h;(p;x;;;8;;;;;;;;;;;;;;;;;q;x ;s(;0;8;@;=H;LP;8X;`;h;p;x;3;@; ;#;;8;;B;;9;a;;;;";;;;,;; ;(;r0;8;@;H;P;`X;`;h;p;x;>;;N;;;;;;;); ;;F;Q;;;;;;; ;(;0;8;@;H;P;X;z`;h;p;jx;;;;;;;;e;;;;;;V;R;;;;I;; ;(;HH6HtH56%6hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!<`<@<`<`<@<`<@<@<@<@<@<@<@<@<@<@<@<@< <@(<@0<@8<@@<@H<rP<rX<r`<rh<@p<@x<@<@<@<@<@<@<@<@<@<p<@<@<@<@<@<r<@<@<@<@<@ <@(<@0<@8<@@<@H<@P<X<r`<rh<rp<rx<r<r<r<r<r<r<<<<r<r<@<!<!<!<r<r<r<r<< <(<p0<r8<r@<rH<rP<rX<r`<rh<rp<rx<r<r<r<r<r<r<r<o<o<o<o<o<o<o<o<o<o<o<o<o<o <o(<o0<o8<o@<oH<oP<oX<o`<oh<op<ox<o<o<o<o<p<r<r<r<r<r<r<r<r<r<r<r<r <r <r <r <r <r( <@0 <@8 <r@ <~H <~P <rX <@` <rh <rp <rx <r <@ <@ <r <r <r <r <r <r <r <r <r <r <r <r <r <r <r < <r <М <l( <@0 <l8 <@@ <rH <rP <@X <r` <rh <@p <rx <r <@ <r <r <@ <r <r <r <r <@ <@ <@ <@ <r <r <@ <@ <@ <r <r <@ <@( <@0 <@8 <r@ < H <@P <@X <@` <@h <@p <rx <@ <@ <@ <@ <@ <@ <@ <@ <@ <  <@ <@ <Pn <@ <@ <@ <@ <@ <@ <@ <@ <@( <@0 <@8 <@@ <@H <@P <X <@` <@h < <@ < <@ <` <p& <p < <0 < <; < <@ < <$ < < <  <`  <  <P < ( < 0 < 8 < @ < H <P <X <0` <@h < p <@x <p < <  < < < < < <P < <P < <P < < < <<<<< < (<P 0<P 8< @<pH<AP<X<B`<p h<@Dp<x<<E<@<`G<<`<<<p<@#<H<@$<I<@%<J<0&<K< <L< '<M <((<pN0< )8< )@< )H< )P<*X<p+`<,h<-p<@3x<@3<`0<6<6<`2<@9<@9<P:<O<<<><?<@<z<P<R<R<T<pV<R<R <R(<X0<^8<^@<\H<aP<eX<n`<rh<@up<@ux<|<<}<<<p<p<<<< <<<<`P<<<P<<< <R (<R 0< 8< @< H<<P<X<``< Ah<pp<Px<<<<<`<<<P<0<<<p<`<<<P<<<P<< < (<`0<8<@<H<"P<PX<``<h<p<Px<+<`)<B<C<<<A<p'<`<<P/<@<<0<О<P5<6<@<7<<@><? < t(<E0<G8<H@< JH< JP<[X<0U`<Uh<@Wp<Xx<Z<w<x< z<}<<~<<p!<#<%<&<P(<+<4<8<09<4<@<<D<0F <X(<J0<K8<S@<0H<0P<VX<p`<Xh<cp<jx<Pn<p<r<u<u<y<c<X<{<`}<@<@<P<P<<<<P<P<0<0 <Ж(<Ж0<Ж8<Ж@<ЖH<ЖP<КX<К`<Кh<Кp<Кx<`<`<`<`<`<`<`<`<`<`<`<`<<<`<`<<<<< <(<0<08<0@<H<P< X<`<h<p<x< <<<<<<@<<p<0<@<<<<`<0<0< <@<< <@(<@0<8<@<@H<@P<@X<`<h<p<x<`g<^<g< q<q<<<<0<0<0<<<<<<<<<< <(<0<8<@<H<P<X<`<h<p<x<<<<<`<$<@$<$<P%<.< /<<p < < <<0<6<9<;<@< <D(< E0<@F8<c@<lH<vP< lX<`<Fh<`Gp<Gx<H<0H<k<k<l<m<@I<<<<;;(;H;h;x;x;;(;%H;h;;k;ȿ;q;;(;H; h;Z;;3;;};(;}H;Oh;;;;;;(;H;;h;;;@;;;@;p;;0;`;;;; ;;;;-;-;-P;R;;:;Sp;n;;;;Q;;;;;7;o;b;;d0;d ;d(;@;@;@`;h;=H;=(;=p;0;x;1;h;H;;up;uP;u;X;;G;;p;;_;_x;_;;;A;;;;;X;;;;`;;;k;k;kh;k;k;q;q;qp;q;q;H;H;H;o;o;o;;;;;m@; X;i8;i;i;ix;ix;;|`;|;h;;;;);;;;t ;=;N;;;;;;(;.0;8;@;!H;mP;X;2`;h;p;x;;;;u;;;;; ;(;0;8;1@;mH;P;;;;;P;;;;@;6;j;;;;;;; ;(;0;l8;G@;H;P;X;`;h;sp;Ux; ;5;;;8;~;;O;;;;5;;;{;;?;t;^;; ;!(;0;w8;#@;KH;9P; X;`;{h;:p;Wx;;;;Y;~;*;%;0;;;;(;q;;;;; ;U;Q;!; ;(;K0;8;@;JH;P;X;g`;h;p;x;;y;;l;;X;D;=;<;;;;;;V;;;E;;; ;(;0;8; @;+H;P;X;1`;bh;Ap;Xx;;;;Z;Z;;;;;;;; ;X;;;T;;4;P;C ;P(;*0;8;@;zH;RP;X;R`;Rh;%p;fx;;x;;;;!;;;;;;;M;M;;;;;;;O;^ ; (;0;;8;@;ZH;P;X;:`;9h;|p;x;E;[;;A;&;[;p;;I;?;;;;;i;M;;e;$; ;s ;;(;0;8;m@;H;P; X;`;h;wp;x;;\;0; ;;>;;; ;;;;;;;3;;;;;a; ;(;0;8;y@;zH;VP;AX;\`;h;jp;x;;;W;;;N;;;; ;v;;;;l;;;L;D;& ;(;0;8;@;H;HP;X;F`;h;Fp;x;;;;I;;;;+; ;;;;;;e;;;w;};:; ;(;8;B@;H;P;X;h`;h;p;]x;; ;;<;;;;;;;;z;S;i;;~;\;;C;?; ;(;H0;(8;@;xH;P;BX;`;@h;tp;x;E;;;; ;};`;;;;;;;;;;-;;;; ;1(;~0;8;@;H;P;eX;t`;&h;p;fx;2;;;/;h;;;;!;; ;;y;D;;;;;W;; ;(;0;8;@;H;~P;X;`;h;p;$x;;;;;n;Z;;-;n;;;;;;;";;;;;Y ;(;0;8;@;H;'P;X;`;h;"p;x;;Q;;^;;;;;;u;;;;7;;G;; ;;]; ;.(;|0;p8;>@;pH;P;X;v`;gh;hp;x;;5;U;_;;=;2;;;G;;;;;;o;a;;;$;S ;(;0; 8;z';z';`z'; z';y';y'ș;@y'Й;y'ؙ;v';`v'; v';u';u'; u';t'; t';s' ;s'(;@s'0;s'8;`r'@; r'H;q'P;q'X;`q'`; q'h;p'p;`p'x;p';o';o';@o';n';n';m';m';@m';m'Ț;l'К;l'ؚ;@l';k';f';`f'; b';K';@2';2';1' ;@0'(;0'0;/'8;/'@;@/'H;/'P;.'X;`.'`;.'h;+'p;+'x;*';`*';*';)'; (';'';`'';&;`&;&ț;@&Л;&؛;&;&;@&;&;&;&;@&;&; & ;&(;&0;@&8;&@;&H;&P;&X;&`;`&h;`&p;&x;&;`&; &;`&;&;w&;^&;]&;]&;R&Ȝ; R&М;Q&؜;@Q&;Q&;O&;@K&;`E&;C&;A&;@&;>& ;`>&(; >&0;=&8;=&@;=&H;<&P;@&X;&`;&h;`&p; &x;&;@&;&;@&;&; &;@ &;`&;@%;%ȝ; q3Н;`%؝; %;%;%; %;%;%;@%;%;% ;%(;`%0; %8;%@;%H; %P;%X;`%`; %h;%p;%x;@%;%;%;`%; %;%;%;`%;%;%Ȟ;%О;`%؞; %;%;@%;%;%;%;%;%;@% ;%(;%0;`%8; %@;`%H; %P;%X;%`;@%h;%p;`%x; q%;a%;N%;`4%;3%;3%;`.%; .%;,%;"%ȟ;@"%П;%؟;%; %;%;@%;@%;%;%;@%;% ;%(;`%0; %8;$@; $H;$P;$X;$`;@$h;$p;`$x;$;$;$;@$;$;`$;$; %;%;`%Ƞ; %Р;%ؠ;%; %;%;%; %;` %; %; %;` % ; %(; %0;@ %8; %@; $H;$P;@$X;$`;`$h; $p;$x;$;`$; $;$;$;`$; $;$;$;`$ȡ;$С;@$ء; $;$;`$;$;$;`$; $;$;$ ;`$(; $0;$8;$@;`$H; $P;$X;`$`; $h;`$p; $x;$;$;`$;`$;$;@$;$;$;@$;$Ȣ;$Т;$آ;@$;$;$;$;@$;$;$; $;$ ;$(; $0;$8;$@;$H;$P;`$X;$`;$h;$p;$x;$;$;@$;$; $;`$;$;$; $;$ȣ;$У;$أ;`$;@$;`$;$;$; $;$;$;$ ;@$(;$0;$8;@$@;$H;$P;"%X;$`;$h;@$p;$x;$;@$;~$;}$;@}$;}$;|$; p$;o$;n$Ȥ;m$Ф;@m$ؤ;l$;@k$;`f$;e$; e$;d$;`d$; d$;c$ ;c$(;@c$0;c$8; b$@;a$H;U$P;p3X;p3`;@p3h;p3p;o3x;o3;@o3;o3;n3;`n3; n3;m3;`m3;`U$;@P$ȥ;P$Х; N$إ; M$;L$;L$;@L$;K$;`K$; K$;@<$;;$ ;;$(;`;$0;;$8;8$@;#$H;"$P;@#X;#`;#h;#p;`#x;#;@#;#;i#;g#; g#;f#;c#;b#;`b#Ȧ;`a#Ц;a#ئ;`#;`#;@`#;`#;_#;@_#;_#;^#;]# ;@]#(;]#0;\#8;@\#@;Y#H;Y#P;X#X;@X#`;W#h; W#p;V#x;U#;`S#;`R#; R#;Q#;O#;N#;@N#;M#;M#ȧ;L#Ч;@L#ا;L#;K#;J#;I#;I#;F#;`F#;F#;`E# ; E#(;D#0;D#8;`D#@; D#H;C#P;C#X;C#`;B#h;@B#p;A#x;`A#;A#;@#;@#;@@#;@?#;?#;>#;>#;@>#Ȩ;=#Ш;;#ب;;#;`;#; ;#;:#;:#;`:#;`9#; 9#;8# ;8#(;@8#0;7#8;7#@;`7#H; 6#P;5#X;4#`;`4#h; 4#p;3#x;3#;3#;2#;2#;@2#;`1#;1#;0#;%#;##ȩ; ##Щ;"#ة;"#;"#;!#;`!#;@ #; #;#;#;`# ; #(;@ #0; #8; #@; #H;@ #P; #X;`#`; #h;#p;@#x;#;#;#;@#;#;#;#;@#;#;#Ȫ;`#Ъ; #ت;#;#;@#;#;";`"; ";";@" ;"(;"0;"8;`"@; "H;"P;"X;`"`;"h;`"p;"x;`";";@";";l3;";";";`";@"ȫ;"Ы;"ث;";@";";C3;";";@";`C3;" ;"(;"0;"8;"@;@"H;"P;"X;"`;P"h;"p;@"x;@"; ";";@";";";@";@";";"Ȭ;@_"Ь;_"ج;,";";"; 3;2;2;2; 2;2 ;2(;U20;@I28;H2@;`2H;1P;1X;`"`;"h; "p;!x;!;`!;!;!;@!;!;!; !;!;@!ȭ;1Э; 1ح;1;1;R1;'1;$1;!;!;#1;"1 ;@ 1(;@!0;x?8;Y @;Z h;@6p;6x;6;6;6;6;6;6;6;p6;@6; 6Ȯ;6Ю;6خ;6;6;6;p6;`6;X6;P6;@6;06 ;(6(;60;68;6@;6H;6P;6X;6`;6h;6p;6x;6;p6;P6;@6; 6;6;6;6;6;6ȯ;@6Я;6د;6;p6;`6;X6;P6;H6;86;(6;6 ;6(;60;68;6@;6H;6P;6X;6`;6h;`6p;P6x;@6;06; 6;6;6;6;6;6;6;6Ȱ;6а;6ذ;p6;@6;6;6;6;`6; 6;6;6 ;6(;60;68;6@;`6H; 6P;6X;6`;x6h;p6p;`6x;X6;P6;H6;86;06; 6;6;6;7ȱ;V7б;b7ر;]7;x?;o7;x?;v7 ;|7@;x?H; P;x?X;( `;7;x?;;x?;uq; Ȳ;7в;7ز;7;7;7;7;7;7;7;7;7 ;7(;70;p78;`7@;X7H;P7P;H7X;@7`;87h;07p;(7x; 7;7;7;7;7;7;7;7;7;7ȳ;7г;7س;7;7;7;7;7;7;7;7;7 ;p7(;h70;`78;X7@;P7H;@7P;07X;(7`;7h;7p;7x;7;7;7;7;7;7;7;7;7;7ȴ;7д;7ش;x7;p7;h7;`7;X7;P7(;`70;X78;P7@;@7H;07P;(7X; 7`;7h;7p;7x;7;7;7;7;7;7;7;7;7;7ȵ;7е;7ص;x7;h7;`7;P7;@7;87;07; 7;7 ;7(;70;78;7@;7H;7P;7X;7`;7h;7p;7x;7;7;7;P8;H8;@8;88ȶ;08ж;(8ض; 8;8;8;8;8;8;8;8;8 ;8(;80;88;8@;8H;8P;8X;8`;8h;x8p;p8x;h8;`8;38;L8;L8;L8;L8ȷ;L8з;L8ط;L8;L8;L8;L8;L8;xL8;pL8;`L8;PL8 ;@L8(;8L80;0L88;(L8@; L8H;L8P;L8X;L8`;L8h;K8p;K8x;K8;K8;K8;K8;K8;K8;K8;K8;K8;K8ȸ;K8и;K8ظ;K8;K8;xK8;pK8;hK8;`K8;PK8;HK8;@K8 ;8K8(;0K80; K88;K8@;K8H;J8P;J8X;J8`;J8h;J8p;J8x;J8;J8;J8;J8;J8;J8;J8;pJ8;`J8;XJ8ȹ;PJ8й;HJ8ع;@J8;8J8;0J8;U ;0V@;?V`;OV;aV;uV; ;VȺ; ;V;';V; ;V(;@;VH;'`;Vh;';V;P&;V;P&;VȻ;%;W;$;#W;# ;>W(;!@;LWH;!`;ZWh;!;hW; ;wW; ;Wȼ;';W;';W;' ;W(;'@;WH;'`;Wh;';W;';W;';WȽ;';W;'; X;' ;X(;@;-XH;`;9Xh;;JX;;YX;`;hXȾ;;|X;X ;X@;X`;X;X;V;U;X;X;X;X ;P\0;Y@;Y`; Yp;6Y; xz;[ z;x z; W z; z;HW z;pW z;W z;vz;}z; z; z; z; z; z;z;z;{;{; {; {; {;({;0{;  8{;@{;H{; P{;X{;`{; h{;* p{;6 x{;L {;b {;{;{; {;{;u {; {; {; {; {;){;0{;7{;>{; {; |; |; |; |; |; (|;( 0|;Y8|;`@|;H|;P|;X|;`|;h|;p|;x|;|;|;|;|;|;|; |;9 |;K |;[ |;u |; |; |;|;|; |; }; }; }; }; };>(};G0};W 8};W @};X H};8X P};hX X};X `};X h};Y p};8Y x};X};\}; }; };  };hY };Y }; };; };E };N };_ };p }; }; }; };t~;}~; ~; ~; ~; (~;0~;8~; @~;H~;P~;X~;`~; h~; p~; x~; ~;  ~; ~;+ ~;7 ~;B ~;O ~;\ ~;h ~;~; ~;y ~; ~; ~; ~; ;;;; ; (; 0; 8;  @;s H;DP; X; `; h;/ p;? x;P ;` ;.;k;;^;v;(;;c ;s ; ; ; ; ; ; ; ; ;;V ; (;  0; 8;0 @;E H;[ P;n X; `; h; p; x; ; ; ;;/; ; ;V;ű; Ȁ; Ѐ;؀;; ; ; ; ; ; ; ;( ; (;&0;> 8;L @;X H;p P; X; `; h; p; x; ; ; ; ; ;A;z; ; ; ȁ;  Ё;+ ؁;: ; ;;. ;_ ;(;G0;v8;]@;\H;YP;4 X;w `;I#h;p;vx;;9 ;p ;u ;z ;= Ȃ;A Ђ; ؂;E ; ; ;I ; ;M ;Q ;U ;Y ;] (;a 0;e 8;j @;o H;t P;y X;~ `; h; p; x;;;j;u; ; ; ; ; ; ȃ; Ѓ; ؃; ; ; ; ; ; ; ; ; ; (; 0; 8; @; H;  P; X; `; h; p;" x;' ;+ ;0 ;5 ;: ;? ;D ;I ;N ;S Ȅ;W Є;[ ؄;_ ;c ;g ;k ;o ;s ;w ;{ ; ; (; 0; 8; @; h;1p;`1x;1;1;1;1;1; 1; 1;` 1;@1;@1ȅ;1Ѕ;@0؅;0;0;0;0; 0;`0;0;0; 0 ;0(;00;08;0@;`0H;0P;0X;@0`; 0h;0p;0x;`0; 0;0;@0;0;0;0;@0;0;0Ȇ;0І;@0؆;0;0;3;3; 0;0;0;`0; 0 ;0(;00; 08;0@;0H;0P;0X;0`; 0h;0p;0x;0;@0;0;u0;`i0; i0;h0; f0;e0;e0ȇ;`e0Ї;e0؇;`d0;b0; b0;a0;Z0;@Z0; Y0;X0;X0 ;T0(;R00;`N08;N0@;M0H;`M0P; M0X;L0`;0h;`0p;0x;0;3;3; 0;@0;0;0;0;@0;0Ȉ;0Ј;0؈;@0;0; 0;` 0; 0; 0; 0;` 0; 0 ; 0(; 00;@ 08; 0@; 0H;` 0P; 0X; 0`; 0h;` 0p; 0x;0;0;`0; 0;0;0;`0; 0;0;0ȉ;`0Љ;0؉;`0; 0;`0; 0;/;`/;/;`/; / ;/(;`/0;/8;/@;/H;@/P;/X;/`; /h;/p;@/x;/;/;`/; /;/;/;`/; /;/;/Ȋ;`/Њ; /؊;/;/;`/; /;/;/;`/; /;@/ ;/(;/0;/8;/@;/H;/P;`/X; /`;`/h; /p;/x;k/;@c/;`./;/;`.;.;.;`.; .;.ȋ;.Ћ;`.؋; .;.;.; .;.;.;`.;.;. ;`.(; .0;.8;@.@;.H;.P;`.X; .`;.h; .p;.x;@.;.;`.;{.;@u.;q.;@q.;p.;d.;J.Ȍ;J.Ќ;I.،;@I.; G.;F.;E.; .;:.; :.;9.;'. ; '.(;`.0;.8;.@;.H;@.P;.X;.`;`.h; .p;.x;`.; .;.;.;`.;@ .;.;.;@.;.ȍ;.Ѝ;.؍;-;-; -;-;@-; -;@-;-;- ; -(;-0;-8;-@;`-H; -P;-X;-`; -h;-p;-x;@-;@-;-; -;j-;@i-;i-;g-;`g-; g-Ȏ;`d-Ў;b-؎;b-;@b-;a-;@a-;a-;_-;_-;_-;^- ; ^-(;]-0;@]-8;\-@;*-H;)-P;(-X;-`;@,h;,p;,x;,;,; ,;,;,; ,;l,;e,;_,;`^,ȏ; ^,Џ;3,؏;@3,;3,;2,;o(;o(;`o(; o(;n(;n( ;`n((; n(0;m(8;m(@;`m(H; m(P;l(X;l(`;`l(h; l(p;k(x;k(;i(;R(;R(;9(;8(;8(;@8(;8(;7(Ȑ;7(А;@7(ؐ;7(;6(;6(;@6(;6(;5(;5(;@5(;5( ;4((;4(0;@4(8;4(@;3(H;3(P;@3(X;3(`;2(h;2(p;@2(x;2(;1(;1(;@1(;1(;0(;0(;@0(;0(;/(ȑ;/(Б;@/(ؑ;/(;.(;.(;@.(;.(;-(;-(;@-(;-( ;,((;,(0;@,(8;,(@;+(H;+(P;@+(X;+(`;*(h;*(p;@*(x;*(;)(;)(;@)(;)(;((;((;@((;((;'(Ȓ;'(В;@'(ؒ;'(;&(;&(;@&(;&(;%(;%(;@%(;%( ;$((;$(0;@$(8;$(@;#(H;#(P;@#(X;#(`;"(h;"(p;@"(x;"(;!(;!(;@!(;(;`(;(;(;(;(ȓ;(Г;@'ؓ;@';';';@';';`';';`'; ' ;'(;'0;`'8; '@;'H;'P;`'X;`'`; 'h; 'p;'x;';';@';';';';';';';'Ȕ;'Д; 'ؔ;';';`'; ';@';';';@';' ;@'(;'0;'8;`'@;'H;'P;'X;`'`;@'h;'p;'x;';@';';';';@';';';';@'ȕ;'Е;'ؕ;';@';';';';@';';';' ;@'(;'0;'8;'@;@'H;'P;'X;'`;@'h;'p;'x;';@+;`+;+;x+;M+;@!+;`*;*; *Ȗ; ,Ж;*ؖ;q*;Z*;`A*;`(*;*;););@); ) ;|)(;Y)0;7)8;)@;@(H; (P;(X; p(`;@'h;'p;'x;';@';';';`'; ';';`';'; 'ȗ;'З;'ؗ; ';';'; ';';';@';';@' ;`'(; '0;'8;`'@; 'H;'P;'X;`'`;'h;'p;`'x; ';';`'; ';';';`'; ';';'Ș;`'И; 'ؘ;';';`'; ';';';`'; ';~' ;~'(;`~'0; ~'8;}'@;}'H;`}'P; }'X;|'`;|'h;`|'p; |'x;{';{';`{'; {';XB;`B;hB;pB;xB;B; B;B;B;#B;)B;?B;SB;eB;vB;B;B;C;C;C;C; C;(C; 0C;&8C;7@C;GHC;XPC;hXC;~`C;hC;pC;xC;C;C;C;C;,C;EC;\C;qC;C;C;C;C;C;C;C;C;D;D;D; D;67 D;(D;0D;8D;@D;HD;PD;'XD;8`D;HhD;ZpD;kxD;}D;D;D;D;D;TD;[D;D;D;D;D;D;D;D;E;;E;HE;WE;m E;(E;0E;b8E;O@E;HE;PE;XE;`E;hE;$pE;xE;E;/E;װE;3E;BE;OE;gE;{E;E;E;E;E;E;E;E;E; F;v(F;0F;@8F;G@F;'HF;.PF;XF;/#F;5F;GF;XF;cF;nF;xF;F;F;F;F;F;F;F;F;F;G;G;G;G; G; (G; 0G;8G;`G;+hG;3pG;;xG;FG;G;VG;QG;^G;mG;G;jG;vG;G;G;G;H;H;H;H; H;\(H;Y0H;8H;@H;@HH;PH;XH;H;H;H;H;H;c H;g H; H;H;H;H;H;!H;*H;.H;H;I;2I;I;=I;X I;@(I;G0I;8I;&@I;kHI;zPI;XI;V`I;hI;CcpI;mxI;I;I;I;I;I;I;I;I;I;!I;4I; I;ձI; I; I;I;2J;\J;YJ;@J; J;m(J;y0J;|8J;`J;hJ;Č7pJ;$xJ;1J;=J;J;@J;CJ;J;J;FJ;J;IJ;OJ;UJ;XJ;J;J;[J;qK;K;K;K;. K;(K;0K;8K;@K;HK;PK;XK;`K;hK;pK;xK;K; K;  K;&K;:K;K;VK;MK;yK;޸K;K;PK;^K;kK;zK;K;L;L;L;L;q L;(L;0L;8L;@L;HL;wPL;5XL;`L;hL;pL;xL;L;L;L;L;7L;L;L;L;L;L; L;L;GL;L;L;L;M;vM;]M;M;/ M; (M;670M;8M;@M;HM;PM;>XM;K`M;WhM;dpM;pxM;M;M;M;CM;#M;M;M;M;M;M;M;M;M;M;1M;M;N;N;N;N; N;(N;0N;8N; @N;HN;PN;AXN;z`N;hN; pN;#xN;2N;N;N;N; N;N;_N;N;-N;<N;2N;>N;#7N;N;wN;IN;ZO;jO;uO;O; O;(O;>0O;8O;@O;HO;PO;XO;O; O;$O;O;O; O;O;O;O;;O;6O;O;O;O;GO;O;P;P;P; P; P;#(P;)0P;8P;`P;hP;;VpP;xP;P;P;P;P; P;P;P;P;P;P;P;iP;uP; P;%P;*P;.Q;2Q;;Q;DQ;I Q;N(Q;V0Q;^8Q;b@Q;fHQ;oPQ;xXQ;T`Q;QhQ;apQ;|xQ;Q;Q;Q;Q;Q;Q;Q;Q;Q;Q;Q;Q;/#Q;Q;\Q;Q;R;R;R;r R; R; (R;=0R;X 8R;b @R;HR;_PR;XR;`R;hR;pR;xR;R;YR;; R;R;R;ZT8R;R;R;R;ER;@R;R;aS;S;mS;&S;y S;(S;7 0S;38S;@S;HS;PS;XS;`S;hS;:pS;GxS;S;S;US;.S;S;S;S;S;S;S;%S;2S;9S;FS;MS;TS;`T;T;T;T;  T; (T;0T;8T;@T;HT;!PT;%XT;)`T;-hT;1pT; xT;$T;oT;}T;5T;@T;T;T;T;T; T;T;P"T; T;JT;OT;TT;XU;\U;aU;fU;u U;(U;0U;8U;@U;HU;PU;s XU;D`U;hU;pU;xU;U;U;U;^U;cU;U;U;U;U;U;U;"U;)U;/U;6U;=U;CV;JV;QV;XV;^ V;d(V;j0V;p8V;v@V;|HV;PV;XV;`V;hV;pV;xV;V;V;V;V;V;V;V;V;V;V;V;V;V;V;V;V;W;W;W;W;# W;)(W;00W;78W;>@W;DHW;JPW;PXW;V`W;\hW;bpW;hxW;nW;tW;zW;W;W;W;W;W;W;W;W;W;W;W;W;W;X;X;X;e?X; X;(X;0X;8X;@X;HX; PX;XX;`X;'hX;6pX;KxX;X;DX;QX;]X;`X;X;VX;bX;OX;cX;X;fX;tX;X; X;X;Y;Y;Y;Y; Y; (Y;&0Y;8Y;@Y;THY;[PY;XY;Y;Č7Y;VY;KY;GY;Y;/#Y;rY;Y;[mY;׺Y;ݺY;Y;Z;Z;Z;Z; Z;(Z;0Z;8Z;@Z;HZ;'PZ;4XZ;R`Z;phZ;pZ;xZ;Z;Z;Z;(I Z;HI Z;Z;Z;Z;Z;$Z;4Z;DZ;6Z;=Z;SZ;`Z;k[;x[;[;[; [;([;0[;8[;@[;H[;P[;X[;'`[;7h[;Cp[;hI x[;I [;I [;N[;Z[;d[;p[;z[;[;[;[;[;[;[;'[;1[;C[;U\;D\;M\;6 \;A \;f(\;l0\;j8\;r@\;H\;P\;X\;`\;rh\;|p\;x\;\;\;\;\;\;\;\;ʻ\;ӻ\;ٻ\;\;\;\; \;\;\;];+];4];]; ];)(];;0];M8];^@];jH];vP];GX];N`];_h];gp];x];];];y];];];];];];];];];];1];];];C];^;^;^; ^;' ^;,(^;;0^;D8^;V@^;cH^;oP^;X^;`^;h^;p^;x^;M^;X^;G^;S^;^;^;^;^;^;^;,^;=^;U^;m^;^;^;_;I _;J _;0J _; _;(_;0_;8_;3@_;=H_;EP_;OX_;W`_;ah_;ip_;sx_;{_;_;_;_;_;_;_;_;_;_;_;_;_; _;%_;;_;G`;S`;^`;j`;u `;(`;0`;8`;@`;H`;XJ P`;J X`;J ``;J h`;J p`;K x`;8K `;`K `;K `;K `;K `;K `;L `;@L `;hL `;L `;L `;L `;L `; M `;HM `;hM `;M a;M a;M a;N a;(N a; (a;%0a;A8a;HN @a;pN Ha;N Pa;N Xa;N `a;O ha;8O pa;`O xa;O a;[a;pa;a;a;a;a;a;a;a;$a;/a;@a;Qa;a; a;ab;vb;b;b; b;(b;0b;8b;@b;*Hb;Pb; Xb;O `b;O hb;P pb;xb;+b;<b;Lb;^b;pb;b;b;b;½b;˽b;b;b;b;b;b;b;c;c;c;c;& c;8(c;L0c;`8c;r@c;Hc;Pc;Xc;`c;hc;pc;xc;c;c;'c;:c;Qc;޽c;c;c;c;gc;vc;c;c;c;c;c;d;d; d;d;, d;9(d;J0d;Z8d;s@d;Hd;Pd;T Xd;{ `d;hd;pd;$xd;9d;?d;d;d;d;d;d;Yd;bd;d;d;d; P d;HP d;pP d;4d;ue;e;Ie;de;P e;P (e;|0e;8e;@e;¾He;ʾPe;Xe;`e;he;pe;xe;e;e;P e;Q e;(Q e;e;*e;>e;Ke;HQ e;hQ e;We;se;e;Q e;Q e;f;ܾf;f;f; f;(f;0f;8f;@f;Hf;$Pf;6Xf;G`f;[hf;opf;xf;f;f;f;f;f;f;f;f;f;f;#f;7f;Jf;[f;lf;|f;g;g;g;g; g;(g;0g;8g; @g;Hg;-Pg;>Xg;K`g;Whg;kpg;xg;*g;5g;g;g;g;g;g;^g;eg;vg;~g;g;g;g; g; g;! h;+ h;4 h;C h;R h;(h;0h;` 8h;¿@h;пHh;ݿPh;Xh;n `h;hh;ph;{ xh; h;zh;h; h; h; h;$h;+h; h; h;+ h;C h;O h;[ h;f h;} h; i; i; i; i; i; (i;  0i; 8i;<@i;LHi;ePi;mXi;`i;hi;pi;xi;, i;H i;d i;} i; i; i; i; i;i;i; i; i;Q i;Q i;R i; i; j;@R j;hR j;R j; j;(j;0j;8j;@j; Hj;$ Pj;8 Xj;J `j;hj;4pj;` xj;Ij;`j;w j; j; j; j; j;J j;ej; j; j; j; j;j;j;j;k; k; k; k; k; (k;# 0k;. 8k;7 @k;G Hk;W Pk;e Xk;u `k; hk; pk; xk; k; k; k; k; k; k; k; k; k; k;k;k;k;k; k;+ k;7 l;T l;q l;l; l; (l;0l;8l;@l;Hl; Pl;Xl;`l;*hl;0pl; xl; l; l;Jl;Ql;Xl;bl; l;ll;vl;l;l; l; l; l; l; l; m;) m;5 m;? m;K m;U (m;a 0m;k 8m;w @m; Hm; Pm; Xm; `m; hm; pm; xm; m;  m;/ m;@ m;Q m;` m;q m; m; m; m; m; m; m; m; m; m; n;$ n;0 n;: n;F n;P (n;\ 0n;f 8n;y @n; Hn;Pn;Xn; `n; hn; pn;xn;n; n;;;.;;;;;; ;;;1 ;(;(n70;8;@;!H;4P; X;ձ`;Fh;Sp;_x;b;e;o;m;y;|;; ;&;;;;w;;;;;Ѻ;Ժ ;(;0;8;ɺ`;׺h;ݺp;x;;;;;;;;,;1;6;=;D;M;V;[;`;e;j;r;z; ;(;0;8;@;H;P;X;`;h;p;x;ʻ;ӻ;ٻ;߻;;;;;;; ;;;!;&;+;4;=;B;G;N ;U(;Z0;_8;g@;oH;tP;yX;`;h;p;x;;;;;;Ҽ;׼;ܼ;;;;;;; ;';,;1;6;;;D ;M(;X0;c8;h@;mH;tP;{X;`;h; p;x;;;;;*;;;;;½;˽;Խ;ٽ;޽;;;;;;; ;(;$0;/8;4@;9H;?P;EX;J`;Oh;Tp;Yx;b;k;p;u;;;;;;;;¾;ʾ;Ҿ;׾;ܾ;;;;; ;(; 0;8;@; H;%P;*X;5`;@h;Ep;Jx;O;T;Y;^;e;l;q;v;~;;;;;;;;;;;¿;п ;ݿ(;0;8;@;H;P;X;`;h;p;$x;+;2;7;<;L;[;`;e;m;u;z;;;;;;;;;; ;(;0;8;@;H;P;X;`;h;p; x;;;4;I;`;v;{;;;;;;;;;; ; ; ; ; ;( ;0 ;8 ;@ ;H ;P ;X ;` ;h ;p ;*x ;0 ;6 ;; ;@ ;E ;J ;Q ;X ;b ;l ;v ; ; ; ; ; ;!;!;!;!; !;(!;0!;8!;@!;H!;P!;X!;`!;h!;p!;x!;!;!;!;!;!;!;!;!; !;!;!; !;)!;1!;6!;;!;@";E";L";S";X ";](";d0";k8";t@";}H";P";X";`";h";p";x";";";";";";";";";";";";";"; ";";$";0#;<#;A#;F#;S #;_(#;d0#;i8#;w@#;H#;P#;X#;`#;h#;p#;x#;#;#;#;#;#;#;#;#;] #;#;#;#;#;!#;&#;+#;0$;5$;:$;?$;G $;O($;W0$;_8$;d@$;iH$;sP$;}X$;`$;h$;p$;x$;$;$;$;$;$;$;$;$;$;$;$;$;$;$;$;$; %;%;%;%;3 %;H(%;M0%;R8%;X@%;^H%;gP%;oX%;t`%;yh%;p%;x%;%;%;%;%;%;%;%;%;%;%; %;0%;;%;E%;P%;Z%;b&;i&;n&;s&;y &;(&;0&;8&;@&;H&;P&;X&;`&;h&;p&;x&;&;&;&;&;&;&;&;&;&;&; &;&;&;$&;)&;.&;3';8';A';I';N ';S(';X0';]8';b@';gH';rP';}X';`';h';p';x';';';';';';';';';';';';';';';';';(;(;(;(; (;$((;)0(;.8(;9@(;DH(;IP(;NX(;V`(;^h(;fp(;nx(;s(;x(;}(;(;(;(;(; (; (;(;(;(;(;(;(;(;); ););); );();0);8);@);H);P);X); `);h);p);x);%);/);4);9);A);I);N);S);`);l);q);v);}););););*;*;*;*; *;(*;0*;8*;@*;H*;P*;X*;`*;h*;p*;x*;*; *;*;*;*;*;$*;)*;0*;7*;>*;E*;J*;O*;T*;Y*;`+;g+;l+;q+;v +;{(+;0+;8+;@+;H+;P+;X+;`+;h+;p+;x+;+;+;+;+;+;+;+;+;+;+;+;+; +;+;+;*+;/,;4,;9,;>,;G ,;P(,;=0,;X8,;\@,;`H,;eP,;jX,;o`,;th,;}p,;x,;,;,;,;,;,;,;,;,;,;,;,;,;,;,;,;,;-;-;-;-;  -;(-;!0-;&8-;+@-;0H-;5P-;:X-;?-;.-;ٱ-;D-;J-;P-;S-;V-;K-;c -;g -;=-;X-;@-;G-;h-;.; .;  .;.;# .;(.;Cc0.; 8.;q@.;\H.;bP.;X.;1`.;h.;(n7p.;hx.;p.;.;.;x.; .;{.;.;p.;.;.;.;.;.;.;u.;.;/;/;/;Y /; /;(/;m0/;y@/;H/;YP/;X/;`/;h/;p/;x/;/;/;/;/;/;C/;/;/;/;/;/;/;/;/; /;/;0;0;0;0;! 0;&(0;*00;.80;2@0;6H0;:P0;>X0;B`0;; h0;Rp0;C x0;W0;W 0;\0;0;H0;70;L0;0;Q0;0;V0;ZT80;[0;0;0;0;E1;@1;1;a1; 1;m(1;&01;y81;@1;7 H1;3P1;X1;`1;h1;p1;x1;1;:1;G1;1;1;U1;.1;1;1;1;1;1;1;1;1;1;2; 2;2;2; 2;!(2;F 02;82; @2;H2; P2;# X2;``2;dh2;hp2;lx2;p2;t2;x2;|2;2;2;2;2;2;2;2;2;2;2;2;2;3;3;3;3; 3;(3;03;83;@3;H3;P3;X3;`3; h3;p3;x3;3;&3;.3;73;@3;J3;U3;a3;o3;3;!_3;3;X3;3;6W4;4;_4;4; 4;(4;/#04;84;1@4;H4;(n7`4;h4;Gp4;vx4;]4;I#4;4;v4;4;54;4;4;S4;4;G4;v4;]5;I#5;5;v5;@5;H5; P5;X5;`5;h5;p5;x5;5;5;5;5;5;5;5;5;5;B5;H 5; 5; 5;5;5;"5;6; 6;%6;(6;+ 6;.(6;:06;E86;R@6;^H6;iP6;sX6;`6;h6;p6;x6;6;6;6;P6;S6;6;6;6;6;6;6;6;6;"6;26;A6;^7;y7;7;7; 7;c (7;g 07; 87;@7;H7;P7;X7;`7;2h7;p7;=x7;X7;7;7;7;7;7;7;7;7;7;7;7;7;7;7;7;8;8;8;t8; 8;(8;08;w88;@8;H8;P8;X8;'`8;3h8;?p8;Kx8;8;N8;Q8;T8;W8;Z8;]8;8;Cc8;`8;j8;s8;8;8;8; 8;9;9;9;Ї9;Լ 9;(9;109;89;(n7@9;H9;P9;X9;`9;h9;p9;x9;9;9;9;9;9;9;!9;$9;.9;!9;49; 9;ձ9;@9;9;89;;:;:;:;:;b :;>(:;#70:;H8:;S8@:;PH:;=P:;KX:;N`:;Qh:;] p:;Tx:;[:;b:;o:;}:;w:;{:;:;m:;y:;:;:;|:;:;:;;;;;Č7;;;;Tj7 ;;(;;0;;8;;@;;H;;VP;;X;;`;;h;;p;; x;;&;; ;;;;\;;Y;;%;;1;;;;;;=;;I;;T;;a<;m<;y<;<; <;(<;0<;8<;@<;H<;P<;rX<;`<;h<;p<;x<;<;<;<; <;Ҵ<;<;<;<;@<;E<;P<;<;<; <;$<;(<;.=;4=;8=;<=;N =;](=;v0=;8=;@=;H=;n7P=;X=;`=;Eh=;Up=;x=;(=;5=;>=;]=;l=;=;=;=;=;=;=;=;=;=;=;=; >;>;&>;2>;@ >;M(>;\0>;j8>;x@>;H>;P>;X>;`>;h>;p>;x>;>;>;>; >;>;'>;8>;H>;X>;g>;w>;>;>;>;>;>;?;?;?;?; ?;-(?;@0?;R8?;b@?;qH?;P?;X?;`?;h?;p?;x?;?;?;?;?;?;%?;5?;D?;U?;e?;w?;?;?;?;?;?;@;@;@;@; @;)(@;80@;F8@;V@@;eH@;vP@;X@;`@;h@;p@;x@;@;\@;h@;@;@;@;@;@;@;u@;@;@;@;@;@;@;A;A;A;A; A;O(A;_0A;8A;@A; HA;PA; XA;`A;hA;#pA;/xA;9A;BA;MA;WA;[A;A;A;_A;kA;vA;A;A;A;A;A;A;B;IB;SB;B; B;(B;0B;8B;@B;HB;PB;:w::ſ:ѿ :޿(:F0:8:@:H:P:X:`: h:p:x:::ԇ:!:&:,:2:8:=:C:J:Q:X:`:h:p:x:::: :(:0:8:@:H:P:X:`:h:p:x:::::::::!:+:5:D:K:W:i:::::: :(:0:8:@:H:$P:6X:B`:Sh:\p:jx:s:::::::::::::-:;:N:Y:i:r : (: x: : : : (:` @: h:p : : : :P @:dh: x:` :p :0 : (: 8: h: x: : : : : (: h: : : : : (: : : : : :p :P : (:@ p: : :г :P (: `: h:0 x: : : : :` : (: h: : :0 : :P : :(:0:8:@:H:=P:X:`:h:p:x:::Q::U:::::::::::::::#: :*(:@0:08:n@:5H:DP:C%X:I`:Rh:\p:jx:z:::::::::::):>:S:i:::::: :(:0:8:@:(H:=P:QX:g`:gh:p:x:::::::::::::::4:,:G:c:[:~:v :(:0:8:@:H:P:X:`:h:^p:x:::):8:G:V:f:v:::::::::::&:0:: :D(:d0:|8:@:\H:tP:X:`:h:p:x::: :::8:[:g:b:zx:yx:l:q:v::{q:D:W::#:H :n(:U0:T8:[@:"H:67P:mX:c`:ih:qp:x:y:|::::::::::::: :::::): :4(:0:8:I@:OH:7P:^X:&$`:$h:ip:x::::::::::::W :::::: ::&:6 :M(:j0:8:@:H:P:X:`:h: p:x:::(:<:6:K:_:k:%:v::~:::':0:::!:: :(:0:8: @:H:P:X:`:h:p:[mx:K:ym: :':-:7:5:;:@:H:Q::d:::i:\:m::m:t :|(:0:8:@:wH:P:X:`:h:p:x::::::::::::m:m::"::%:(:+:.:1 :4(:D 0:8:7@::H:=P:@X:n`:Ch:Fp:Ix:~:L:O:R:U:X:[:r :^: n:d:&n:n:-n:k:~:r:z::: :(:0:8:@:H:P:X:`:h:"p:x::::::>::: :':-:3:::A:I:R:Y:En:`:g:m :t(:&0:{8:@:H:P:X:`:h:p:x:::::*:;:G:U:c:n:y:::::::::: :(:0:8:@:H:P: X:`:> h:p:)x:A:S::m:e:e:e:x::::::::: ::*:2:A :U(:g0:y8:@:5_H:=_P:E_X:M_`:R_h:X_p:x:::::m?:D:C%:I:R:0Y:::::::: :: :(:&0:,8:I@:6H:5P:c\8X:`:{#h:p:=x:F:O:Y:c:>::k:q:{::::::::މ:"::: :(:0:8:@:H:P:X:`:h:p:x::::::::: ::V::::'::,:#:1:-:6 :7(:;0:A8:@@:GH:EP:LX:P`:Th:p:x:X:\:b:k:t:a:j:s:{::::::::;2;[;g;b ;zx(;yx0;l8;q@;vH;P;{qX;D`;Wh;p;#x;;n;U;T;[;";67;m;c;i;q;;y;|;;;;;;; ;(;0; 8;@;H; P;X;`;h;p;x;;%;;;I;0;7;5;<;E;N;;;;;;;;X;b;l ;u(;~0;8;@;-H;P;X;`;h;"p;x;;;;;;;;;;; ;;;;;; ;;;!;' ;-(;20;78;A@;H;'P;0X;`;h;!p;x;T;K;X;e;r;;;;;;;[m;K;; ;';-;7;5;;;@ ;H(;0;8;d@;H;P;X;`;mh;p;mx;t;|;;;;w;;;;;;;;;;;;;;; ;(;0;m8;m@;H;P;X;`;h;p;'x;,;3;;;C;K;T;];d;k;q;w;~;;;;;;;;;^ ; n(;d0;&n8;n@;-nH;kP;~X;r`;zh;p;x;;;;;;;;;;;";;;;;;;>;;;  ;'(;-0;38;:@;AH;IP;RX;Y`;Enh;`p;gx;m;t;&;;;#;;;;;; ;;;$;,;5;@;J;S;\ ;e(;n0;v8;@;H;P;X;`;h;p;x;;;;;;;; ;;> ;;;;;;m; ; ;" ;* ;3 ;( ;=0 ;H8 ;P@ ;UH ;ZP ;gX ;t` ;h ;p ;x ; ;%_ ;-_ ; ; ;5_ ;=_ ;E_ ;M_ ;R_ ;X_ ; ; ; ; ; ; ; ;& ; ;s( ;|0 ;!@ ;QvH ;P ;X ;` ;h ;p ; x ; ; ; ;* ; ; ;1 ;$s ;7 ; ;; ;S ;@ ;E ;J ;N ;R ;W ;\ ;a( ;f0 ;8 ;k@ ;pH ;wP ;|X ;` ;h ;p ;x ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;( ;0 ; 8 ;@ ;H ;P ;$X ;*` ;0h ;6p ;<x ;B ;H ;N ;T ;Z ;` ;f ;l ;r ;x ;~ ; ; ;G= ;$ ; ; ;( ;0 ;8 ;@ ;qWH ;VP ;VX ;` ;h ;Wp ;x ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;X ;W ;W;W;W;W;W ;W(;W0;8;@;H; P;X;`;h;p;#x;&;*;.;3;6;:;>;C;F;J;N;UW;GW;S;V;Z;a;f;k;p;u ;{(;~0;8;@;H;P;`;p h;`[ p;0 ;pE ;~;;;;;;; ;(;0;8;@;H;P; X; ;;H;  ;;;̊;;؊0;H;`;x;#;1;?;Q;e;p; ;8;P;h;ɋ;;; ;;*;=;K(;Z@;fX;v;;ı;ȱ;̱;б;Ա;ر;ܱ;;;;;;; ;(;0;8;H;;P;;X;;`;Y;h;Y;p;R;x;`P;;O;;`J;;H;;G;;`G;;F;; F;;E;;B;;;;;;;;@5;;4;;`4;;3;;@/;;-;;`;;;; ; ;ݸ(;0;c 8;g @;H;P;X; `; h;p;x;;;!;*;.;;;2;;=;X;@;G;N;[;h;; ;  ;;& ;k(;z0;8;@;H;P;X;`;h;p;x;#;;Cc;;;ù;͹;׹;޹;PL_origfilenamePL_envgvPL_minus_aPerl_hv_iterinitPerl_hv_iternext_flagsPerl_my_setenvPerl_av_shiftPL_stderrgvperl_destructPerl_grok_atoUVPL_exit_flagsPL_minus_cPerl_PerlIO_stdoutPerl_PerlIO_flushPerl_my_fflush_allPL_main_cvPerlIO_destructPerlIO_cleanupPerl_PerlIO_closePL_minus_FPL_minus_nPL_minus_pPL_minus_lPL_unsafePL_ofsgvPL_ors_svPL_efloatbufPL_statgvPL_efloatsizePL_argvoutgvPL_last_in_gvPL_DBcontrolPL_replgvPL_argvout_stackPL_subnamePL_collation_namePL_numeric_namePL_numeric_radix_svPL_underlying_radix_svPL_warn_localePL_AboveLatin1PL_Assigned_invlistPL_GCB_invlistPL_HasMultiCharFoldPL_InMultiCharFoldPL_Latin1PL_LB_invlistPL_SB_invlistPL_SCX_invlistPL_UpperLatin1PL_in_some_foldPL_utf8_foldclosuresPL_utf8_idcontPL_utf8_idstartPL_utf8_perl_idcontPL_utf8_perl_idstartPL_utf8_xidcontPL_utf8_xidstartPL_WB_invlistPL_utf8_toupperPL_utf8_totitlePL_utf8_tolowerPL_utf8_tofoldPL_utf8_tosimplefoldPL_utf8_charname_beginPL_utf8_charname_continuePL_utf8_markPL_CCC_non0_non230PL_Private_UsePL_XPosix_ptrsPL_Posix_ptrsPerl_sv_clearPL_psig_namePL_psig_ptrPL_psig_pendPL_taint_warnPL_debugPL_mess_svPerl_PerlIO_restore_errnoPerl_my_exitabortPL_origargvPerlIO_putsPerl_moreswitchesPerl_grok_bin_oct_hexPerl_newSVPL_do_undumpperl_parsePL_origargcPL_origalenPL_basetimePerl_hv_name_setPL_globalstashPerl_set_caret_XPerl_gv_fetchfilePerlIO_openPerl_sv_catpvPL_minus_EPerlIO_fdopenPerl_PerlIO_filenofstat64Perl_rsignal_statePerl_pad_newPerl_PerlIO_stdinPerl_setdefoutPL_defoutgvPL_signalsPerl_sv_getsstrstrPerlIO_ungetcPL_my_environPerl_filter_addPerl_gv_checkPerl_rsignalPerlIO_binmodeperl_runPerl_my_failure_exitPerl_xs_boot_epilogPerl_mro_meta_initPerl_mro_get_linear_isaXS_NamedCapture_flagsPerl_sv_setuvPerl_gv_stashpvnPerl_sv_blessPerl_sv_isobjectXS_UNIVERSAL_import_unimportPerl_sv_reftypePerl_sv_derived_from_svPerl_sv_derived_from_pvPerl_sv_derived_from_pvnPerl_vnormalPerl_vstringifyPerl_sv_derived_from_hvPerl_sv_isa_svPerl_gv_fetchmeth_pvnPerl_sv_does_svPerl_sv_eq_flagsPL_isa_DOESPerl_sv_refPerl_tmps_grow_pXS_UNIVERSAL_DOESPerl_sv_doesPerl_sv_does_pvPerl_sv_does_pvnPerl_croak_xs_usageXS_UNIVERSAL_isaXS_UNIVERSAL_canPerl_gv_fetchmethod_sv_flagsXS_utf8_is_utf8XS_utf8_validPL_extended_utf8_dfa_tabPerl_is_utf8_FF_helper_XS_utf8_encodePerl_sv_utf8_encodeXS_utf8_decodePerl_sv_pvn_force_flagsXS_utf8_upgradePerl_sv_utf8_upgrade_flags_growPerl_sv_setiv_mgXS_utf8_downgradePerl_sv_utf8_downgrade_flagsXS_utf8_native_to_unicodePerl_sv_2uv_flagsXS_utf8_unicode_to_nativeXS_Internals_SvREADONLYXS_constant__make_constXS_Internals_SvREFCNTXS_Internals_hv_clear_placeholdPerl_hv_clear_placeholdersXS_Internals_stack_refcountedXS_PerlIO_get_layersXS_re_is_regexpPerl_get_re_argXS_re_regnames_countXS_re_regnameXS_re_regnamesXS_re_regexp_patternXS_NamedCapture_tie_itPerl_sv_setrv_noincPerl_sv_unmagicXS_NamedCapture_TIEHASHPerl_newSVrvXS_NamedCapture_FETCHPerl_croak_no_modifyXS_NamedCapture_FIRSTKEYPerl_vnumifyPerl_av_reifyPerl_av_extendPerl_newSVpv_sharePerl_mg_copyPerl_av_makePerl_newAVavPerl_newAVhvPerl_hv_iterkeysvPerl_hv_itervalPerl_mg_clearPerl_av_popPerl_av_lenPerl_av_fillPerl_av_undefPerl_av_deletePerl_av_existsPerl_av_arylen_pPerl_av_iter_pXS_builtin_trueXS_builtin_falseXS_builtin_infPL_infXS_builtin_nanPL_nanXS_builtin_func1_voidXS_builtin_load_modulePerl_pad_add_name_svXS_builtin_created_as_stringXS_builtin_created_as_numberXS_builtin_trimPerl_report_uninitXS_builtin_export_lexicallyPerl_sv_setuv_mgPerl_sv_setpv_mgPerl_sv_setnv_mgXS_builtin_func1_scalarPerl_pad_findmy_svXS_builtin_importreadlinkPerl_valid_identifier_svPerl_scan_versionPerl_save_set_svflagsPerl_newHVhvPerl_croak_kw_unless_classPerl_newSVobjectinjected_constructorPerl_save_clearsvPerl_find_runcvPerl_class_setup_stashPerl_suspend_compcvPerl_class_apply_attributesPerl_class_seal_stashPerl_resume_compcvPerl_padnamelist_freePerl_class_prepare_initfield_parsePerl_class_prepare_method_parsePerl_class_add_fieldPerl_padnamelist_storePerl_newPADNAMELISTPerl_class_apply_field_attributesPerl_class_set_field_defopPerl_class_add_ADJUSTPerl_debPerl_vdebPerl_debstackptrsPerl_debstackPL_forkprocessPerl_my_pclosefcntl64PL_strategy_dupPL_strategy_dup2dup3Perl_PerlIO_clearerrgetsocknamePerlIO_opennPL_warn_nlPL_strategy_open__open64_2PL_strategy_open3PL_strategy_mkstempmkostemp64mkstemp64PL_strategy_pipepipe2PL_strategy_socketPL_strategy_acceptaccept4PL_strategy_socketpairPerlIO_intmode2strPerl_my_popen_listPerlIO_apply_layersPerl_my_popenPerlIO_fdupopenPerl_sv_2ioPerl_taint_envPerl_looks_like_numberPerl_do_opennPerl_PerlIO_errorPerl_my_dirfdrenameatfchmodunlinkatunlinkrenameclosedirPerl_do_closePerl_mg_findextPerl_mg_freeextPL_lastfdPL_filemodePL_oldnamePerl_sv_untaintumaskopendirfchownPerlIO_has_cntptrPerl_PerlIO_get_cntPerlIO_getcPerlIO_canset_cntPerl_PerlIO_set_cntPerl_PerlIO_tellPerl_PerlIO_seeklseek64PerlIO_isutf8Perl_uiv_2bufPerl_utf8_to_bytes_Perl_PerlIO_writePerl_bytes_to_utf8_free_mePerl_my_stat_flagsPL_statcachePerl_my_lstat_flagslstat64execvpPL_sh_pathexeclPerl_whichsig_pvnkillpgPerl_sv_taintedfutimes__getgroups_chkshmgetsemgetmsggetPerl_sv_2pvbyte_flagssemctlshmctlmsgctlmsgsndmsgrcvsemopshmatshmdtPerl_save_helem_flagsPL_strict_utf8_dfa_tabPerl_utf8_to_uv_msgs_helper_Perl_do_joinPerl_do_sprintfPerl_sv_vsetpvfnPerl_is_lvalue_subPerl_hv_placeholders_getPerl_grok_bslash_cPerl_form_alien_digit_msgPerl_pv_uni_displayPerl_form_cp_too_large_msgPerl_grok_bslash_oPerl_grok_bslash_xPerl_gv_fullname4PL_op_sequencePL_op_seqPerlIO_vprintfPerl_pv_escapePerl__is_uni_FOOPerl_my_snprintfPerl_pv_displayPerl_sv_peekPerl_set_numeric_standardPerl_set_numeric_underlyingPerl_sv_uni_displayPerl_dump_vindentPerl_dump_indentPerl_opdump_printfPerl_vnewSVpvfPerl_gv_dumpPerlIO_putcPerl_do_hv_dumpPerl_do_gv_dumpPerl_do_gvgv_dumpPerl_multideref_stringifyPerl_multiconcat_stringifyPerl_debopPerl_runops_debugPL_watchokPerl_op_classop_class_namesPL_op_private_bitdef_ixPL_op_private_labelsPL_op_private_bitdefsPL_op_private_bitfieldsop_flags_namespmflags_flags_namesPerl_do_pmop_dumpPerl_pmop_dumpPerl_do_op_dumpPerl_op_dumpPerl_dump_subPerl_dump_formPerl_dump_packsubsPerl_PerlIO_setlinebufPerl_dump_evalPerl_dump_allPerl_do_sv_dumpfirst_sv_flags_namessecond_sv_flags_namescv_flags_namesPerl_do_magic_dumpPerl__invlist_dumphv_flags_namesregexp_extflags_namesgp_flags_imported_namesPL_core_reg_enginegp_flags_namesregexp_core_intflags_namesPL_magic_vtable_namesPerl_magic_dumpPerl_sv_dump_depthPerl_sv_dumpPerl_av_dumpPerl_hv_dumpPerl_debprofdumpPerl_re_compilePerl_regexec_flagsPerl_re_intuit_startPerl_re_intuit_stringPerl_regfree_internalPerl_reg_numbered_buff_fetchPerl_reg_numbered_buff_storePerl_reg_numbered_buff_lengthPerl_reg_named_buffPerl_reg_named_buff_iterPerl_reg_qr_packagePL_EXACT_REQ8_bitmaskPL_EXACTFish_bitmaskPL_simple_bitmaskPL_simplePL_varies_bitmaskPL_variesPL_reg_intflags_namePL_reg_extflags_namePL_regnode_infoPL_regnode_namePL_c9_utf8_dfa_tabPL_deBruijn_bitpos_tab64PL_deBruijn_bitpos_tab32PL_valid_types_NV_setPL_valid_types_IV_setPL_valid_types_RVPL_valid_types_PVXPL_valid_types_NVXPL_valid_types_IVXPL_magic_dataPL_runops_dbgPL_runops_stdPL_user_def_propsPL_infix_pluginPerl_infix_plugin_standardPL_keyword_pluginPerl_keyword_plugin_standardPL_watch_pvxPL_perlio_debug_fdPL_perlio_fd_refcnt_sizePL_perlio_fd_refcntPL_csighandler3pPerl_csighandler3PL_csighandler1pPerl_csighandler1PL_csighandlerpPerl_csighandlerPL_wcrtomb_psPL_mbrtowc_psPL_mbrlen_psPL_fold_localePL_random_statePL_body_arenasPL_ptr_tablePL_pad_reset_pendingPL_colorsetPL_in_utf8_COLLATE_localePL_collxfrm_basePL_padix_floorPL_constpadixPL_padixPL_max_intro_pendingPL_min_intro_pendingPL_delaymagic_egidPL_delaymagic_gidPL_delaymagic_euidPL_delaymagic_uidPL_nomemokPL_comppad_name_floorPL_comppad_name_fillPL_reentrant_retintPL_colorsPL_secondgvPL_firstgvPL_sortstashPL_sortcopPL_lastgotoprobePL_hv_fetch_ent_mhPL_naPL_SvPL_padname_constPL_padname_undefPL_regmatch_statePL_sv_arenarootPL_localizingPL_curpm_underPL_multideref_pcPL_op_private_validPL_phase_namesPL_block_typePL_mod_latin1_ucPL_latin1_lcPL_fold_latin1PL_foldPL_sig_numPL_sig_namePL_bitcountPL_uudmapPL_uuemapPL_subversionPL_versionPL_revisionPL_hexdigitPL_ZeroPL_extended_cp_formatPL_no_localize_refPL_no_myglobPL_no_funcPL_no_dir_funcPL_no_sock_funcPL_no_securityPL_no_modifyPL_no_helem_svPL_no_aelemPL_no_usymPL_no_symref_svPL_no_symrefPL_no_wrongrefPL_warn_reservedPL_warn_nosemiPL_warn_uninit_svPL_warn_uninitPerl_gv_const_svPerl_newGPPerl_sv_del_backrefPerl_gp_refPerl_gp_freePerl_gv_name_setPerl_sv_usepvn_flagsPerl_gv_init_pvPerl_mro_package_movedPerl_hv_clearPerl_gv_fetchfile_flagsPerl_fatal_warnerPerl_gv_stashpvPerl_save_scalarPerl_gv_fetchmeth_pvPerl_gv_fetchmeth_pvn_autoloadPerl_gv_fetchmeth_sv_autoloadPerl_gv_fetchmeth_pv_autoloadPerl_gv_autoload_pvnPerl_gv_autoload_svPerl_gv_autoload_pvPerl_gv_fetchmethod_pvn_flagsPerl_gv_fetchmethod_pv_flagsPerl_gv_fetchmethod_autoloadPerl_Gv_AMupdatePerl_amagic_appliesPerl_amagic_callPerl_try_amagic_unPerl_try_amagic_binPerl_amagic_deref_callPerl_gv_handlerPerl_gv_fetchmeth_svPerl_newGVgen_flagsPerl_hv_fillPerl_hv_riter_pPerl_hv_eiter_pPerl_hv_riter_setPerl_hv_rand_setPerl_hv_eiter_setPerl_hv_iterkeyPerl_unsharepvnPerl_hv_free_entPerl_hv_delayfree_entPerl_hv_placeholders_pPerl_hv_scalarPerl_hv_bucket_ratioPerl_hv_iternextsvPerl_hv_placeholders_setPerl_sv_setpvn_freshPerl_hv_undef_flagsPerl_refcounted_he_chain_2hvPerl_refcounted_he_fetch_pvPerl_refcounted_he_fetch_svPerl_refcounted_he_new_pvnPerl_refcounted_he_new_pvPerl_refcounted_he_new_svPerl_locale_panicPerl_mini_mktimenl_langinfostrpbrkPerl__byte_dump_stringPerl_newSVpvzPerl_warn_problematic_localePerl_setlocalePerl_mbtowc_mbtowcPerl_localeconvPerl_sv_langinfoPerl_langinfoPerl_langinfo8Perl_my_strftimePerl_sv_strftime_intsPerl_sv_strftime_tmPerl_utf8_length__ctype_b_locPerl_strxfrmtowupper__ctype_get_mb_cur_max__ctype_tolower_loc__ctype_toupper_loctowlowerPerl_switch_to_global_localePerl_sync_localePerl_refPerl_sv_unrefPerl_sv_unref_flagsPerl_sv_taintPerl_sv_2ivPerl_sv_2uvPerl_sv_2nvPerl_sv_2pvPerl_sv_2pv_nolenPerl_sv_2pvbyte_nolenPerl_sv_2pvutf8_nolenPerl_sv_2pvutf8_flagsPerl_sv_force_normalPerl_sv_setsvPerl_sv_catpvnPerl_sv_catpvn_mgPerl_sv_catsvPerl_sv_catsv_mgPerl_sv_pvPerl_sv_pvn_forcePerl_sv_pvbytePerl_sv_pvutf8Perl_sv_utf8_upgradePerl_hugePerl_gv_fullname3Perl_gv_efullname3Perl_gv_fetchmethodPerl_hv_iternextPerl_hv_magicPerl_do_openPerl_do_aexecPerl_sv_nolockingPerl_sv_usepvn_mgPerl_sv_usepvnPerl_hv_store_entPerl_hv_exists_entPerl_hv_fetch_entPerl_hv_delete_entPerl_hv_store_flagsPerl_hv_storePerl_hv_existsPerl_hv_fetchPerl_hv_deletePerl_newAVPerl_newHVPerl_sv_insertPerl_save_freesvPerl_save_mortalizesvPerl_save_freeopPerl_save_freepvPerl_save_opPerl_gv_SVaddPerl_gv_AVaddPerl_gv_HVaddPerl_gv_IOaddPerl_newIOPerl_my_statPerl_my_lstatPerl_sv_eqPerl_sv_collxfrmPerl_sv_collxfrm_flagsPerl_sv_2boolPerl_newSUBPerl_sv_mortalcopyPerl_sv_copypvPerl_is_utf8_char_bufPerl_utf8_to_uvuniPerl_newSVsvPerl_sv_utf8_downgradePerl_sv_2pvutf8Perl_sv_2pvbytePerl_uvuni_to_utf8Perl_utf8n_to_uvuniPerl_utf8_to_uvchrstrnlensigprocmaskPerl_mg_magicalPerl_save_allocPerl_sv_set_undefPerl_emulate_cop_ioPerl_sv_string_from_errnumPerl_sv_setrv_incPerl_sv_rvweakenPerl_delimcpy_no_escapePerl_my_clearenvPerl_save_re_contextPerl_sv_regex_global_pos_getPerl_sv_regex_global_pos_setPerl_sv_regex_global_pos_clearPerl_sv_len_utf8Perl_sv_pos_u2b_flagsPerl_sv_len_utf8_nomgPerl_vivify_defelemPerl_mg_find_mglobprctlseteuidsetegidsetgroupssetreuidsetregidPerl_new_warnings_bitfieldsigemptysetsigaddsetPerl_whichsig_svPerl_whichsig_pvPerl_perly_sighandlerPerl_sv_2cvsigactionPerl_die_svsigismemberPerl_mro_get_private_dataPerl_mro_set_private_dataPerl_mro_get_from_namePerl_mro_registerXS_mro_method_changed_inPerl_mro_set_mroPerl_my_strtodPerl_cast_ulongPerl_cast_i32Perl_cast_ivPerl_cast_uvPerl_grok_binPerl_grok_hexPerl_grok_octPerl_scan_binPerl_scan_octPerl_scan_hexPerl_grok_numeric_radixPerl_grok_number_flagsPerl_grok_infnanPerl_my_atof3Perl_my_atofPerl_my_atof2Perl_isinfnanPerl_find_rundefsvPerl_save_strlenPerl_pad_pushPerl_newPADNAMEpvnPerl_newPADNAMEouterPerl_padname_freePerl_save_boolPerl_pad_add_name_pvPerl_pad_findmy_pvXS_PerlIO__Layer__NoWarningsPerlIOUtf8_pushedPerlIOBase_noop_okPerlIOBase_noop_failPerlIOBase_eofPerlIOBase_errorPerlIOBase_setlinebufPerlIOUnix_filenoPerlIOBuf_get_basePerlIOUnix_tellPerlIOStdio_errorferrorPerlIOStdio_readfreadfgetcPerlIOStdio_seekfseeko64PerlIOStdio_tellftello64PerlIOStdio_flushfflushPerlIOStdio_fillPerlIOStdio_eoffeofPerlIOStdio_clearerrPerlIOStdio_setlinebufPerlIOUnix_seekPerlIOStdio_writefwritePerlIOBase_poppedPerlIOBuf_poppedPerlIOStdio_filenoPerlIOScalar_eofperlsio_binmodePerlIO_debugPerlIO_allocatePerlIO_list_allocPerlIO_list_freePerlIO_list_pushPerlIO_clone_listPerlIO_clonePerlIO_popPerlIOBase_binmodePerlIOPending_flushPerlIOCrlf_binmodePerlIO_find_layerPerlIO_tab_svXS_PerlIO__Layer__findPerlIO_define_layerPerlIO_parse_layersPerlIO_default_bufferPerlIO_perlioPerlIO_arg_fetchPerlIO_layer_fetchPerlIO_default_layersPerlIO_unixPerlIO_rawPerlIO_stdioPerlIO_crlfPerlIO_utf8PerlIO_removePerlIO_bytePerlIO_default_layerPerlIO_pushPerlIO_apply_layeraPerlIOBase_filenoPerlIOPop_pushedPerlIORaw_pushedPerlIOBuf_seekPerlIOBuf_tellPerlIOPending_fillPerlIOPending_seekPerlIOBase_flush_linebufPerl_PerlIO_fillPerl_PerlIO_eofPerlIOBase_clearerrPerlIO_has_basePerlIO_fast_getsPerl_PerlIO_get_basePerlIOBuf_unreadPerlIOBase_unreadPerlIO_pendingPerl_PerlIO_unreadPerlIOStdio_unreadPerlIOBuf_writePerlIOBuf_get_ptrPerlIOBuf_get_cntPerlIOBuf_bufsizPerlIOBuf_set_ptrcntPerlIOPending_set_ptrcntPerlIOCrlf_unreadPerlIOCrlf_get_cntPerlIOCrlf_set_ptrcntPerlIOCrlf_writePerl_PerlIO_get_bufsizPerl_PerlIO_get_ptrPerl_PerlIO_set_ptrcntPerlIO_modestrPerlIOBase_pushedPerl_sv_lenPerlIOBuf_pushedisattyPerlIOCrlf_pushedPerlIOPending_pushedPerlIOBase_closePerlIO__closePerlIO_cleantablePerlIOBase_openPerlIOBuf_openPerlIOPending_closePerlIOBuf_closePerlIO_sv_dupPerlIOBase_dupPerlIOBuf_dupPerlIOUnix_refcnt_incPerlIOUnix_dupPerlIOStdio_dupPerlIOUnix_refcnt_decPerlIOUnix_closePerlIOStdio_closefclosePerlIOUnix_refcntPerlIOUnix_oflagsPerlIOUnix_pushedPerlIOUnix_openPerlIOStdio_modePerlIOStdio_pushedPerlIOStdio_openfreopen64fopen64PerlIO_importFILEPerlIO_exportFILEPerlIO_findFILEPerlIO_releaseFILEPerlIO_getnamePerlIO_rewindPerl_PerlIO_save_errnoPerlIOBase_readPerl_PerlIO_readPerlIOBuf_readPerlIOPending_readPerlIOUnix_readPerlIOUnix_writePerlIOBuf_flushPerlIOCrlf_flushPerlIOBuf_fillPerl_PerlIO_context_layersPerlIO_resolve_layersPerlIO_tmpfile_flagsPerlIO_stdstreamsPerlIO_stdoutfPerlIO_tmpfilePerlIO_reopenPerlIO_setposPerlIO_getposPerl_noperl_die__vfprintf_chkPerl_save_pptrPerl_yylexPerl_init_named_cvPerl_scan_numPerl_apply_builtin_cv_attributesPerl_sv_dec_nomgPerl_sv_inc_nomgPerl_save_hdeletePerl_save_pushptrptrPerl_save_hashPerl_save_aryPerl_clear_defarrayPerl_save_aelem_flagsPerl_save_adeletePerl_sv_setrv_noinc_mgPerl_save_padsv_and_mortalizePerl_save_gpPerl_softref2xvPerl_sv_pos_b2u_flagsPerl_block_gimmepowfmodPerl_repeatcpyPerl_sv_cmp_locale_flagsatan2cossinsqrtPerl_drand48_rPerl_rninstrPerl_fbm_instrPerl_sv_setsv_mgcryptPerl__to_utf8_lower_flagsPerl__to_utf8_title_flagsPerl__to_utf8_upper_flagsPerl__to_utf8_fold_flagsPerl__to_uni_fold_flagsPerl_sv_can_swipe_pv_bufPerl_sv_rvunweakenPerl_cxincPerl_filter_readPerl_save_I16Perl_sv_streq_flagsPerl_mortal_destructor_svPerl__is_utf8_perl_idcontmemmemPerl_reg_temp_copyPerl_sv_magicext_mglobPerl_dowantarrayPerl_was_lvalue_subPerl_caller_cxPerl_savestack_grow_cntPerl_leave_adjust_stacksPerl_get_db_subPerl_save_deletePerl_sv_pvbyten_forcePerl_rpp_free_2_setresuidsetresgidPerl_sv_grow_freshPerl_vcroakmodfPerl_unpackstringPerl_packlistPerl_sv_cmp_localePerl_sv_cmpPerl_sortsv_flagsPerl_sortsvPerl_warn_svselectPerl_sv_pvutf8n_forcerecvfromsendtosendftruncate64ioctlflockconnectbindlistenshutdowngetsockoptsetsockoptgetpeernameeaccessfchdirchrootsymlinkmkdirrmdirreaddir64telldirseekdirrewinddirsigfillsetPerl_my_forksleepgetppidgetpgidsetpgidgetprioritysetpriorityPerl_gmtime64_rPerl_sv_setpvf_mgPerl_localtime64_ralarmpausegethostent__h_errno_locationgethostbyaddrgethostbynamegetnetentgetnetbyaddrgetnetbynamegetprotoentgetprotobynumbergetprotobynamegetserventgetservbyportgetservbynamesetnetentsetserventsethostentsetprotoentendhostentendgrentendnetentendprotoentendserventsetpwentendpwentsetgrentgetspnamgetpwuidgetpwnamgetpwentgetgrentgetgrgidgetgrnamgetloginsyscallPerl_reentrant_sizePerl_reentrant_initPerl_reentrant_freePerl_reentrant_retryPerl__is_utf8_FOOPerl_vmessPerl__invlist_intersection_maybe_complement_2ndPerl_reginitcolorsPerl_pregcompPerl_regcurlyPerl__to_fold_latin1Perl__inverse_foldsPerl__invlistEQPerl_invlist_clonePerl_pregfreePerl_pregfree2match_unipropPerl__new_invlist_C_arrayPerl_do_uniprop_matchPerl_get_prop_definitionPerl_get_prop_valuesPerl_get_deprecated_property_msgdeprecated_property_msgsPerl__invlist_union_maybe_complement_2ndPerl_load_charnamesstrspnPerl_cntrl_to_mnemonicPerl_get_and_check_backslash_N_namestrcspnPerl_regdumpPerl_regpropPerl__setup_canned_invlistPerl_sv_setsv_cowPerl_isSCRIPT_RUNPerl_foldEQ_utf8_flagsPerl_pregexecPerl_reg_named_buff_existsPerl_reg_named_buff_firstkeyPerl_reg_named_buff_nextkeyPerl_reg_named_buff_scalarPerl_reg_named_buff_allPerl_reg_numbered_buff_fetch_flagsPerl_reg_named_buff_fetchPerl_new_stackinfoPerl_savestack_growPerl_save_rcpvPerl_save_generic_pvrefPerl_save_shared_pvrefPerl_save_pushi32ptrPerl_save_I8Perl_save_ivPerl_save_hptrPerl_save_aptrPerl_save_freercpvPerl_save_destructorPerl_save_svrefPerl_sv_replacePerl_cx_dumpPerl_mortal_svfunc_xfrexpPerl_sv_report_usedPerl_sv_get_backrefsPerl_sv_newrefPerl_sv_numeq_flagsPerl_sv_freePerl_sv_unmagicextPerl_sv_truePerl_sv_isaPerl_ptr_table_newPerl_ptr_table_fetchPerl_ptr_table_splitPerl_ptr_table_storePerl_ptr_table_freePerl_sv_vstring_getPerl_sv_set_truePerl_sv_set_falsePerl_sv_set_bool__sprintf_chkPerl_sv_resetPerl_sv_setrv_inc_mgPerl_sv_pos_u2bPerl_sv_pos_b2uPerl_sv_setpvn_mgPerl_sv_setref_pvnPerl_sv_cat_decodePerl_sv_setref_uvPerl_sv_setref_pvPerl_sv_setref_ivPerl_sv_setref_nvPerl_sv_catpv_mgPerl_sv_catpv_flagsPerl_sv_vcatpvfn_flagsPerl_scan_vstringPerl_sv_vcatpvfPerl_sv_catpvf_mgPerl_sv_vsetpvfPerl_sv_vsetpvf_mgPerl_sv_vcatpvfnPerl_sv_vcatpvf_mgPerl_newSVboolPerl_newSV_truePerl_newSV_falsePerl_sv_recode_to_utf8localtimePerl_lex_bufutf8Perl_lex_grow_linestrPerl_lex_stuff_pvnPerl_lex_stuff_pvPerl_lex_stuff_svPerl_lex_unstuffPerl_lex_read_toPerl_lex_discard_toPerl_str_to_versionPerl_utf16_to_utf8_basePerl_scan_wordPerl_lex_next_chunkPerl_lex_peek_unicharPerl_lex_read_unicharPerl_lex_read_spacePerl_skipspace_flagsexecvPerl_prescan_versionPerl_scan_strPerl_delimcpyldexpPerl_wrap_keyword_pluginPerl_wrap_infix_pluginPerl_parse_arithexprPerl_parse_termexprPerl_parse_listexprPerl_parse_fullexprPerl_parse_blockPerl_parse_barestmtPerl_parse_labelPerl_parse_fullstmtPerl_parse_stmtseqPerl_parse_subsignaturePerl_valid_identifier_pvePerl_valid_identifier_pvnnonchar_cp_formatsuper_cp_formatsurrogate_cp_formatPerl_uvoffuni_to_utf8_flagsPerl_is_utf8_char_helper_Perl_utf8_to_bytesPerl_bytes_from_utf8Perl_utf16_to_utf8Perl_utf16_to_utf8_reversedPerl_utf8_to_utf16_basePerl__is_uni_perl_idcontPerl__is_uni_perl_idstartPerl_to_uni_upperPerl_to_uni_titlePerl_to_uni_lowerPerl_mallocPerl_callocPerl_reallocPerl_mfreePerl_ninstrPerl_savesharedpvnPerl_mess_svPerl_vformPerl_vwarnPerl_vfatal_warnerPerl_vwarnerunsetenvPerl_atfork_lockPerl_atfork_unlockwaitpidPerl_set_contextPerl_get_op_namesPerl_get_op_descsPerl_get_ppaddrPerl_init_tmPerl_getcwd_svgetcwdPerl_vverifyPerl_my_socketpairgettimeofday__vsnprintf_chkPerl_my_vsnprintfPerl_xs_handshakeXS_DynaLoader_dl_undef_symbolsXS_DynaLoader_dl_errorXS_DynaLoader_dl_unload_filedlclosedlerrorXS_DynaLoader_dl_install_xsubXS_DynaLoader_dl_load_filedlopenXS_DynaLoader_dl_find_symboldlsymboot_DynaLoader__environlibm.so.6libcrypt.so.1libc.so.6XCRYPT_2.0GLIBC_2.29GLIBC_2.2.5GLIBC_2.14GLIBC_2.10GLIBC_2.28GLIBC_2.33GLIBC_2.3GLIBC_2.4GLIBC_2.7GLIBC_2.3.4GLIBC_2.11GLIBC_2.34GLIBC_2.9                ~r `] rtr0rui r rrrr rii rii rii rti sssii $sui r:]:P]@:po`:hEh:8Kp:pMx:@O:P::c:}:c:py:c:{ :p0:H:mX:sh:}x::::::Â:ς:ڂ:::(:8:H:'X::h:Hx:V:c:u::::::ă:˃:փ(:8:H:X:h:: :::::!:(:2:=(:F8:QH:[h:fx:l:t:{::::::::ń(:τ8:؄H:X:h:x::::!:+:7:F:K:Q:[(:d8:kH:qX:wh:}x:::::l:r:x::::(:8:H:ʅX:Յh:x::::::":(:8:A:N:U(:`8:iH:sX:}h:x:::::Ɔ:̆:ӆ:ކ:::(:8:H:X:"h:,x:7:B:J:V:_:l:x:Qv::: :(:0:8:@:H:P:X:`:h::Ň:ˇ:Ӈ:؇:݇:::::(:8:H:X:*h:2x:D:s:W:c7:K:N:U:Z:_:d:U{:k:::: :: :Qv(:W0:c78:K@:pH:UP:ZX:_`:dh:xp:kx:}::::::::::ü:Ѽ:ݼ:x?:::: : (:0:$@:3H:=P:HX:M`:Vh:dp:nx:w::::::::ɽ:׽::: ::!:1:?:K:W:a:v :3v(:?v0:Jv8:Qv@:|H:nP:X:`:vh:{p:x:::::::::::::::ľ:о:׾:߾::: :(: 0:8:@:ɾH:!P:)X:`:h: p:(x:0:6:>:=:D:K:R:Z:b:k:|::::::/0 I:<PW XYUP/ A08 <NK7`d?dV =4B 9B ;< A<5`/ p, 0 m^PIx<X1W[P~ NMК ]P ~vZe dG (-C =7Z ^a1 @^)F MK "0~<+:E L#|<`(}iQ ]!a%)< i*HO0"V;<`<FV`;a`V0A Wl8,8!0? !<` hd<@9(<#{<<  *CLZPd / `,m  yU>;S IБ 8p * `?#\ 7 .sU `<'e<L@  i+` DA0 ` ff Zf ]`' ?<gg"Y\ W`6r"~<)po Pge-L i@Tx <"H~<& ` I~+fONд KH b >`~<m eb@5G?$P{< PR#|<7 9I p<T* ^WI I >({<Nd0&&@WF)5Y s b<P .H3qddj)VR?O) jDV 0~<2W`B bW ;pYM8 Oi<}BDzX M |3<9 2sQd Y%{< ;W!<WA -NЋyRZz'7ToP8@Tq%<%H<(0;R` T`( # `4[`z hB @X\ gOp8%X  < 0C$0 !WA v 1 <P hc3<!в O* =0@O- `<CG)E`c ~[x 2(. <7++  X<<%<1SQPP Y9PЙ; h<ioT7 J'1<` \,o@LpQPg RaP K -DpN kP )iyW>o`TZ0pDd)`Ir[{ Z;1 2<$0e Y0R ,M  0= "Ѓ<>p [l`0+ <5Of> -'0; Mn*;XH;,(m1h<5I`<0 @ ras>W-pTJYZ WPH ,26Zc l XP@W 5B @8nQ 7 P 2 @ 9<]!YR  3a,P+`&!9p [?<(p9h0:!<h9@ !7p `W!PY LgWD *CX< m:H0a ,p:@JV? 9L @;U; K s&<^@<#YV xmb9P~< }@f<e`U)p| <ZG BhXK <!<DV 8<0@*Ha [| bY0X .JP #h{<w{< ' @LP5?<E0a +<<eI0y**ks0BS> xl;L"wM {<!l*\[.7` WE Z`Y,`F$@<(` p <SW D )^ @3PE *,`7_K n`*QX nni 0<8#x{<B`Ё< <snF::@#{<K U6 <r=`r"< |N0 S .qUE9*4I nfb <؂<<<  _qW./!ml0KG"< J0 h`!ZPk !<U !*`|$؈<M10<\A\P \!x<~&t1 6n>z<  !e@@ ]CWC Z7rm4@= ]S  !<jp<.$<XQ ZmAABlP29_PUp%"<v0@ hS@ [! (pq@bd$O <\p~ V9 F \: HBSpB,U 0nACQ $.#|<: A?؀<M P/QdP@p`J@<r 3Q `M  -Kyd@QA<<`U3 Qȁ<e3 tG@ %`<N%xs1C Mpn$ |<i;t X<F& .V)@`<\@w"@@<!`> /R Jin\G@< N@ x7s F\2)<<Sf@+K `2~J`Z\BV nYZ z<F PDeW(LC@  <V ; %@t / h;eRp =zAqF ,-KГ hJ$ـ<@;QPb #K4u-0MOS   :g 5 a-4; Pm0=(;W;Y0] `<2; IQb 1(<K.\ 7-Q;LИ  o;WxE E` ,PT {<,CyvS@ </]pu 3pQ ]V7 D \ 0A n7F3{< : *E'U 4 fP AkB B@:X M 4pM,S a^p lK BQA, n( ALp j!!p/.`b-[М#p{<;4HrH<:X<$p<Up* mKP ?A0<GoR2W`G Kl [BpBTr2P.QB (P<S 5P61@_m_?$$`{<XN )XJ 2YY Uj@_AOOXpK Ypa ({ K  WlH<}${<1 <nx;" ~<aO N0]t<t8 M_`x>;i+'fPlJ@ \0NW8<#|< -1$<  Q0,"N|T( X;M 7_20' 16p L8p Ah:*S!<tn-+ MЎZ/pV= 08:'/ yjv?<l[_$8{<;0.m0!@H<70*k@<7 zL` Qpy 6 8U6 Qs f0;- 3D`O z<=I f7[s ZP&h`^0$QD>@<8~rrVA fPXi C\ X&PA@4<B9 J@ 0`(<8  qF kH{<(/` %(<i!*<H<ZC+_<)(-0O]0Cwc @ I,@<HPP<:&<KP (g[0v !Hq :yHc PA&s l]FWk?;K T;:@:L CB  /l1Jg0"y?<A ;(i(pH` g@a@ <VXDP\ <m[4P36t XJ #4<>z<=J`   <Zl hC"8~<@C wyJ G8 ~@0<b +<hC+A`m`} /<!^0q8<H@<P0T  : F@ T' ?<SP /YH`b FMT K :07} oPPpK_;9:<@<B<P.[q !,<<t!.<``nK !)@!-<)0bj#P0Fn}<G` 7p} x8:`pT D;&<soڀ<I+yI e` `z9 !DF Y.`GP:&E 2_T WP$<P ']1,<[`p  [' TD[9P s7pu8<In <h7 І .J >F< O 6z<YC@ j U,&g0'k UT<FV;%u:X J` '-\ B p$ AȈ<6 M}9PD M>] WW8` ,0 ,@ qQ^nU* Hqq0U;i'`A a0<a]8Of A&,NA@ ;p9&  p2qn !0j$h<P;%<W7] Т `B+`/z rI X<Y\  RLp 39U6 92 k <m;{<?A ;8XJ = o0<sYX TD;p'<nЀ<^ jF`V;mЈ<w~<)h`:WG WB <Z<_=@4aZrO-_!gP!"ZPb zR` + m}'0 , M an@i8<-`@8<` <eQd e Cn.pT!.J[`s 7B!~ p]J 5)))p[ DV   $C#|<^ ]3 `,kG@^ G?P<|;Ȁ<cL <G@`<8p| m!l?<v]>I`;}<``TeDn75> Tn+*tu\ +N` S p { <f%pA%-a <i8<aBP`;hT@) \ {*0fuP< j-!m`}kp )KU(7/:WNI Ab@H<QDP ?@<:8 ;!Ȃ<Rp KvpMnP7O nn ! R NBT-WP<@d0t(<. <&:{MEP X0R PR HQX n2 Y6 &i )0 (Jp wkS(PN _p G+6z<gk@@v50I h<f_`{|~  lO-]]7j1>0{<@<&Zc ]Zd ,=;c`qf.n#~<'p 9a<WG QPm E?<- <#F <C8 __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizePL_compcvPL_cv_has_evalPL_comppad_namePL_cop_seqmaxmemsetPL_memory_wrapPerl_croakPL_curpmPerl_mg_findPerl_safesysfreePL_sv_immortalsPL_top_env__sigsetjmpPL_delaymagicPL_runops__stack_chk_failPL_markstack_ptrPL_stack_spPL_stack_basePL_stack_maxPerl_stack_growPerl_cop_fetch_labelPerl_newSVpvn_flagsPerl_save_pushptrPerl_hv_commonPerl_sv_incPL_opPL_curstackinfomemcpyPerl_newSVivPerl_sv_2mortalPerl_cvgv_from_hekPL_hash_state_wPerl_sv_2iv_flagsPL_sv_rootPL_sv_countPL_body_rootsPerl_more_svPerl_sv_backoffPerl_more_bodiesPerl_optimize_optreePL_peeppPerl_finalize_optreePerl_pad_tidyPL_in_evalPL_eval_startPL_main_startPerl_sv_decPL_curcopPerl_newSVpvPL_op_namePerl_newSVpvnPerl_sv_free2Perl_gv_try_downgradePerl_Slab_AllocPerl_Slab_FreePL_comppadPerl_push_scopePL_curpadPerl_pop_scopePerl_messPerl_qerrorstrcmpPL_parserPL_charclassPerl_pad_add_name_pvnPL_curstashPL_defstashmemchrPerl_formPerl_force_out_malformed_utf8_message_Perl__is_utf8_perl_idstartPerl_op_refcnt_lockPerl_op_refcnt_unlockPerl_op_parentPL_ppaddrPerl_op_linklistPerl_sv_chopPerl_warnerPerl_sv_newmortalPerl_pv_prettyPerl_padnamelist_fetchPerl_hv_common_key_lenPerl_sv_2pv_flagsPerl_newSVpvn_sharePerl_blockhook_registerPL_blockhooksPerl_av_create_and_pushPerl_forbid_outofblock_opsPerl_save_vptrPerl_PerlIO_stderrPerlIO_printfPerl_newARGDEFELEMOPPerl_cv_ckproto_len_flagsPerl_ckwarn_dPerl_bytes_cmp_utf8Perl_sv_setpvnPerl_sv_catpvfPerl_sv_catpvn_flagsmemcmpPerl_newSVhek_mortalPerl_gv_efullname4Perl_sv_catsv_flagsPerl_cv_const_svPerl_cvgv_setPerl_cvstash_setPerl_gv_fetchsvPL_sub_generationPerl_mro_method_changed_inPerl_pad_add_anonPL_compilingPerl_ck_warnerPerl_rv2cv_op_cvPerl_cv_get_call_checker_flagsPerl_ck_entersub_args_proto_or_listPerl_cv_get_call_checkerPerl_cv_set_call_checker_flagsPerl_sv_magicPerl_mg_free_typePerl_cv_set_call_checkerPerl_custom_op_registerPL_custom_opsPerl_custom_op_get_fieldPL_custom_op_namesPerl_safesyscallocPerl_safesysmallocPL_custom_op_descsPerl_sv_magicextPL_op_descPerl_op_sibling_splicePL_opargsPL_NoPL_YesPerl_cv_namePerl_ckwarnPerl_sv_cmp_flagsPerl_wrap_op_checkerPL_checkPerl_rcpv_newPerl_rcpv_freePerl_op_freePL_opfreehookPerl_op_clearPL_WARN_ALLPL_WARN_NONEPerl_refcounted_he_freePL_phasePerl_av_fetchPerl_gv_add_by_typePerl_op_nullPerl_sv_2nv_flagsPerl_newSVpvfPerl_dorefPerl_ck_warner_dPerl_op_lvalue_flagsPL_modcountPerl_newOPPL_op_maskPerl_pad_allocPerl_newNULLLISTPerl_newLISTOPPerl_op_append_elemPerl_op_prepend_elemPerl_op_append_listPerl_op_scopePL_perldbPL_taintingPerl_op_force_listPerl_newUNOP_AUXPerl_newMETHOPPerl_newPMOPPerl_is_in_locale_category_Perl_refcounted_he_fetch_pvnPerl_newSVOPPerl_newGVOPPL_warnhookPL_diehookPL_dowarnPL_sv_placeholderPL_errgvPL_markstack_maxPerl_sv_setpv_bufsizePerl_mg_freePerl_markstack_growPerl_op_contextualizePerl_ck_entersub_args_listPL_debstashPerl_op_convert_listPerl_newLISTOPnPerl_newANONLISTPerl_newANONHASHPerl_newUNOPPerl_newPROGPL_eval_rootPL_main_rootPerl_get_cvn_flagsPerl_call_svPL_savestack_ixPerl_newRANGEPerl_sv_upgradePerl_newDEFEROPPerl_op_wrap_finallyPerl_newAVREFPerl_newGVREFPerl_newHVREFPerl_newCVREFPerl_newSVREFPerl_gv_fetchpvn_flagsPerl_newDEFSVOPPL_defgvPerl_gv_overridePerl_ck_entersub_args_protoPerl_newBINOPPerl_newSLICEOPPerl_newPVOPPerl_save_generic_svrefPL_curstnamePerl_save_itemPerl_gv_stashsvPerl_sv_setsv_flagsPerl_sv_2bool_flagsPerl_mg_getPerl_newLOGOPPerl_newCONDOPPerl_newSVuvPerl_newASSIGNOPPerl_sv_setivPerl_newTRYCATCHOPPerl_newLOOPOPPerl_newWHILEOPPerl_newFOROPPerl_newLOOPEXPerl_savesharedpvPerl_validate_protoPerl_sv_mortalcopy_flagsPerl_newFORMPerl_leave_scopePL_prevailing_versionPL_hintgvPerl_hv_copy_hints_hvPL_stdingvPL_taintedPerl_fbm_compilePerl_sv_copypv_flagsPL_argvgvPerl_gv_init_svmemmovePerl_share_hekPerl_sv_sethekPerl_unshare_hekPerl_diePerl_sv_force_normal_flags__memcpy_chkPerl_pad_findmy_pvnPerl_newSVhekPerl_newWHENOPPerl_newGIVENOPPerl_newMETHOP_namedPerl_sv_insert_flagsstrncmpPerl_rcpv_copyPerl_dup_warningsPerl_block_startPerl_save_hintsPerl_save_I32Perl_mg_sizePerl_newSTATEOPPerl_intro_myPerl_refcounted_he_incPerl_cop_store_labelPerl_block_endstrrchrPerl_warnPL_scopestack_ixPerl_get_svPL_eval_begin_nest_depthPerl_save_intPL_curstackPerl_save_sptrPL_beginavPerl_call_listPL_savebeginPL_checkavPerl_av_create_and_unshift_onePL_endavPL_initavPL_unitcheckavPerl_new_stackinfo_flagsPerl_croak_popstackPerl_sv_setpvPL_xsubfilenamePerl_cv_undefPerl_newXSPerl_newXS_flagsPerl_newXS_deffilePerl_newCONSTSUB_flagsPerl_newATTRSUB_xmemrchrPL_breakable_sub_genPL_sublinePL_DBsubPerl_class_wrap_method_bodyPerl_gv_init_pvnPerl_sv_setpvfPerl_current_re_enginePerl__new_invlistPerl__add_range_to_invlistPerl_sv_growPerl__invlist_searchPerl_av_pushPerl_newSVnvPerl_safesysreallocPL_utf8skipPerl__invlist_invertPerl_uvoffuni_to_utf8_flags_msgsPerl_re_op_compilePerl_newSVsv_flagsPerl_new_versionPerl_sv_setnvPerl_upg_versionPerl_vcmpPerl_sv_derived_fromPerl_vload_modulePerl_lex_startPerl_start_subparsePerl_load_modulePerl_apply_attrs_stringPerl_newRVPL_globhookPL_incgvPerl_newMYSUBPerl_cv_clonePerl_newANONATTRSUBPerl_newANONSUBPerl_newCONSTSUBPerl_save_destructor_xPerl_nothreadhookgetuidgeteuidgetgidgetegidPL_preambleavPL_e_scriptPerl_filter_delPL_bincompat_optionsPL_mainstackPerl_dounwindPerl_rpp_obliterate_stack_to__longjmp_chkPL_statusvaluePerl_sys_initPL_sigfpe_savedPerl_sys_init3Perl_sys_termPL_veto_cleanupPL_shutdownhookPerlIO_teardownperl_allocPL_curinterpPerl_noshutdownhookperl_freePerl_call_atexitPL_exitlistlenPL_exitlistPerl_gv_fetchpvPerl_av_unshiftPerl_av_storePerl_get_avPerl_get_hvPerl_get_cvPL_DBcvPL_tmps_floorPL_tmps_ixPerl_free_tmpsPerl_savetmpsPL_statusvalue_posixPL_restartopPL_restartjmpenvPerl_call_pvPerl_call_argvPerl_call_methodPerl_eval_svPerl_taint_properPerl_croak_svPerl_eval_pvPerl_require_pvgetpidkillPerl_doing_taintPL_dbargsPerl_av_clearPL_DBgvPL_DBlinePL_DBsinglePL_magic_vtablesPL_DBtracePL_DBsignalPerl_mg_setPerl_init_stacksPL_tmps_stackPL_tmps_maxPL_markstackPL_scopestackPL_scopestack_maxPL_savestackPL_savestack_maxperl_constructPL_perl_destruct_levelPL_errorsPL_clocktickPL_sighandlerpPL_sighandler1pPL_sighandler3pPL_rsPerl_seedPL_internal_random_statePerl_drand48_init_rPL_start_envPL_TR_SPECIAL_HANDLING_UTF8PL_localpatchesPerlIO_initPL_fdpidPL_modglobalPL_debug_padPL_hash_seed_setPL_strtabPL_sv_constsPL_origenvironsysconfPL_stashcachePL_mmap_page_sizePL_patchlevel__errno_locationPL_osnamePL_registered_mrosPerl_init_i18nl10nPL_hash_rand_bits_enabledPL_hash_rand_bitsPL_utf8cachePL_reg_curpmPL_regmatch_slabPL_statnamePL_chopsetPL_dumpindentPL_in_utf8_CTYPE_localePL_in_utf8_turkic_localePL_rpeeppPL_watchaddrPL_hook__require__beforePL_hook__require__afterPL_splitstrPL_maxsysfdPL_sig_pendingPL_curcopdbPL_gensymPL_laststypePL_laststatvalPerl_runops_standardPL_profiledataPL_generationPL_in_clean_objsPL_in_clean_allPL_anPL_evalseqPL_padlist_generationPL_collxfrm_multPL_collation_ixPL_strxfrm_NUL_replacementPL_strxfrm_is_behavedPL_strxfrm_max_cpPL_srand_calledPL_collation_standardPL_srand_overridePL_langinfo_svPL_srand_override_nextPL_scratch_langinfoPL_numeric_underlyingPL_setlocale_bufPL_numeric_underlying_is_standardPL_setlocale_bufsizePL_numeric_standardPL_ctype_namePL_in_load_modulePL_beginav_savePL_sharehookPL_perlioPL_known_layersPL_def_layerlistPL_checkav_savePL_unitcheckav_savePerl_sv_nosharingPL_lockhookPL_unlockhookPerl_sv_nounlockingPL_threadhookPL_destroyhookPerl_sv_destroyablePL_signalhookPerl_despatch_signalsPL_isarevPL_scopestack_namePL_dump_re_max_lenPL_InBitmapPL_in_diehookPL_in_warnhookPL_hash_seed_wPerl_hv_ksplitgetenvPerl_grok_numberstrerrorPL_doswitchesPL_unicodePL_utf8localePerl_sv_utf8_decodePL_inplacestrchrPL_toptargetPL_bodytargetPL_formtargetELF>@4?@8 @m m :::G`;;; $$Std Ptd]8]8]8GGQtdRtd:::  GNUGNU!jݶstj$q#` BZ  4 )B @@ @!r0H (@20 IP䁠(t % "( * @@  A&!B$0@P`80""a0 P0$ؐPB a 0#!@<@F `a  PA% .  ( Q@0 @a &00BB +"@P h@ H@ 02 P B@ @`Jh#PA8HC0D@@P!@! #B|`BE4P!P  + 1@TDFhQ &4E0D @b@X@@h @@ J@Pb"@""  D(6@ D0!a@PB  D$A(P X "P  - ) 0HH A "daHB0D@!s(8R"89@@(@@#tbH ' I($"$  8($d  0 B`U$ @U !$ #@G^P 0H$  "$bh` 0! `DA Ӣ@0$  A @ PH ! H @ !0 $ "@@)HIdBR@@" @ T@$@4@$ 1(hB G0 ` ("AT   E"@` b $!  4hAD"!8@!Ԡ$ $T 4\ PQ ( DFA@ @Q@p$ !0 "@ "@ HL#4(  A@ 0 `@ P3  H 1@@H @ U8p DH@!W eH $b TAd A%#@`   L F'p 8 $@hTHP!D@`HdB87$(J @ @P8@$0$2  @Pp  9 @(AE!@ - ,A)D a+P  @AL@@8 2 6   A@(Q h T    !$%(*,.025:<>ACDEGHJKMNPQSTUWXYZ\^_abdfiklnprstwyz|    !#%')-.1245679;<=?ACDGILMORUVX[^_`abcefgiklnpqtuwy{    !#'()*,-./1248:;=>@BCEFIJKLMOQRUVWX[^acegjlnorstuvwxz|~    !#%*+-.12346789;<=>@ACDFHJLNOQRSUXY[^bfijklopstvwy{}~     #$'*+.02357:;=>?ADGJMORTUWYZ[\]^_bfgijlopqsvy{|~  !$%)*+-.049:<>?@BCGIJKLORSUXZ^bceghlopqrsuvyz|}    !#%&(Q蛠bloM5Wd͙῀!e;3%ia<=e͜&[iuzT?_3N{.a<-ۦo7^]x!7T0Z<mh.F~R5;o8 ͤvTqvTk:\+(G#_e΀^lĒ8hI\nJd`#j_w-o?k7gap;?j/n7)z76Y8:|]D)u vExy[,sga]#_V&ǹPoF 96a) Q޶zR+^M,ɛ[m2-P-s1m3~Eיִ飉l^.4>15x-E%%y(d9őG3Qn Vn' u%TN4-]~E ے̼aY^[&eϿ@jXHĝ^FΡL86]]u,3D*(bh*E<b7Q蓞B5RtATYҙZ,ko^Oh FBV&q\9,VQc )Vc~OnqT$}1r]nY$E|Zg(9G-YVTh?C'T ğVYŰҥ$j/`Io\HZ#_'Z瓭A16\W g]}:ݭ$3 fB}qЛ/N٩Ilt"z+(PnΎhnDNgo*-hLc2 "(QqtQ(d]_B%'+k(,еv"_ s5W\dt Qc.¢0SZ *;RE.dS A]jHWrA(G 0m&.4w>yw}jX\<=}L-2^L}Akj btzΎl'q)5#IaF,?jP? WY~pȳn;eJyN + N L~,eOJ;6P$rYnWH uTW=HNOr- *kQIWx D1I@ER~z] ԛC bFN, ;=~)d7Ivt]2iީE}vkX~Ӟզ֗МGLOG5QFKr;Jb'20Oߗga ޻J=z 2_b<ȇ'gꖷ`tz*J_ ȞH3 8ha7Qq|l}tT~mk$DxT:v@r3b);w,ix31((k oJJUk[?biM?BDӠӲ qYU Zt5Ň55\![5kOE״KRUM4̉N1= 9F]Sw *>2GPֶ(q*ԛ])DFI6x9-c%:\f+QftH“ȇղ1q֎~'V 4!| ,4;{0>1ԇm̄.zF?& >2!nY❡V Sg@h1{o;?ݙuRr9\AdVC u+ΗL7z&GUIp>dӻT1ʵ);|udlBuu<=O5ѼkOy,as6F pݙmc +C:sK [jPCȊh 働HDAsf/tN(9AS2Fʕ7օ ORGWCɒG Ǒ&Gs ;y9>.ޅ Onѹ)ԣa Ohzߨ9f 9l "Hx#WYn'R|P=ڜ@_ԣto8haMht^Eۜ& k5V0@B4(h|+A).XsJhFAtv23F4ZAdO=nivY<7a..[FG1_"~Ӑtpb $EyzEWTd ppUsx4': csrX;@5 [~Y\ha_5/jRy1@vX r7QUL=p>o !;9錜gFn >T6i`l2V-}ˎ1M ;2LQL_0<\Ύ Z)RrmHTwb{j 'N;d,SƮu ddMjOR߆MLh}òV[>i086Wqt] Z/@|`$ ?y4Y=fk=`2}а̥ L\(ĉk x}p!hO7nd65ek}~HvTI"hY_7K봶UNQ0U@xÙ)F~ uB "_=yC],>Ok`aL˙)YMy\ᾁHlYdž+I j={ kSI翟aдr`VZRۂ",l7*ӥ Q簍gT'QUB}ZEl[1s('ɍיf }$jJJ(98l.5z'åJɬxHoY/ɰ9+JLrP(,'4w{uEHYn',3@Pk/Ӷwz="F6y ;Ԓk6)Jr<-_DT6XlVN2 F_e}zz )?P"]s߇{yv}L-6۳W#lZ&:dWQI ,CG)zt}_oq&WUI٘L'ҩ^7#*R/xZzc_F۠h/+6(@KiN:FƿRHɢ}ڲ,(6IhUe Gq.S#*_FۮDcD; "BDUy7E>I0;#ɮsKQ(c;o( ab*w7Zj*Jao5?VHnژ  rB cħޟ[ߺ!9zct wJFβUV 00LV%>]'c>o4m Oܗ"ac)X,HIp̒$95]4L[{{6MtKnMKCqz^Rw}_?,YtVMu?|?߫ʟ}}N.BD-9A^ vHӌ_e24ϽTk;{!)+shP5S՛Y1^LB[ޱ,}_ϽG|+'BۼKJIR!S #x`>;vG'y<;{*u +('ZM/~Z` #S vp[M/S9)zIv+&'%r!Wx|$2]UJ:]lK_:M&TGv7}!`r^CuEH^$AIL2 jPF:g6buvJ_ZRGvyWGq& YW 97aopvĿ{qcOnq"BvDe(XQ WwT3ٞhazJkGEs]݌vo72 dud%(Tctyʖ#F 6³D71鄾׮II 'P`wSZx,)?A.-6-  n.燥3,q96 ԣ Z\y3}v(!4Fjv2CWM+GWYIƍ.ؤP}1&)YOQ9Sn9 1\mX`Ei+*EXh{aTP(*,i+@9( UI)bPnӣKqBzU[; #T]A1՜BD ՌGHs(s'STz`.GލqMQ͹ Lڗ|ABNzw gNzCuFtQh % b2 n&DG\vb "Cg&0]q2EO` g_4___pTh- FpW/EZMG/c!3 b2Oa&i1cy^ciYmc#HbqSG4daac!*lra5%bm=dGm4Y5b v5Hka4a'OSqG0b4[ p"dBbYxbaN"c03`b'EP^65OapbN1`q3Zjr5d cL^M&I'5^v R, aS&3bH\Lc1aHF"o5h5.R&S&HPFdc2Zb(bb5aUZ&M/PT2&OaZ50ra.13aIccc 3hb`E1gf p&2yS8b ab1[c@2O5c,qad+dO/Hb4c3;cc_cHfcCp/5SoZa}554c9bp=5>3Hjf1aUbO``b'3kr!ZTr)3aaFT!p Ha5ly4SpHc92H^^3O3cn1d^73P!bb%5SqtcJ Q< <@ <T,_aip-kU<@:LP oP$5 _dAA9 UY <Z@<46`R4> {<6n;L=v. veqPtm Z k -'[r h<AA<O<HL@  RP <p<B-p;?. Xmh@OBB+2cD(zhHb 2u G<jPCVj5kV02U0+ @L$@{<:0 -K(2л"E BFUp+ :C0 +LP T<;N ;P.,% p$oDPP ;,0I ^;'@(<Qu 18 0mfAb#|<5H<V P<p| <0;=jN ``"@~<?<P2qP t:1<t6[ ` 3F U8<к'MF` C ?6P% 9`:p  Y+ S3y \% }e0 M@ ;#4E *( ( =;%d/ !p<Dm`hgo0P% "4T R.hU`* <{* %j`8@!؃< T -2<_ XL O(<&% N".V!\PE I d0>ZF@ Hm<kU0 2* EDp}%<_cjTOpL-V<d;A`!Za KOP e:&v-V~,`*CA *n  U3 D1 T' }RrxkaE ;4p@b@2p_f-`URp $<7^j~zhPBwDR (a0`<  Y^ d5/0SP $ iD(<V@ a/@|y(Pb0<P?G $T D:V@;K09 f="(~<N  etf@ <5_j[{ i{Ѓ = 0P<Y f<OJp j z<l01x?oLF (7 a: : 6\ 2<MYX ,^``lp> *P g&p<=PPW X`pF6` ?`<(>z<;YPW K =ZUug)<k RV ;5 @SpC`!O]PE.d E K "L yuBL= $G-@X@pI qr?Sp iQ/?<؁<1S Ї .(n* <| <\` `y8i C  <u3<^:;`!::P(<< 6o Hlp,F6PX MhY4pG<CI \z<8:p/;qH<B #hD"  NV;Fx<`tA4 XP7"< guD5p,4> ]k1@q A`p%C9 #G q(<iB~]='Ch/g! ;P WQ@c *fEV;-0|\;H! f jT,<)NKJ 2pC Zpp&: &/` WE N<=;h@DI dM0 gp Xh?O!Cp T-;Uk@K$Ђ<q::0 &< R;v#|<k<\< P7 ` <CN Afгj `DWlEc5*B`!C pMR , n6<= ;KZW<>kP~FU{< r ;Aqf=3tL yU1 <K:%@<? <^M9@ z qpMp| <@:uO L j\ 1/0::p X<.@pJ9=>09#' `Mi|r m"~<g#Zh K )q@(< nex<bp<@@#|<s;#Sp ["<hP9p; . : .dq l<:xv/PDz< 3f<9 W: 89`:e(V@ u~oTZL 4T`# ~0 Wp`k(P 'ueЂp  j90 oh<T ' jC%)P J;[z X5 > @ <=8<})&#)!ȃ<* 3E 2"0<n0<y\ $8<4P/' o>}<E<UX@O f"LA>z<2<hFOHe t_Y3F ]9 %$X{< <>h~<x>;lVP9 &F- TJoR2%: ;E U-V;Zh q3E 4@<X< PJ$@9 B "J >#|<8< 3Qy %f<]pH&E : VU&-Q0b name; $PAR::Heavy::FullCache{$filename} = $fullname; } else { $ModuleCache{$fullname} = { buf => $buf, crc => $crc, name => $fullname, }; $require_list{$fullname}++; } read _FH, $buf, 4; } local @INC = (sub { my ($self, $module) = @_; return if ref $module or !$module; my $info = $ModuleCache{$module}; return unless $info; delete $require_list{$module}; $INC{$module} = "/loader/$info/$module"; if ($ENV{PAR_CLEAN} and defined(&IO::File::new)) { my $fh = IO::File->new_tmpfile or die "Can't create temp file: $!"; $fh->binmode(); $fh->print($info->{buf}); $fh->seek(0, 0); return $fh; } else { my $filename = _save_as("$info->{crc}.pm", $info->{buf}); $info->{file} = $filename; open my $fh, '<:raw', $filename or die qq[Can't read "$filename": $!]; return $fh; } die "Bootstrapping failed: can't find module $module!"; }, @INC); require XSLoader; require PAR::Heavy; require Carp::Heavy; require Exporter::Heavy; PAR::Heavy::_init_dynaloader(); require IO::File; while (my $filename = (sort keys %require_list)[0]) { unless ($INC{$filename} or $filename =~ /BSDPAN/) { if ($filename =~ /\.pmc?$/i) { require $filename; } else { do $filename unless $filename =~ /sitecustomize\.pl$/; } } delete $require_list{$filename}; } if ($buf ne $PKZIP_MAGIC) { outs(qq[No zip found after FILE section in file "$progname"]); last MAGIC ; } $start_pos = (tell _FH) - 4; # start of zip } my @par_args; my ($out, $bundle, $logfh, $cache_name); delete $ENV{PAR_APP_REUSE}; # sanitize (REUSE may be a security problem) if (!$start_pos or ($ARGV[0] eq '--par-options' && shift)) { my %dist_cmd = qw( p blib_to_par i install_par u uninstall_par s sign_par v verify_par ); if (@ARGV and $ARGV[0] eq '--reuse') { shift @ARGV; $ENV{PAR_APP_REUSE} = shift @ARGV; } else { # normal parl behaviour my @add_to_inc; while (@ARGV) { $ARGV[0] =~ /^-([AIMOBLbqpiusTv])(.*)/ or last; if ($1 eq 'I') { push @add_to_inc, $2; } elsif ($1 eq 'M') { eval "use $2"; } elsif ($1 eq 'A') { unshift @par_args, $2; } elsif ($1 eq 'O') { $out = $2; } elsif ($1 eq 'b') { $bundle = 'site'; } elsif ($1 eq 'B') { $bundle = 'all'; } elsif ($1 eq 'q') { $quiet = 1; } elsif ($1 eq 'L') { open $logfh, ">>", $2 or die qq[Can't open log file "$2": $!]; } elsif ($1 eq 'T') { $cache_name = $2; } shift(@ARGV); if (my $cmd = $dist_cmd{$1}) { delete $ENV{'PAR_TEMP'}; init_inc(); require PAR::Dist; &{"PAR::Dist::$cmd"}() unless @ARGV; &{"PAR::Dist::$cmd"}($_) for @ARGV; exit; } } unshift @INC, @add_to_inc; } } if ($out) { { require IO::File; require Archive::Zip; require Digest::SHA; } my $par = shift(@ARGV); my $zip; if (defined $par) { open my $fh, '<:raw', $par or die qq[Can't find par file "$par": $!]; bless($fh, 'IO::File'); $zip = Archive::Zip->new; ( $zip->readFromFileHandle($fh, $par) == Archive::Zip::AZ_OK() ) or die qq[Error reading zip archive "$par"]; } my %meta_par = do { if ($zip and my $meta = $zip->contents('META.yml')) { $meta =~ s/.*^par:$//ms; $meta =~ s/^\S.*//ms; $meta =~ /^ ([^:]+): (.+)$/mg; } }; if (defined $par) { open my $ph, '<:raw', $par or die qq[Can't read par file "$par": $!]; my $buf; read $ph, $buf, 4; die qq["$par" is not a par file] unless $buf eq $PKZIP_MAGIC; close $ph; } CreatePath($out) ; my $fh = IO::File->new( $out, IO::File::O_CREAT() | IO::File::O_RDWR() | IO::File::O_TRUNC(), 0777, ) or die qq[Can't create file "$out": $!]; $fh->binmode(); seek _FH, 0, 0; my $loader; if (defined $start_of_FILE_section) { read _FH, $loader, $start_of_FILE_section; } else { local $/ = undef; $loader = <_FH>; } if (!$ENV{PAR_VERBATIM} and $loader =~ /^(?:#!|\@rem)/) { require PAR::Filter::PodStrip; PAR::Filter::PodStrip->apply(\$loader, $0); } $fh->print($loader) or die qq[Error writing loader to "$out": $!]; if ($bundle) { require PAR::Heavy; PAR::Heavy::_init_dynaloader(); init_inc(); require_modules(); my @inc = grep { !/BSDPAN/ } grep { ($bundle ne 'site') or ($_ ne $Config::Config{archlibexp} and $_ ne $Config::Config{privlibexp}); } @INC; s|/+|/|g, s|/$|| foreach @inc; my %files; $files{$_}++ for @DynaLoader::dl_shared_objects, values %INC; my $lib_ext = $Config::Config{lib_ext}; # XXX lib_ext vs dlext ? my %written; foreach my $key (sort keys %files) { my ($file, $name); if (defined(my $fc = $PAR::Heavy::FullCache{$key})) { ($file, $name) = ($key, $fc); } else { foreach my $dir (@inc) { if ($key =~ m|^\Q$dir\E/(.*)$|i) { ($file, $name) = ($key, $1); last; } if ($key =~ m|^/loader/[^/]+/(.*)$|) { if (my $ref = $ModuleCache{$1}) { ($file, $name) = ($ref, $1); last; } if (-f "$dir/$1") { ($file, $name) = ("$dir/$1", $1); last; } } } } next unless defined $name; next if $written{$name}++; next if !ref($file) and $file =~ /\.\Q$lib_ext\E$/i; outs(sprintf(qq[Packing FILE "%s"...], ref $file ? $file->{name} : $file)); my $content; if (ref($file)) { $content = $file->{buf}; } else { local $/ = undef; open my $th, '<:raw', $file or die qq[Can't read "$file": $!]; $content = <$th>; close $th; PAR::Filter::PodStrip->apply(\$content, "/$name") if !$ENV{PAR_VERBATIM} and $name =~ /\.(?:pm|ix|al)$/i; PAR::Filter::PatchContent->new->apply(\$content, $file, $name); } $fh->print("FILE", pack('N', length($name) + 9), sprintf("%08x/%s", Archive::Zip::computeCRC32($content), $name), pack('N', length($content)), $content) or die qq[Error writing embedded FILE to "$out": $!]; outs(qq[Written as "$name"]); } } if ($zip) { $zip->writeToFileHandle($fh) == Archive::Zip::AZ_OK or die qq[Error writing zip part of "$out"]; } if ($meta_par{clean}) { $fh->print("\0CLEAN"); } else { if (!defined $cache_name) { my $ctx = Digest::SHA->new(1); seek $fh, 0, 0; $ctx->addfile($fh); seek $fh, 0, 2; $cache_name = $ctx->hexdigest; } $cache_name = substr $cache_name, 0, $cache_name_size; $cache_name .= "\0" x ($cache_name_size - length $cache_name); $fh->print($cache_name, "\0CACHE"); } my $offset = $fh->tell - length($loader); $fh->print(pack('N', $offset), $PAR_MAGIC); $fh->close or die qq[Error writing trailer of "$out": $!]; chmod 0755, $out; exit; } { last unless defined $start_pos; _fix_progname(); require PAR; PAR::Heavy::_init_dynaloader(); { require File::Find; require Archive::Zip; } my $fh = IO::File->new; # Archive::Zip operates on an IO::Handle $fh->fdopen(fileno(_FH), 'r') or die qq[fdopen() failed: $!]; Archive::Zip::setChunkSize(-s _FH); my $zip = Archive::Zip->new; ($zip->readFromFileHandle($fh, $progname) == Archive::Zip::AZ_OK()) or die qq[Error reading zip archive "$progname"]; Archive::Zip::setChunkSize(64 * 1024); push @PAR::LibCache, $zip; $PAR::LibCache{$progname} = $zip; outs("Extracting zip..."); if (defined $ENV{PAR_TEMP}) { # should be set at this point! foreach my $member ( $zip->members ) { next if $member->isDirectory; my $member_name = $member->fileName; next unless $member_name =~ m{ ^ /?shlib/ (?:$Config::Config{archname}/)? ([^/]+) $ }x; my $extract_name = $1; my $dest_name = File::Spec->catfile($ENV{PAR_TEMP}, $extract_name); if (-f $dest_name && -s _ == $member->uncompressedSize()) { outs(qq[Skipping "$member_name" since it already exists at "$dest_name"]); } else { outs(qq[Extracting "$member_name" to "$dest_name"...]); ($member->extractToFileNamed($dest_name) == Archive::Zip::AZ_OK()) or die qq[Error extracting zip member to "$dest_name"]; chmod(0555, $dest_name) if $^O eq "hpux"; } } } } unless ($PAR::LibCache{$progname}) { die << "." unless @ARGV; Usage: $0 [ -Alib.par ] [ -Idir ] [ -Mmodule ] [ src.par ] [ program.pl ] $0 [ -B|-b ] [-Ooutfile] src.par . $ENV{PAR_PROGNAME} = $progname = $0 = shift(@ARGV); } sub CreatePath { my ($name) = @_; require File::Basename; my ($basename, $path, $ext) = File::Basename::fileparse($name, ('\..*')); require File::Path; File::Path::mkpath($path) unless(-e $path); # mkpath dies with error } sub require_modules { require lib; require DynaLoader; require integer; require strict; require warnings; require vars; require Carp; require Carp::Heavy; require Errno; require Exporter::Heavy; require Exporter; require Fcntl; require File::Temp; require File::Spec; require XSLoader; require Config; require IO::Handle; require IO::File; require Compress::Zlib; require Archive::Zip; require Digest::SHA; require PAR; require PAR::Heavy; require PAR::Dist; require PAR::Filter::PodStrip; require PAR::Filter::PatchContent; require attributes; eval { require Cwd }; eval { require Win32 }; eval { require Scalar::Util }; eval { require Archive::Unzip::Burst }; eval { require Tie::Hash::NamedCapture }; eval { require PerlIO; require PerlIO::scalar }; eval { require utf8 }; } sub _set_par_temp { if (defined $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/) { $par_temp = $1; return; } foreach my $path ( (map $ENV{$_}, qw( PAR_TMPDIR TMPDIR TEMPDIR TEMP TMP )), qw( C:\\TEMP /tmp . ) ) { next unless defined $path and -d $path and -w $path; my $username; my $pwuid; eval {($pwuid) = getpwuid($>) if defined $>;}; if ( defined(&Win32::LoginName) ) { $username = &Win32::LoginName; } elsif (defined $pwuid) { $username = $pwuid; } else { $username = $ENV{USERNAME} || $ENV{USER} || 'SYSTEM'; } my $stmpdir = "$path$sys{_delim}par-".unpack("H*", $username); mkdir $stmpdir, 0755; my $cache_dir; if ($ENV{PAR_CLEAN}) { $cache_dir = "temp-$$"; } else { open my $fh, "<:raw", $progname or die qq[Can't read "$progname": $!]; if ((my $magic_pos = find_par_magic($fh)) >= 0) { seek $fh, $magic_pos - $FILE_offset_size - length("\0CACHE"), 0; my $buf; read $fh, $buf, length("\0CACHE"); if ($buf eq "\0CACHE") { seek $fh, $magic_pos - $FILE_offset_size - length("\0CACHE") - $cache_name_size, 0; read $fh, $buf, $cache_name_size; $buf =~ s/\0//g; $cache_dir = "cache-$buf"; } } close $fh; } if (!$cache_dir) { $cache_dir = "temp-$$"; $ENV{PAR_CLEAN} = 1; } $stmpdir .= "$sys{_delim}$cache_dir"; mkdir $stmpdir, 0755; $ENV{PAR_TEMP} = $stmpdir; last; } $par_temp = $1 if $ENV{PAR_TEMP} and $ENV{PAR_TEMP} =~ /(.+)/; } sub _save_as { my ($name, $contents, $mode) = @_; my $fullname = "$par_temp/$name"; unless (-e $fullname) { my $tempname = "$fullname.$$"; my $fh; (open $fh, '>:raw', $tempname) && (print $fh $contents) && (close $fh) or die qq[Error writing "$tempname": $!]; chmod $mode, $tempname if defined $mode; rename($tempname, $fullname) or unlink($tempname); } return $fullname; } sub _set_progname { if (defined $ENV{PAR_PROGNAME} and $ENV{PAR_PROGNAME} =~ /(.+)/) { $progname = $1; } $progname ||= $0; if ($ENV{PAR_TEMP} and index($progname, $ENV{PAR_TEMP}) >= 0) { $progname = substr($progname, rindex($progname, $sys{_delim}) + 1); } if (!$ENV{PAR_PROGNAME} or index($progname, $sys{_delim}) >= 0) { if (open my $fh, '<', $progname) { return if -s $fh; } if (-s "$progname$sys{_exe}") { $progname .= $sys{_exe}; return; } } foreach my $dir (split /\Q$sys{path_sep}\E/, $ENV{PATH}) { next if exists $ENV{PAR_TEMP} and $dir eq $ENV{PAR_TEMP}; $dir =~ s/\Q$sys{_delim}\E$//; (($progname = "$dir$sys{_delim}$progname$sys{_exe}"), last) if -s "$dir$sys{_delim}$progname$sys{_exe}"; (($progname = "$dir$sys{_delim}$progname"), last) if -s "$dir$sys{_delim}$progname"; } } sub _fix_progname { $0 = $progname ||= $ENV{PAR_PROGNAME}; if (index($progname, $sys{_delim}) < 0) { $progname = ".$sys{_delim}$progname"; } my $pwd = (defined &Cwd::getcwd) ? Cwd::getcwd() : ((defined &Win32::GetCwd) ? Win32::GetCwd() : `pwd`); chomp($pwd); $progname =~ s/^(?=\.\.?\Q$sys{_delim}\E)/$pwd$sys{_delim}/; $ENV{PAR_PROGNAME} = $progname; } sub _par_init_env { if ( $ENV{PAR_INITIALIZED}++ == 1 ) { return; } else { $ENV{PAR_INITIALIZED} = 2; } for (qw( SPAWNED TEMP CLEAN DEBUG CACHE PROGNAME ) ) { delete $ENV{"PAR_$_"}; } for (qw/ TMPDIR TEMP CLEAN DEBUG /) { $ENV{"PAR_$_"} = $ENV{"PAR_GLOBAL_$_"} if exists $ENV{"PAR_GLOBAL_$_"}; } if ($ENV{PAR_TEMP}) { delete $ENV{PAR_CLEAN}; } } sub outs { return if $quiet; if ($logfh) { print $logfh "@_\n"; } else { print "@_\n"; } } sub init_inc { require Config; push @INC, grep defined, map $Config::Config{$_}, qw( archlibexp privlibexp sitearchexp sitelibexp vendorarchexp vendorlibexp ); } package main; require PAR; unshift @INC, \&PAR::find_par; PAR->import(@par_args); die qq[par.pl: Can't open perl script "$progname": No such file or directory\n] unless -e $progname; do $progname; CORE::exit($1) if ($@ =~/^_TK_EXIT_\((\d+)\)/); die $@ if $@; }; $::__ERROR = $@ if $@; } CORE::exit($1) if ($::__ERROR =~/^_TK_EXIT_\((\d+)\)/); die $::__ERROR if $::__ERROR; 1; __END__ CACHEperlxsi.c#EgܺvT2;`o0rXrp v@wxy@z{<|||0P00@DPЃLh ,P@ p$zRx v&D$4(n`FJ w?9*3$"\`qtXqPHPwBBB B(A0A8D@l 8D0A(B BBBI wAJq AA @@xdBBB A(A0G~ 0A(A BBBK <@lyBBA A(G I k (A ABBI yFHyH4zYBBB B(A0D8G` 8A0A(B BBBE H|8T|FAA G L@I@  DABA 4| `H|FBB B(A0A8G L!o 8A0A(B BBBF !O"Z!A!~&E\8~AEAG I  AAD Z HAM HFBB B(A0H8DPL 8K0A(B BBBE P,iH P H lEAG<$>BAA H Q D  AABK $!HXL<FBB H(G0D@~ 0D(A BBBJ dHGPaHA@0̆FFIN B(A0A8G4]_Br 8D0A(B BBBG AKZA_DNIK  8D0A(B BBBM CFA(lEHD0A AAD 4 0EAN0O AAK W DAE ,DoEADP_ CAA LtjBIB B(A0A8GB 8A0A(B BBBA ȥIH@HFEE B(D0E8G@ 8A0A(B BBBB <(TUFFB A(D0 (A BBBM )P)Y ao   H ooooo0 @ P ` p !! !0!@!P!`!p!!!!!!!!!"" "0"@"P"`"p"""""""""## #0#@#P#`#p# PAR.pm rGCC: (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.dynamic.data.bss.comment 880&hh$9 GoQ Y aonop}HHB  `####P&&:aa pp@h(@(P 0(-U ELF>(@`@8 @@@@ AAppp(H(H888800hhhDDStd88800PtdQtdRtd/lib64/ld-linux-x86-64.so.2 GNUGNU פmFShhaGNU;@D( "I A ;>ABJKMPQRSVX[]nG-k|.śd|!qXGoKBׇ?,|l`OÛk CffŹ@8BEpWw3b% : ݣkF ~emN; kP WII rXm> o f v, MF=cLc"M 0TToF<Fa&0 D1@3&@9i{p]/;9>@3AHf`( &P(&P]I !H~QT;!t"@(0J@_Uh 4R__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTablePerl_sys_termPerl_sys_init3perl_constructPerl_get_svPL_exit_flagsPerl_sv_setpvnPL_do_undumpPerl_newXS_flagsPL_taintingperl_freePerl_mg_setPerl_sv_setpvPL_taintedPerl_gv_fetchpvperl_runPerl_newXSperl_destructPL_perl_destruct_levelboot_DynaLoaderPerl_croakperl_parsePerl_safesysmallocperl_alloc__stack_chk_failexitlseek64readdir64strdupclosediropen64strrchrunlinkstrtokstrlenrmdirread__memcpy_chkmkdir__vfprintf_chkgetpidreadlinkrealloc__sprintf_chk__memmove_chk__fprintf_chklstat64__libc_start_mainstderrmemchr__cxa_finalizestrchropendirgetuidaccessmemcpystrcmp__errno_locationstrncmp__environlibperl.solibc.so.6par_current_execpar_basenameXS_Internals_PAR_BOOTpar_env_cleanpar_current_exec_procpar_dirnamesha_finalget_username_from_getpwuidpar_cleanup_IO_stdin_used__data_startsha_updatexs_init__bss_startsha_init_endpar_mktmpdir_edatapar_setup_libpathpar_findprogmy_par_plpar_diepar_init_envGLIBC_2.14GLIBC_2.34GLIBC_2.4GLIBC_2.33GLIBC_2.3.4GLIBC_2.2.5/opt/hostedtoolcache/perl/5.42.0/x64/lib/5.42.0/x86_64-linux/CORE!ii ,6ti Aui M)P) rW7@XHLPPQUR]`Mh[(08@HPX` h p x   !"# $(%0&8'@(H)P*X+`,h-p.x/012345689:HHHtH5%@hfhfhfhfhfhfhfhrfhbfh Rfh Bfh 2fh "fh fhfhfhfhfhfhfhfhfhfhrfhbfhRfhBfh2fh"fhfhfhfh fh!fh"fh#fh$fh%fh&fh'rfh(bfh)Rfh*Bfh+2fh,"fh-fh.fh/fh0fh1fh2fh3fh4f%^fD%fD%fD%~fD%vfD%nfD%ffD%^fD%VfD%NfD%FfD%>fD%6fD%.fD%&fD%fD%fD%fD%fD%fD%fD%fD%fD%ީfD%֩fD%ΩfD%ƩfD%fD%fD%fD%fD%fD%fD%fD%fD%~fD%vfD%nfD%ffD%^fD%VfD%NfD%FfD%>fD%6fD%.fD%&fD%fD%fD%fD%fD%fD%fD%fDUSH8|$H|$Ht$Ht$HT$HT$dH%(HD$(1=Eu$vHWHH\D$ xXHcHH|$DD$HHHHH`JHAHHAHMJHAAHAHHcHHD9uHcH=E1H5VHtQH=Hl$$rHH=HHt8H=]`HD$(dH+%(u^H8[]H=3H=HtH=GH"HHHtٺ==1I^HHPTE11H=#f.H=AH:H9tHަHt H=H5 H)HH?HHHtHHtfD=u+UH=Ht H= d]wAWAVAUATUSHHL5MIIt<=uXE1IHt3McLLLHuB<#=tGH]HHuHH[]A\A]A^A_IAD$It<=uE)fDL)J\#HAmfD1@SHHdH%(H$1HZu6T$@tuHD1H$dH+%(u HĠ[ff.fAVAUATUSHdH%(H$1Ht?Hu1H$dH+%(HĠ[]A\A]A^f.{IHtLKHx.Hhu}tfx.HHIEtMcLSIILIHǾ1H *DaLHLtD$%=@tV9LLH^LH }.X}!I\ff.AUATUSHH $HdH%(H$1IHHH=\CL~ƒHcȀ< u@u4HHH$dH+%(uFH[]A\A]fDLc/LLHtLLH"ff.HH5HH=BH[DE1H5HH=BHf.AWAVAUATUHSHH(dH%(HD$11>=HHHt$HIHHIL9LcD$N4<=HfPHt=uH)HL- J| MIEHtVHHKJ0<=t"u <=tHHu=1fDLLHuHD$dH+%('H([]A\A]A^A_@1fDTATHu@L=QI?LE1fHDAH8uDrMcJ :ufHHL$$HHLMcHL$LN4LHɠHAEDl$HHgfDLHHHHMcN4D1_E1LH5HnH=@rfATUSHH $HH $H dH%(H$ 1HH$)L ?HAH ?1HߺH1x2D`HMcLlHHtHcLHHHH$ dH+%(uH H[]A\DAWAVAUATUSHH $HdH%(H$1IHH=?Ht$ U/LHHt@LH=>!LH$dH+%(Hĸ[]A\A]A^A_DHL->L5?LHHHt;t~fHtHHtMHHTIH9r!DHH9t:/tHILIDH=vOL1HH;uHt}.tAH=f.}tL$LI1HLATL =Ht$ LZYkD$(%=WLiBLH=h=LgS/HHPHHEH[jf.USHH $HdH%(H$1H?H=HPHHHrHHH1t tD fDHt HDH9rHH9t8/t/H"Ht-H9rXHH$dH+%(uIH[]H$dH+%(u)HH=;[]81?ff.@AWAVAUATUH-;SHdH%(HD$1H\$HHHtBHcT$HnHHPHHtfDHPHHHuHHHuH-d;HH~HtAHcT$HHHPHHtDHPHHHuHH=HuH-;HH&HtAHcT$HHHPHHtDHPHHHuHHHuH-:HHHtAHcT$HeHHPHHtDHPHHHuHHHuH-t:HHvHtAHcT$H HHPHHtDHPHHHuHH5HuL%,:HLHtAHcT$HHHPHHtDHPHHHuHLHuL%9HLHtAHcT$H]HHPHHtDHPHHHuHLHuL59HLnHtAHcT$HHHPHHtDHPHHHuHL-HuL-:9HLHtAHcT$HHHPHHtDHPHHHuHLHuL=8HLHtAHcT$HUHHPHHtDHPHHHuHL}HuL=28HLfHtAHcT$HHHPHHtDHPHHHuHL%HuHH=C8Ht HLHH=58HtHH=38HH=/8HHt5LHD$dH+%(u>HHH58[]A\A]A^A_HH=7HtHLcff.HH=`7dH%(HD$1Ht$7Ht20 ЃHT$dH+%(uH1PXHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HH$HH=*HD$HD$ $D$0HD$xATUSL$HH $L9uH1dH%(H$1AHjHhHH?H0HDH)H)1HD3HHD}HHvXHDH9rNHDHH9r7H H9uH)HH$dH+%(uOH[]A\f.HH\HH=51H=|51fHCHtHHff.@AVAUATL%F5UHLSHdH%(HD$1Ht$Ht8Hu,HD$dH+%(u~HHL[]A\A]A^EDHhHI]MtLHLISHIL 3H 41XZHD$dH+%(uL fAWH 4AVfHnH 4AUATUSHxH<$Hl$H=`3HdH%(H$hHC3HD$0HDŽ$HD$PfHnH4flfHnH4)D$ fHnfHnH 3flH3D$hfHnfHnH 3flD$xfHnfl)D$@Ht 8HJH L8MLLtLM&EHD$HEtZL-k3fDLEH1LIM9LEICHL)HH9HBI)HMtEuLl$`H=2DI}IHt;H#IHt8tHtLIHuJf.Ll$ MeMt2A<$LMeIMuf.LH\$IHEMcLSML J1IHK2LPH 22L1Ly_AXu,DAH$LoÅtyH$MH=ːH2H1%E1H$hdH+%(.HxL[]A\A]A^A_fDLIIH$%=@pD$A9Z$%=CLHH=0IBHIH $HH9IH.L6Hƒ~>HH50HT$I|&u"HT$BHA</@HH-/HH<0HH50H-0|L=0`ULL E/PMH n0L1XZC;8uD!HMUL .LLSLP1H L7tL LH=.L#fDE1 H|$@H\$@Ht HHt8u>H{HHu A L=6/A ASHD$HHhIHtH$MH= H/H1g=fHhH$hdH+%(dHxH[]A\A]A^A_H$L8@L11tADž'H1HpDH$'H$*DH $H$*CACf$.HE1HqDH$0(DHH(HP.MLƄ$XH .L ,LP1SY^H$HPHHH$HH$H5-H|H$LDH=-1f.UH=w,SHdH%(HD$1Hl$H UHt 81?10H=R-HHt$H@H5<-H8HCH8G@.H=-xHHt'HH=+HHHCH8yH=,H5,HYHH=G+:HTHHt<HPv HD$dH+%(H[]H=LHHHuH=,1xfHɊH0HCH8DHHH=,H01i@USHH=*HdH%(HD$1Ht$rHt0u Ht;u!HD$dH+%(urH[]f.H/HHHPHHEHH5*HQuHD$dH+%(uHH[]/f.AWHLG8AVAUATUSHdH%(H$1HL$HAMHIȉLHGLH H(I8%L IHIEL H HGL9ufoL$fo\$ HD$hHhfoT$0fo-hofofoPHfHfffofsfsffofof)@H9uLL^H~ H^LLHnHL$HHH $H yZ8yZLH1H!H1؍<HHHHIH LIAL1L!L1HHHL LT$D$LLHHOyZMH IH1‰H!L1LMIM Ll$AHHHEO(yZH MH1ЉL!IH1LMIM Ll$ ALIHEJ)yZL MH1IAL!H1HLHL Ll$(LIHJ/yZL IH1IAL!L1HHHL Ll$0LIHO,yZL IH1IAH!L1LIIM Ll$8AHHHEO*yZH MH1IH!L1LMIM Ll$@AHHHEO(yZH MH1IL!H1LMIM Ll$HALIHEJ)yZL MH1IAL!H1HLHL Ll$PLIHJ/yZL IH1IAL!L1HHHL Ll$XLIHO,yZL IH1IAH!L1LIIM Ll$`AHHHEO*yZH MH1IH!L1LMIM Ll$hAHHHEO(yZH MH1IL!H1LMIM Ll$pALIHEJ)yZL MH1IAL!H1HLHL Ll$xLHIJ/yZL IH1IAL!L1HHHL L$LIHO,yZL IH1IAH!L1LIIM F,"HHL$HH O"yZMH1IH!L1LMIM L$AHHHEO yZH MH1IL!H1LMIM ELMIIAM L$L1L!J)yZMH1IHLHL HLIHAL MEI1D1L$JnMHLIHL ҉HLHIAL$L ỈH$I1D1MnLMIHL ILIHEL IՉH$I1D1L9nLLHHH ILIHDL I‰I1E1NnHIIHL ҉ILIHEL IH$I1H$E1NnLMIHL IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1H$E1NnLMIHL IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMHIH$L IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMIHL H$IHHHEH H׉H$H1D1L9nLLHHH ILIHDL I‰H$ I1E1NnHIIHL ҉ILIHEL IȉI1E1NnLMIHL IHHHEH$(H H׉H$0H1D1MH9nLIHL MIIM IHM1H$8E1INnHIHL ALIHEL MEI1IAD1MHnLIHL DHHܼHH I ΉH!M!I H$@HLMLMIIM ALIHEL H IAI!L!L L$HIMMLMIIM IALIHEL AI M!L!L L$PILMHLIHL LIHL H IAM!L!L L$XIMILIIIM IALIHEL AI I!L!L L$`IMMLMIIM AHHHEH H I։M!L!L L$hIMMLMIIM IALIHEL AI M!L!L L$pIMMLMIIM ALHIEL H IAM!L!L L$xILMHLIHL ILIHL AI M!L!L L$IMILIIIM ALIHEL H IAH!M!L L$IMMLMIIM IAHHHEH I M!H!L L$IMMLMIIM ALIHEL H IAI!L!L L$IMMLMIIM IALIHEL AI M!L!L L$ILMHLIHL LIHL H IAM!L!L L$IMILIIIM IALIHEL AI I!L!L L$IMMLMIIM AHHHEH H I։M!L!L L$IMMLMIIM IALIHEL I AM!L!L L$IMMLMIIM ALIHEL H IAM!L!L L$ILMHLIHL D9LIHHL AH L!L!H H$HLMH$HLIHL щHLIHAL H IAL!M!I J<8LL$LMHIL HLIHAI bL11H$HLMHLIHL MԉIHIIM MĉEM1D1L$IMILIIIM MIIEM L$LAIMMM1D1MILIHL IHHHEH DMI1LL$D1MHLHIIL щHLIHAI DIՉM1LL$E1MILIIHL ILIHEL L$ILMI1D1MHLIHL HLIHAI DỈLM1L$ E1MILIIHL ILIHEL L$ILMI1D1MHLIHL HLIHAI DI҉M1LL$0E1MILIHL щILHIEIL L$(ILMI1D1MHLIHL HLIHAI DIΉM1LL$@E1MILIHL ILIHEL L$8ILMI1D1MHLHIIL щHLIHAI DIՉM1LL$`E1MILIHL ILIHEL L$HILMEI1D1MHLIHL HLIHAI H$PHIHʉL1ID1MILIHL ‰ILIHEL L$XILMI1D1MHLIHL HLIHAI DI҉M1LL$pE1MLMIIM MEILIIM L$hAIH$xLMLM1D1MHLIHL MIIM EMHM1MED1ILMLIIIM DMIIM M1D1IHHHIAL Dn HNLVHHHHLn H DHFH$dH+%(uHĘ[]A\A]A^A_vfDHfo&SH@0fo#S@x@fo S@ HAWHcAVIAUATIUHo8SHHHw(HW0 H9HO(HHHHG0HcGxA?'A@EAEoIIݐoLH@EoKMoSU o[]0L9uAE)IcHr\IUIL$@HIT$8ITHTH)HI)HHrH1ItH4HH9rEt$xH[]A\A]A^A_ÐutHtAUAT$8tATfT@A@H|HA)E9EOMcLAD$xDAD$x@uLE)LI#AUAT$8ATT\AVLv8AUATUHSLn(HLf0LH?PD8Hcʃ8@L)t1ƒ9rHAfC8IF0AFAF LALLHHLHILH@@HH LHH AHH AHH HH HHH HH HCpHHHEHHEHeHEHCHEHCHEHCeHCEHCHEHCHE HCe HCE HCHE HCHE HCeHCEHC HEHC HEHC eHC E[]A\A]A^8I1)ЃrGINIIDHI)D|1҉փH<19re@u$UAI1fAT<AAD$HH%s/%s/proc/self/exeDynaLoader::boot_DynaLoaderInternals::PAR::BOOT/proc/%i/%s.PAR_TEMPPAR_PROGNAME:/PERL5LIBPERLLIBPERL5OPTPERLIOPAR_INITIALIZEDPAR_SPAWNEDPAR_CLEANPAR_DEBUGPAR_CACHEPAR_GLOBAL_DEBUGPAR_GLOBAL_TMPDIRPAR_TMPDIRPAR_GLOBAL_TEMPPAR_GLOBAL_CLEAN1lseek failedread failedLD_LIBRARY_PATHSYSTEM/tmpTEMPDIRTMPUSERUSERNAME%02x%s%s%s%spar-parl.parshort read%s%scache-%s%s%s%stemp-%u%s%s%stemp-%u-%u%sperl0PAR::Packer::VERSION1.064-e--%s: creation of private subdirectory %s failed (errno=%i) %s: private subdirectory %s is unsafe (please remove it and retry your operation) Unable to create cache directory%s: creation of private cache subdirectory %s failed (errno=%i) eval 'exec /usr/bin/perl -S $0 ${1+"$@"}' if 0; # not running under some shell package __par_pl; my ($PAR_MAGIC, $FILE_offset_size, $cache_name_size); BEGIN { $PAR_MAGIC = "\nPAR.pm\n"; $FILE_offset_size = 4; # pack("N") $cache_name_size = 40; $PKZIP_MAGIC = "PK\003\004"; } sub find_par_magic { my ($fh) = @_; my $chunk_size = 64 * 1024; my $buf; my $size = -s $fh; my $pos = ($size-1) - ($size-1) % $chunk_size; # NOTE: $pos is a multiple of $chunk_size while ($pos >= 0) { seek $fh, $pos, 0; read $fh, $buf, $chunk_size + length($PAR_MAGIC); if ((my $i = rindex($buf, $PAR_MAGIC)) >= 0) { return $pos + $i; } $pos -= $chunk_size; } return -1; } my ($par_temp, $progname, @tmpfile, %ModuleCache); END { if ($ENV{PAR_CLEAN}) { require File::Temp; require File::Basename; require File::Spec; my $topdir = File::Basename::dirname($par_temp); outs(qq[Removing files in "$par_temp"]); File::Find::finddepth(sub { ( -d ) ? rmdir : unlink }, $par_temp); rmdir $par_temp; if (-d $par_temp && $^O ne 'MSWin32') { my $tmp = new File::Temp( TEMPLATE => 'tmpXXXXX', DIR => File::Basename::dirname($topdir), SUFFIX => '.cmd', UNLINK => 0, ); my $filename = $tmp->filename; print $tmp <<"..."; x=1; while [ \$x -lt 10 ]; do rm -rf '$par_temp' if [ \! -d '$par_temp' ]; then break fi sleep 1 x=`expr \$x + 1` done rm '$filename' ... close $tmp; chmod 0700, $filename; my $cmd = "$filename >/dev/null 2>&1 &"; system($cmd); outs(qq[Spawned background process to perform cleanup: $filename]); } } } BEGIN { Internals::PAR::BOOT() if defined &Internals::PAR::BOOT; eval { _par_init_env(); my $quiet = !$ENV{PAR_DEBUG}; my %sys = ( path_sep => ($^O =~ /^MSWin/ ? ';' : ':'), _exe => ($^O =~ /^(?:MSWin|OS2|cygwin)/ ? '.exe' : ''), _delim => ($^O =~ /^MSWin|OS2/ ? '\\' : '/'), ); _set_progname(); outs(qq[\$progname = "$progname"]); _set_par_temp(); outs(qq[\$ENV{PAR_TEMP} = "$ENV{PAR_TEMP}"]); my ($start_pos, $start_of_FILE_section); MAGIC: { local $SIG{__WARN__} = sub {}; unless (open _FH, '<:raw', $progname) { outs(qq[Can't read from file "$progname"]); # don't use $! here as it requires Errno.pm last MAGIC; } my $magic_pos = find_par_magic(*_FH); if ($magic_pos < 0) { outs(qq[Can't find magic string "$PAR_MAGIC" in file "$progname"]); last MAGIC; } outs("Found PAR magic at position $magic_pos"); seek _FH, $magic_pos - $FILE_offset_size - length("\0CACHE"), 0; read _FH, $buf, length("\0CACHE"); if ($buf ne "\0CACHE" && $buf ne "\0CLEAN") { outs("No cache marker found"); last MAGIC; } outs(qq[Cache marker "$buf" found]); seek _FH, $magic_pos - $FILE_offset_size, 0; read _FH, $buf, $FILE_offset_size; my $offset = unpack("N", $buf); outs("Offset from start of FILEs is $offset"); seek _FH, $magic_pos - $FILE_offset_size - $offset, 0; $start_of_FILE_section = tell _FH; my %require_list; read _FH, $buf, 4; # read the first "FILE" while ($buf eq "FILE") { read _FH, $buf, 4; read _FH, $buf, unpack("N", $buf); my $fullname = $buf; outs(qq[Unpacking FILE "$fullname"...]); my $crc = ( $fullname =~ s|^([a-f\d]{8})/|| ) ? $1 : undef; my ($basename, $ext) = ($buf =~ m|(?:.*/)?(.*)(\..*)|); read _FH, $buf, 4; read _FH, $buf, unpack("N", $buf); if (defined($ext) and $ext !~ /\.(?:pm|pl|ix|al)$/i) { my $filename = _save_as("$crc$ext", $buf, 0755); $PAR::Heavy::FullCache{$fullname} = $file PAR.pm Qq@@q;?@@[?>[>=`[=@< [<;Z;:Z:9`Z9@8 Z87Y76Y65`Y5@4 Y43X32X21`X1@0 X0/W/.W.-`W-@, W,+V+*V*)`V)@( V('U'&U&%`U%@$ U$#T#"T"!`T!@ T SS`S@ SRR`R@ RQQ`Q@ QPP`P@ POO `O @ O N N `N @ NMM`M@ MLL`L@;`$@H?GCC: (Ubuntu 13.3.0-6ubuntu2~24.04.1) 13.3.0.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.got.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.dynamic.data.bss.comment 880&hh$9 GoQ YX X aaonoPPp}h B((00 0 02222p 5 58mm ppsshtht0xx|||~xp@ @p@0 0p@-@ FILEda9b579d/File/GlobMapper.pm=?package File::GlobMapper; use strict; use warnings; use Carp; our ($CSH_GLOB); BEGIN { if ($] < 5.006) { require File::BSDGlob; File::BSDGlob->import(':glob'); $CSH_GLOB = File::BSDGlob::GLOB_CSH(); *globber = \&File::BSDGlob::csh_glob; } else { require File::Glob; File::Glob->import(':glob'); $CSH_GLOB = File::Glob::GLOB_CSH(); #*globber = \&File::Glob::bsd_glob; *globber = \&File::Glob::csh_glob; } } our ($Error); our ($VERSION, @EXPORT_OK); $VERSION = '1.001'; @EXPORT_OK = qw( globmap ); our ($noPreBS, $metachars, $matchMetaRE, %mapping, %wildCount); $noPreBS = '(? '([^/]*)', '?' => '([^/])', '.' => '\.', '[' => '([', '(' => '(', ')' => ')', ); %wildCount = map { $_ => 1 } qw/ * ? . { ( [ /; sub globmap ($$;) { my $inputGlob = shift ; my $outputGlob = shift ; my $obj = File::GlobMapper->new($inputGlob, $outputGlob, @_) or croak "globmap: $Error" ; return $obj->getFileMap(); } sub new { my $class = shift ; my $inputGlob = shift ; my $outputGlob = shift ; # TODO -- flags needs to default to whatever File::Glob does my $flags = shift || $CSH_GLOB ; #my $flags = shift ; $inputGlob =~ s/^\s*\<\s*//; $inputGlob =~ s/\s*\>\s*$//; $outputGlob =~ s/^\s*\<\s*//; $outputGlob =~ s/\s*\>\s*$//; my %object = ( InputGlob => $inputGlob, OutputGlob => $outputGlob, GlobFlags => $flags, Braces => 0, WildCount => 0, Pairs => [], Sigil => '#', ); my $self = bless \%object, ref($class) || $class ; $self->_parseInputGlob() or return undef ; $self->_parseOutputGlob() or return undef ; my @inputFiles = globber($self->{InputGlob}, $flags) ; if (GLOB_ERROR) { $Error = $!; return undef ; } #if (whatever) { my $missing = grep { ! -e $_ } @inputFiles ; if ($missing) { $Error = "$missing input files do not exist"; return undef ; } } $self->{InputFiles} = \@inputFiles ; $self->_getFiles() or return undef ; return $self; } sub _retError { my $string = shift ; $Error = "$string in input fileglob" ; return undef ; } sub _unmatched { my $delimeter = shift ; _retError("Unmatched $delimeter"); return undef ; } sub _parseBit { my $self = shift ; my $string = shift ; my $out = ''; my $depth = 0 ; while ($string =~ s/(.*?)$noPreBS(,|$matchMetaRE)//) { $out .= quotemeta($1) ; $out .= $mapping{$2} if defined $mapping{$2}; ++ $self->{WildCount} if $wildCount{$2} ; if ($2 eq ',') { return _unmatched("(") if $depth ; $out .= '|'; } elsif ($2 eq '(') { ++ $depth ; } elsif ($2 eq ')') { return _unmatched(")") if ! $depth ; -- $depth ; } elsif ($2 eq '[') { # TODO -- quotemeta & check no '/' # TODO -- check for \] & other \ within the [] $string =~ s#(.*?\])## or return _unmatched("["); $out .= "$1)" ; } elsif ($2 eq ']') { return _unmatched("]"); } elsif ($2 eq '{' || $2 eq '}') { return _retError("Nested {} not allowed"); } } $out .= quotemeta $string; return _unmatched("(") if $depth ; return $out ; } sub _parseInputGlob { my $self = shift ; my $string = $self->{InputGlob} ; my $inGlob = ''; # Multiple concatenated *'s don't make sense #$string =~ s#\*\*+#*# ; # TODO -- Allow space to delimit patterns? #my @strings = split /\s+/, $string ; #for my $str (@strings) my $out = ''; my $depth = 0 ; while ($string =~ s/(.*?)$noPreBS($matchMetaRE)//) { $out .= quotemeta($1) ; $out .= $mapping{$2} if defined $mapping{$2}; ++ $self->{WildCount} if $wildCount{$2} ; if ($2 eq '(') { ++ $depth ; } elsif ($2 eq ')') { return _unmatched(")") if ! $depth ; -- $depth ; } elsif ($2 eq '[') { # TODO -- quotemeta & check no '/' or '(' or ')' # TODO -- check for \] & other \ within the [] $string =~ s#(.*?\])## or return _unmatched("["); $out .= "$1)" ; } elsif ($2 eq ']') { return _unmatched("]"); } elsif ($2 eq '}') { return _unmatched("}"); } elsif ($2 eq '{') { # TODO -- check no '/' within the {} # TODO -- check for \} & other \ within the {} my $tmp ; unless ( $string =~ s/(.*?)$noPreBS\}//) { return _unmatched("{"); } #$string =~ s#(.*?)\}##; #my $alt = join '|', # map { quotemeta $_ } # split "$noPreBS,", $1 ; my $alt = $self->_parseBit($1); defined $alt or return 0 ; $out .= "($alt)" ; ++ $self->{Braces} ; } } return _unmatched("(") if $depth ; $out .= quotemeta $string ; $self->{InputGlob} =~ s/$noPreBS[\(\)]//g; $self->{InputPattern} = $out ; #print "# INPUT '$self->{InputGlob}' => '$out'\n"; return 1 ; } sub _parseOutputGlob { my $self = shift ; my $string = $self->{OutputGlob} ; my $maxwild = $self->{WildCount}; if ($self->{GlobFlags} & GLOB_TILDE) #if (1) { $string =~ s{ ^ ~ # find a leading tilde ( # save this in $1 [^/] # a non-slash character * # repeated 0 or more times (0 means me) ) }{ $1 ? (getpwnam($1))[7] : ( $ENV{HOME} || $ENV{LOGDIR} ) }ex; } # max #1 must be == to max no of '*' in input while ( $string =~ m/#(\d)/g ) { croak "Max wild is #$maxwild, you tried #$1" if $1 > $maxwild ; } my $noPreBS = '(?{OutputGlob}' => '$string'\n"; $self->{OutputPattern} = $string ; return 1 ; } sub _getFiles { my $self = shift ; my %outInMapping = (); my %inFiles = () ; foreach my $inFile (@{ $self->{InputFiles} }) { next if $inFiles{$inFile} ++ ; my $outFile = $inFile ; if ( $inFile =~ m/$self->{InputPattern}/ ) { no warnings 'uninitialized'; eval "\$outFile = $self->{OutputPattern};" ; if (defined $outInMapping{$outFile}) { $Error = "multiple input files map to one output file"; return undef ; } $outInMapping{$outFile} = $inFile; push @{ $self->{Pairs} }, [$inFile, $outFile]; } } return 1 ; } sub getFileMap { my $self = shift ; return $self->{Pairs} ; } sub getHash { my $self = shift ; return { map { $_->[0] => $_->[1] } @{ $self->{Pairs} } } ; } 1; __END__ =head1 NAME File::GlobMapper - Extend File Glob to Allow Input and Output Files =head1 SYNOPSIS use File::GlobMapper qw( globmap ); my $aref = globmap $input => $output or die $File::GlobMapper::Error ; my $gm = File::GlobMapper->new( $input => $output ) or die $File::GlobMapper::Error ; =head1 DESCRIPTION This module needs Perl5.005 or better. This module takes the existing C module as a starting point and extends it to allow new filenames to be derived from the files matched by C. This can be useful when carrying out batch operations on multiple files that have both an input filename and output filename and the output file can be derived from the input filename. Examples of operations where this can be useful include, file renaming, file copying and file compression. =head2 Behind The Scenes To help explain what C does, consider what code you would write if you wanted to rename all files in the current directory that ended in C<.tar.gz> to C<.tgz>. So say these files are in the current directory alpha.tar.gz beta.tar.gz gamma.tar.gz and they need renamed to this alpha.tgz beta.tgz gamma.tgz Below is a possible implementation of a script to carry out the rename (error cases have been omitted) foreach my $old ( glob "*.tar.gz" ) { my $new = $old; $new =~ s#(.*)\.tar\.gz$#$1.tgz# ; rename $old => $new or die "Cannot rename '$old' to '$new': $!\n; } Notice that a file glob pattern C<*.tar.gz> was used to match the C<.tar.gz> files, then a fairly similar regular expression was used in the substitute to allow the new filename to be created. Given that the file glob is just a cut-down regular expression and that it has already done a lot of the hard work in pattern matching the filenames, wouldn't it be handy to be able to use the patterns in the fileglob to drive the new filename? Well, that's I what C does. Here is same snippet of code rewritten using C for my $pair (globmap '<*.tar.gz>' => '<#1.tgz>' ) { my ($from, $to) = @$pair; rename $from => $to or die "Cannot rename '$old' to '$new': $!\n; } So how does it work? Behind the scenes the C function does a combination of a file glob to match existing filenames followed by a substitute to create the new filenames. Notice how both parameters to C are strings that are delimited by <>. This is done to make them look more like file globs - it is just syntactic sugar, but it can be handy when you want the strings to be visually distinctive. The enclosing <> are optional, so you don't have to use them - in fact the first thing globmap will do is remove these delimiters if they are present. The first parameter to C, C<*.tar.gz>, is an I. Once the enclosing "< ... >" is removed, this is passed (more or less) unchanged to C to carry out a file match. Next the fileglob C<*.tar.gz> is transformed behind the scenes into a full Perl regular expression, with the additional step of wrapping each transformed wildcard metacharacter sequence in parenthesis. In this case the input fileglob C<*.tar.gz> will be transformed into this Perl regular expression ([^/]*)\.tar\.gz Wrapping with parenthesis allows the wildcard parts of the Input File Glob to be referenced by the second parameter to C, C<#1.tgz>, the I. This parameter operates just like the replacement part of a substitute command. The difference is that the C<#1> syntax is used to reference sub-patterns matched in the input fileglob, rather than the C<$1> syntax that is used with perl regular expressions. In this case C<#1> is used to refer to the text matched by the C<*> in the Input File Glob. This makes it easier to use this module where the parameters to C are typed at the command line. The final step involves passing each filename matched by the C<*.tar.gz> file glob through the derived Perl regular expression in turn and expanding the output fileglob using it. The end result of all this is a list of pairs of filenames. By default that is what is returned by C. In this example the data structure returned will look like this ( ['alpha.tar.gz' => 'alpha.tgz'], ['beta.tar.gz' => 'beta.tgz' ], ['gamma.tar.gz' => 'gamma.tgz'] ) Each pair is an array reference with two elements - namely the I filename, that C has matched, and a I filename that is derived from the I filename. =head2 Limitations C has been kept simple deliberately, so it isn't intended to solve all filename mapping operations. Under the hood C (or for older versions of Perl, C) is used to match the files, so you will never have the flexibility of full Perl regular expression. =head2 Input File Glob The syntax for an Input FileGlob is identical to C, except for the following =over 5 =item 1. No nested {} =item 2. Whitespace does not delimit fileglobs. =item 3. The use of parenthesis can be used to capture parts of the input filename. =item 4. If an Input glob matches the same file more than once, only the first will be used. =back The syntax =over 5 =item B<~> =item B<~user> =item B<.> Matches a literal '.'. Equivalent to the Perl regular expression \. =item B<*> Matches zero or more characters, except '/'. Equivalent to the Perl regular expression [^/]* =item B Matches zero or one character, except '/'. Equivalent to the Perl regular expression [^/]? =item B<\> Backslash is used, as usual, to escape the next character. =item B<[]> Character class. =item B<{,}> Alternation =item B<()> Capturing parenthesis that work just like perl =back Any other character it taken literally. =head2 Output File Glob The Output File Glob is a normal string, with 2 glob-like features. The first is the '*' metacharacter. This will be replaced by the complete filename matched by the input file glob. So *.c *.Z The second is Output FileGlobs take the =over 5 =item "*" The "*" character will be replaced with the complete input filename. =item #1 Patterns of the form /#\d/ will be replaced with the =back =head2 Returned Data =head1 EXAMPLES =head2 A Rename script Below is a simple "rename" script that uses C to determine the source and destination filenames. use File::GlobMapper qw(globmap) ; use File::Copy; die "rename: Usage rename 'from' 'to'\n" unless @ARGV == 2 ; my $fromGlob = shift @ARGV; my $toGlob = shift @ARGV; my $pairs = globmap($fromGlob, $toGlob) or die $File::GlobMapper::Error; for my $pair (@$pairs) { my ($from, $to) = @$pair; move $from => $to ; } Here is an example that renames all c files to cpp. $ rename '*.c' '#1.cpp' =head2 A few example globmaps Below are a few examples of globmaps To copy all your .c file to a backup directory '' '' If you want to compress all '' '<*.gz>' To uncompress '' '' =head1 SEE ALSO L =head1 AUTHOR The I module was written by Paul Marquess, F. =head1 COPYRIGHT AND LICENSE Copyright (c) 2005 Paul Marquess. All rights reserved. This program is free software; you can redistribute it and/or modify it under the same terms as Perl itself. FILEb585357c/File/Find.pmIpackage File::Find; use 5.006; use strict; use warnings; use warnings::register; use Exporter 'import'; require Cwd; require File::Basename; require File::Spec; our $VERSION = '1.44'; our @EXPORT = qw(find finddepth); my $Is_VMS = $^O eq 'VMS'; my $Is_Win32 = $^O eq 'MSWin32'; # Should ideally be my() not our() but local() currently # refuses to operate on lexicals our %SLnkSeen; our ($wanted_callback, $avoid_nlink, $bydepth, $no_chdir, $follow, $follow_skip, $full_check, $untaint, $untaint_skip, $untaint_pat, $pre_process, $post_process, $dangling_symlinks); sub contract_name { my ($cdir,$fn) = @_; return substr($cdir,0,rindex($cdir,'/')) if $fn eq $File::Find::current_dir; $cdir = substr($cdir,0,rindex($cdir,'/')+1); $fn =~ s|^\./||; my $abs_name= $cdir . $fn; if (substr($fn,0,3) eq '../') { 1 while $abs_name =~ s!/[^/]*/\.\./+!/!; } return $abs_name; } sub _is_absolute { return $_[0] =~ m|^(?:[A-Za-z]:)?/| if $Is_Win32; return substr($_[0], 0, 1) eq '/'; } sub _is_root { return $_[0] =~ m|^(?:[A-Za-z]:)?/\z| if $Is_Win32; return $_[0] eq '/'; } sub PathCombine($$) { my ($Base,$Name) = @_; my $AbsName; if (_is_absolute($Name)) { $AbsName= $Name; } else { $AbsName= contract_name($Base,$Name); } # (simple) check for recursion my $newlen= length($AbsName); if ($newlen <= length($Base)) { if (($newlen == length($Base) || substr($Base,$newlen,1) eq '/') && $AbsName eq substr($Base,0,$newlen)) { return undef; } } return $AbsName; } sub Follow_SymLink($) { my ($AbsName) = @_; my ($NewName,$DEV, $INO); ($DEV, $INO)= lstat $AbsName; while (-l _) { if ($SLnkSeen{$DEV, $INO}++) { if ($follow_skip < 2) { die "$AbsName is encountered a second time"; } else { return undef; } } my $Link = readlink($AbsName); # canonicalize directory separators $Link =~ s|\\|/|g if $Is_Win32; $NewName= PathCombine($AbsName, $Link); unless(defined $NewName) { if ($follow_skip < 2) { die "$AbsName is a recursive symbolic link"; } else { return undef; } } else { $AbsName= $NewName; } ($DEV, $INO) = lstat($AbsName); return undef unless defined $DEV; # dangling symbolic link } if ($full_check && defined $DEV && $SLnkSeen{$DEV, $INO}++) { if ( ($follow_skip < 1) || ((-d _) && ($follow_skip < 2)) ) { die "$AbsName encountered a second time"; } else { return undef; } } return $AbsName; } our($dir, $name, $fullname, $prune); sub _find_dir_symlnk($$$); sub _find_dir($$$); # check whether or not a scalar variable is tainted # (code straight from the Camel, 3rd ed., page 561) sub is_tainted_pp { my $arg = shift; my $nada = substr($arg, 0, 0); # zero-length local $@; eval { eval "# $nada" }; return length($@) != 0; } sub _find_opt { my $wanted = shift; return unless @_; die "invalid top directory" unless defined $_[0]; # This function must local()ize everything because callbacks may # call find() or finddepth() local %SLnkSeen; local ($wanted_callback, $avoid_nlink, $bydepth, $no_chdir, $follow, $follow_skip, $full_check, $untaint, $untaint_skip, $untaint_pat, $pre_process, $post_process, $dangling_symlinks); local($dir, $name, $fullname, $prune); local *_ = \my $a; my $cwd = $wanted->{bydepth} ? Cwd::fastcwd() : Cwd::getcwd(); if ($Is_VMS) { # VMS returns this by default in VMS format which just doesn't # work for the rest of this module. $cwd = VMS::Filespec::unixpath($cwd); # Apparently this is not expected to have a trailing space. # To attempt to make VMS/UNIX conversions mostly reversible, # a trailing slash is needed. The run-time functions ignore the # resulting double slash, but it causes the perl tests to fail. $cwd =~ s#/\z##; # This comes up in upper case now, but should be lower. # In the future this could be exact case, no need to change. } my $cwd_untainted = $cwd; my $check_t_cwd = 1; $wanted_callback = $wanted->{wanted}; $bydepth = $wanted->{bydepth}; $pre_process = $wanted->{preprocess}; $post_process = $wanted->{postprocess}; $no_chdir = $wanted->{no_chdir}; $full_check = $wanted->{follow}; $follow = $full_check || $wanted->{follow_fast}; $follow_skip = $wanted->{follow_skip}; $untaint = $wanted->{untaint}; $untaint_pat = $wanted->{untaint_pattern}; $untaint_skip = $wanted->{untaint_skip}; $dangling_symlinks = $wanted->{dangling_symlinks}; # for compatibility reasons (find.pl, find2perl) local our ($topdir, $topdev, $topino, $topmode, $topnlink); # a symbolic link to a directory doesn't increase the link count $avoid_nlink = $follow || $File::Find::dont_use_nlink; my ($abs_dir, $Is_Dir); Proc_Top_Item: foreach my $TOP (@_) { my $top_item = $TOP; $top_item = VMS::Filespec::unixify($top_item) if $Is_VMS; ($topdev,$topino,$topmode,$topnlink) = $follow ? stat $top_item : lstat $top_item; # canonicalize directory separators $top_item =~ s|[/\\]|/|g if $Is_Win32; # no trailing / unless path is root $top_item =~ s|/\z|| unless _is_root($top_item); $Is_Dir= 0; if ($follow) { if (_is_absolute($top_item)) { $abs_dir = $top_item; } elsif ($top_item eq $File::Find::current_dir) { $abs_dir = $cwd; } else { # care about any ../ $top_item =~ s/\.dir\z//i if $Is_VMS; $abs_dir = contract_name("$cwd/",$top_item); } $abs_dir= Follow_SymLink($abs_dir); unless (defined $abs_dir) { if ($dangling_symlinks) { if (ref $dangling_symlinks eq 'CODE') { $dangling_symlinks->($top_item, $cwd); } else { warnings::warnif "$top_item is a dangling symbolic link\n"; } } next Proc_Top_Item; } if (-d _) { $top_item =~ s/\.dir\z//i if $Is_VMS; _find_dir_symlnk($wanted, $abs_dir, $top_item); $Is_Dir= 1; } } else { # no follow $topdir = $top_item; unless (defined $topnlink) { warnings::warnif "Can't stat $top_item: $!\n"; next Proc_Top_Item; } if (-d _) { $top_item =~ s/\.dir\z//i if $Is_VMS; _find_dir($wanted, $top_item, $topnlink); $Is_Dir= 1; } else { $abs_dir= $top_item; } } unless ($Is_Dir) { unless (($_,$dir) = File::Basename::fileparse($abs_dir)) { ($dir,$_) = ('./', $top_item); } $abs_dir = $dir; if (( $untaint ) && (is_tainted($dir) )) { ( $abs_dir ) = $dir =~ m|$untaint_pat|; unless (defined $abs_dir) { if ($untaint_skip == 0) { die "directory $dir is still tainted"; } else { next Proc_Top_Item; } } } unless ($no_chdir || chdir $abs_dir) { warnings::warnif "Couldn't chdir $abs_dir: $!\n"; next Proc_Top_Item; } $name = $abs_dir . $_; # $File::Find::name $_ = $name if $no_chdir; { $wanted_callback->() }; # protect against wild "next" } unless ( $no_chdir ) { if ( ($check_t_cwd) && (($untaint) && (is_tainted($cwd) )) ) { ( $cwd_untainted ) = $cwd =~ m|$untaint_pat|; unless (defined $cwd_untainted) { die "insecure cwd in find(depth)"; } $check_t_cwd = 0; } unless (chdir $cwd_untainted) { die "Can't cd to $cwd: $!\n"; } } } } # API: # $wanted # $p_dir : "parent directory" # $nlink : what came back from the stat # preconditions: # chdir (if not no_chdir) to dir sub _find_dir($$$) { my ($wanted, $p_dir, $nlink) = @_; my ($CdLvl,$Level) = (0,0); my @Stack; my @filenames; my ($subcount,$sub_nlink); my $SE= []; my $dir_name= $p_dir; my $dir_pref; my $dir_rel = $File::Find::current_dir; my $tainted = 0; my $no_nlink; if ($Is_VMS) { # VMS is returning trailing .dir on directories # and trailing . on files and symbolic links # in UNIX syntax. # $p_dir =~ s/\.(dir)?$//i unless $p_dir eq '.'; $dir_pref = ($p_dir =~ m/[\]>]+$/ ? $p_dir : "$p_dir/" ); } else { $dir_pref = _is_root($p_dir) ? $p_dir : "$p_dir/"; } local ($dir, $name, $prune); unless ( $no_chdir || ($p_dir eq $File::Find::current_dir)) { my $udir = $p_dir; if (( $untaint ) && (is_tainted($p_dir) )) { ( $udir ) = $p_dir =~ m|$untaint_pat|; unless (defined $udir) { if ($untaint_skip == 0) { die "directory $p_dir is still tainted"; } else { return; } } } unless (chdir ($Is_VMS && $udir !~ /[\/\[<]+/ ? "./$udir" : $udir)) { warnings::warnif "Can't cd to $udir: $!\n"; return; } } # push the starting directory push @Stack,[$CdLvl,$p_dir,$dir_rel,-1] if $bydepth; while (defined $SE) { unless ($bydepth) { $dir= $p_dir; # $File::Find::dir $name= $dir_name; # $File::Find::name $_= ($no_chdir ? $dir_name : $dir_rel ); # $_ # prune may happen here $prune= 0; { $wanted_callback->() }; # protect against wild "next" next if $prune; } # change to that directory unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { my $udir= $dir_rel; if ( ($untaint) && (($tainted) || ($tainted = is_tainted($dir_rel) )) ) { ( $udir ) = $dir_rel =~ m|$untaint_pat|; unless (defined $udir) { if ($untaint_skip == 0) { die "directory (" . ($p_dir ne '/' ? $p_dir : '') . "/) $dir_rel is still tainted"; } else { # $untaint_skip == 1 next; } } } unless (chdir ($Is_VMS && $udir !~ /[\/\[<]+/ ? "./$udir" : $udir)) { warnings::warnif "Can't cd to (" . ($p_dir ne '/' ? $p_dir : '') . "/) $udir: $!\n"; next; } $CdLvl++; } $dir= $dir_name; # $File::Find::dir # Get the list of files in the current directory. my $dh; unless (opendir $dh, ($no_chdir ? $dir_name : $File::Find::current_dir)) { warnings::warnif "Can't opendir($dir_name): $!\n"; next; } @filenames = readdir $dh; closedir($dh); @filenames = $pre_process->(@filenames) if $pre_process; push @Stack,[$CdLvl,$dir_name,"",-2] if $post_process; # default: use whatever was specified # (if $nlink >= 2, and $avoid_nlink == 0, this will switch back) $no_nlink = $avoid_nlink; # if dir has wrong nlink count, force switch to slower stat method $no_nlink = 1 if ($nlink < 2); if ($nlink == 2 && !$no_nlink) { # This dir has no subdirectories. for my $FN (@filenames) { if ($Is_VMS) { # Big hammer here - Compensate for VMS trailing . and .dir # No win situation until this is changed, but this # will handle the majority of the cases with breaking the fewest $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); } next if $FN =~ $File::Find::skip_pattern; $name = $dir_pref . $FN; # $File::Find::name $_ = ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } else { # This dir has subdirectories. $subcount = $nlink - 2; # HACK: insert directories at this position, so as to preserve # the user pre-processed ordering of files (thus ensuring # directory traversal is in user sorted order, not at random). my $stack_top = @Stack; for my $FN (@filenames) { next if $FN =~ $File::Find::skip_pattern; if ($subcount > 0 || $no_nlink) { # Seen all the subdirs? # check for directoriness. # stat is faster for a file in the current directory $sub_nlink = (lstat ($no_chdir ? $dir_pref . $FN : $FN))[3]; if (-d _) { --$subcount; $FN =~ s/\.dir\z//i if $Is_VMS; # HACK: replace push to preserve dir traversal order #push @Stack,[$CdLvl,$dir_name,$FN,$sub_nlink]; splice @Stack, $stack_top, 0, [$CdLvl,$dir_name,$FN,$sub_nlink]; } else { $name = $dir_pref . $FN; # $File::Find::name $_= ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } else { $name = $dir_pref . $FN; # $File::Find::name $_= ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } } } continue { while ( defined ($SE = pop @Stack) ) { ($Level, $p_dir, $dir_rel, $nlink) = @$SE; if ($CdLvl > $Level && !$no_chdir) { my $tmp; if ($Is_VMS) { $tmp = '[' . ('-' x ($CdLvl-$Level)) . ']'; } else { $tmp = join('/',('..') x ($CdLvl-$Level)); } die "Can't cd to $tmp from $dir_name: $!" unless chdir ($tmp); $CdLvl = $Level; } if ($^O eq 'VMS') { if ($p_dir =~ m/[\]>]+$/) { $dir_name = $p_dir; $dir_name =~ s/([\]>]+)$/.$dir_rel$1/; $dir_pref = $dir_name; } else { $dir_name = "$p_dir/$dir_rel"; $dir_pref = "$dir_name/"; } } else { $dir_name = _is_root($p_dir) ? "$p_dir$dir_rel" : "$p_dir/$dir_rel"; $dir_pref = "$dir_name/"; } if ( $nlink == -2 ) { $name = $dir = $p_dir; # $File::Find::name / dir $_ = $File::Find::current_dir; $post_process->(); # End-of-directory processing } elsif ( $nlink < 0 ) { # must be finddepth, report dirname now $name = $dir_name; if ( substr($name,-2) eq '/.' ) { substr($name, length($name) == 2 ? -1 : -2) = ''; } $dir = $p_dir; $_ = ($no_chdir ? $dir_name : $dir_rel ); if ( substr($_,-2) eq '/.' ) { substr($_, length($_) == 2 ? -1 : -2) = ''; } { $wanted_callback->() }; # protect against wild "next" } else { push @Stack,[$CdLvl,$p_dir,$dir_rel,-1] if $bydepth; last; } } } } # API: # $wanted # $dir_loc : absolute location of a dir # $p_dir : "parent directory" # preconditions: # chdir (if not no_chdir) to dir sub _find_dir_symlnk($$$) { my ($wanted, $dir_loc, $p_dir) = @_; # $dir_loc is the absolute directory my @Stack; my @filenames; my $new_loc; my $updir_loc = $dir_loc; # untainted parent directory my $SE = []; my $dir_name = $p_dir; my $dir_pref; my $loc_pref; my $dir_rel = $File::Find::current_dir; my $byd_flag; # flag for pending stack entry if $bydepth my $tainted = 0; my $ok = 1; $dir_pref = _is_root($p_dir) ? $p_dir : "$p_dir/"; $loc_pref = _is_root($dir_loc) ? $dir_loc : "$dir_loc/"; local ($dir, $name, $fullname, $prune); unless ($no_chdir) { # untaint the topdir if (( $untaint ) && (is_tainted($dir_loc) )) { ( $updir_loc ) = $dir_loc =~ m|$untaint_pat|; # parent dir, now untainted # once untainted, $updir_loc is pushed on the stack (as parent directory); # hence, we don't need to untaint the parent directory every time we chdir # to it later unless (defined $updir_loc) { if ($untaint_skip == 0) { die "directory $dir_loc is still tainted"; } else { return; } } } $ok = chdir($updir_loc) unless ($p_dir eq $File::Find::current_dir); unless ($ok) { warnings::warnif "Can't cd to $updir_loc: $!\n"; return; } } push @Stack,[$dir_loc,$updir_loc,$p_dir,$dir_rel,-1] if $bydepth; while (defined $SE) { unless ($bydepth) { # change (back) to parent directory (always untainted) unless ($no_chdir) { unless (chdir $updir_loc) { warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } $dir= $p_dir; # $File::Find::dir $name= $dir_name; # $File::Find::name $_= ($no_chdir ? $dir_name : $dir_rel ); # $_ $fullname= $dir_loc; # $File::Find::fullname # prune may happen here $prune= 0; lstat($_); # make sure file tests with '_' work { $wanted_callback->() }; # protect against wild "next" next if $prune; } # change to that directory unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { $updir_loc = $dir_loc; if ( ($untaint) && (($tainted) || ($tainted = is_tainted($dir_loc) )) ) { # untaint $dir_loc, what will be pushed on the stack as (untainted) parent dir ( $updir_loc ) = $dir_loc =~ m|$untaint_pat|; unless (defined $updir_loc) { if ($untaint_skip == 0) { die "directory $dir_loc is still tainted"; } else { next; } } } unless (chdir $updir_loc) { warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } $dir = $dir_name; # $File::Find::dir # Get the list of files in the current directory. my $dh; unless (opendir $dh, ($no_chdir ? $dir_loc : $File::Find::current_dir)) { warnings::warnif "Can't opendir($dir_loc): $!\n"; next; } @filenames = readdir $dh; closedir($dh); for my $FN (@filenames) { if ($Is_VMS) { # Big hammer here - Compensate for VMS trailing . and .dir # No win situation until this is changed, but this # will handle the majority of the cases with breaking the fewest. $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); } next if $FN =~ $File::Find::skip_pattern; # follow symbolic links / do an lstat $new_loc = Follow_SymLink($loc_pref.$FN); # ignore if invalid symlink unless (defined $new_loc) { if (!defined -l _ && $dangling_symlinks) { $fullname = undef; if (ref $dangling_symlinks eq 'CODE') { $dangling_symlinks->($FN, $dir_pref); } else { warnings::warnif "$dir_pref$FN is a dangling symbolic link\n"; } } else { $fullname = $loc_pref . $FN; } $name = $dir_pref . $FN; $_ = ($no_chdir ? $name : $FN); { $wanted_callback->() }; next; } if (-d _) { if ($Is_VMS) { $FN =~ s/\.dir\z//i; $FN =~ s#\.$## if ($FN ne '.'); $new_loc =~ s/\.dir\z//i; $new_loc =~ s#\.$## if ($new_loc ne '.'); } push @Stack,[$new_loc,$updir_loc,$dir_name,$FN,1]; } else { $fullname = $new_loc; # $File::Find::fullname $name = $dir_pref . $FN; # $File::Find::name $_ = ($no_chdir ? $name : $FN); # $_ { $wanted_callback->() }; # protect against wild "next" } } } continue { while (defined($SE = pop @Stack)) { ($dir_loc, $updir_loc, $p_dir, $dir_rel, $byd_flag) = @$SE; $dir_name = _is_root($p_dir) ? "$p_dir$dir_rel" : "$p_dir/$dir_rel"; $dir_pref = "$dir_name/"; $loc_pref = "$dir_loc/"; if ( $byd_flag < 0 ) { # must be finddepth, report dirname now unless ($no_chdir || ($dir_rel eq $File::Find::current_dir)) { unless (chdir $updir_loc) { # $updir_loc (parent dir) is always untainted warnings::warnif "Can't cd to $updir_loc: $!\n"; next; } } $fullname = $dir_loc; # $File::Find::fullname $name = $dir_name; # $File::Find::name if ( substr($name,-2) eq '/.' ) { substr($name, length($name) == 2 ? -1 : -2) = ''; # $File::Find::name } $dir = $p_dir; # $File::Find::dir $_ = ($no_chdir ? $dir_name : $dir_rel); # $_ if ( substr($_,-2) eq '/.' ) { substr($_, length($_) == 2 ? -1 : -2) = ''; } lstat($_); # make sure file tests with '_' work { $wanted_callback->() }; # protect against wild "next" } else { push @Stack,[$dir_loc, $updir_loc, $p_dir, $dir_rel,-1] if $bydepth; last; } } } } sub wrap_wanted { my $wanted = shift; if ( ref($wanted) eq 'HASH' ) { # RT #122547 my %valid_options = map {$_ => 1} qw( wanted bydepth preprocess postprocess follow follow_fast follow_skip dangling_symlinks no_chdir untaint untaint_pattern untaint_skip ); my @invalid_options = (); for my $v (keys %{$wanted}) { push @invalid_options, $v unless exists $valid_options{$v}; } warn "Invalid option(s): @invalid_options" if @invalid_options; unless( exists $wanted->{wanted} and ref( $wanted->{wanted} ) eq 'CODE' ) { die 'no &wanted subroutine given'; } if ( $wanted->{follow} || $wanted->{follow_fast}) { $wanted->{follow_skip} = 1 unless defined $wanted->{follow_skip}; } if ( $wanted->{untaint} ) { $wanted->{untaint_pattern} = $File::Find::untaint_pattern unless defined $wanted->{untaint_pattern}; $wanted->{untaint_skip} = 0 unless defined $wanted->{untaint_skip}; } return $wanted; } elsif( ref( $wanted ) eq 'CODE' ) { return { wanted => $wanted }; } else { die 'no &wanted subroutine given'; } } sub find { my $wanted = shift; _find_opt(wrap_wanted($wanted), @_); } sub finddepth { my $wanted = wrap_wanted(shift); $wanted->{bydepth} = 1; _find_opt($wanted, @_); } # default $File::Find::skip_pattern = qr/^\.{1,2}\z/; $File::Find::untaint_pattern = qr|^([-+@\w./]+)$|; # this _should_ work properly on all platforms # where File::Find can be expected to work $File::Find::current_dir = File::Spec->curdir || '.'; $File::Find::dont_use_nlink = 1; # We need a function that checks if a scalar is tainted. Either use the # Scalar::Util module's tainted() function or our (slower) pure Perl # fallback is_tainted_pp() { local $@; eval { require Scalar::Util }; *is_tainted = $@ ? \&is_tainted_pp : \&Scalar::Util::tainted; } 1; __END__ =head1 NAME File::Find - Traverse a directory tree. =head1 SYNOPSIS use File::Find; find(\&wanted, @directories_to_search); sub wanted { ... } use File::Find; finddepth(\&wanted, @directories_to_search); sub wanted { ... } use File::Find; find({ wanted => \&process, follow => 1 }, '.'); =head1 DESCRIPTION These are functions for searching through directory trees doing work on each file found similar to the Unix L command. C exports two functions, C and C. They work similarly but have subtle differences. =over 4 =item B find(\&wanted, @directories); find(\%options, @directories); C does a depth-first search over the given C<@directories> in the order they are given. For each file or directory found, it calls the C<&wanted> subroutine. (See below for details on how to use the C<&wanted> function). Additionally, for each directory found, it will C into that directory and continue the search, invoking the C<&wanted> function on each file or subdirectory in the directory. =item B finddepth(\&wanted, @directories); finddepth(\%options, @directories); C works just like C except that it invokes the C<&wanted> function for a directory I invoking it for the directory's contents. It does a postorder traversal instead of a preorder traversal, working from the bottom of the directory tree up where C works from the top of the tree down. =back Despite the name of the C function, both C and C perform a depth-first search of the directory hierarchy. =head2 C<%options> The first argument to C is either a code reference to your C<&wanted> function, or a hash reference describing the operations to be performed for each file. The code reference is described in L below. Here are the possible B for the hash: =over 4 =item C The value should be a code reference. This code reference is described in L below. The C<&wanted> subroutine is mandatory. =item C Reports the name of a directory only AFTER all its entries have been reported. Entry point C is a shortcut for specifying C<< { bydepth => 1 } >> in the first argument of C. =item C The value should be a code reference. This code reference is used to preprocess the current directory. The name of the currently processed directory is in C<$File::Find::dir>. Your preprocessing function is called after C, but before the loop that calls the C function. It is called with a list of strings (actually file/directory names) and is expected to return a list of strings. The code can be used to sort the file/directory names alphabetically, numerically, or to filter out directory entries based on their name alone. When C or C are in effect, C is a no-op. =item C The value should be a code reference. It is invoked just before leaving the currently processed directory. It is called in void context with no arguments. The name of the current directory is in C<$File::Find::dir>. This hook is handy for summarizing a directory, such as calculating its disk usage. When C or C are in effect, C is a no-op. =item C Causes symbolic links to be followed. Since directory trees with symbolic links (followed) may contain files more than once and may even have cycles, a hash has to be built up with an entry for each file. This might be expensive both in space and time for a large directory tree. See L and L below. If either C or C is in effect: =over 4 =item * It is guaranteed that an C has been called before the user's C function is called. This enables fast file checks involving C<_>. Note that this guarantee no longer holds if C or C are not set. =item * There is a variable C<$File::Find::fullname> which holds the absolute pathname of the file with all symbolic links resolved. If the link is a dangling symbolic link, then fullname will be set to C. =back =item C This is similar to C except that it may report some files more than once. It does detect cycles, however. Since only symbolic links have to be hashed, this is much cheaper both in space and time. If processing a file more than once (by the user's C function) is worse than just taking time, the option C should be used. =item C C, which is the default, causes all files which are neither directories nor symbolic links to be ignored if they are about to be processed a second time. If a directory or a symbolic link are about to be processed a second time, C dies. C causes C to die if any file is about to be processed a second time. C causes C to ignore any duplicate files and directories but to proceed normally otherwise. =item C Specifies what to do with symbolic links whose target doesn't exist. If true and a code reference, will be called with the symbolic link name and the directory it lives in as arguments. Otherwise, if true and warnings are on, a warning of the form C<"symbolic_link_name is a dangling symbolic link\n"> will be issued. If false, the dangling symbolic link will be silently ignored. =item C Does not C to each directory as it recurses. The C function will need to be aware of this, of course. In this case, C<$_> will be the same as C<$File::Find::name>. =item C If find is used in L (C<-T> command line switch or C or C), then internally directory names have to be untainted before they can be C'd to. Therefore they are checked against a regular expression C. Note that all names passed to the user's C function are still tainted. If this option is used while not in taint-mode, C is a no-op. =item C See above. This should be set using the C quoting operator. The default is set to C. Note that the parentheses are vital. =item C If set, a directory which fails the C is skipped, including all its sub-directories. The default is to C in such a case. =back =head2 The wanted function The C function does whatever verifications you want on each file and directory. Note that despite its name, the C function is a generic callback function, and does B tell C if a file is "wanted" or not. In fact, its return value is ignored. The C function takes no arguments but rather does its work through a collection of variables. =over 4 =item C<$File::Find::dir> is the current directory name, =item C<$_> is the current filename within that directory =item C<$File::Find::name> is the complete pathname to the file. =back The above variables have all been localized and may be changed without affecting data outside of the wanted function. For example, when examining the file F you will have: $File::Find::dir = /some/path/ $_ = foo.ext $File::Find::name = /some/path/foo.ext You are C'd to C<$File::Find::dir> when the function is called, unless C was specified. Note that when changing to directories is in effect, the root directory (F) is a somewhat special case inasmuch as the concatenation of C<$File::Find::dir>, C<'/'> and C<$_> is not literally equal to C<$File::Find::name>. The table below summarizes all variants: $File::Find::name $File::Find::dir $_ default / / . no_chdir=>0 /etc / etc /etc/x /etc x no_chdir=>1 / / / /etc / /etc /etc/x /etc /etc/x When C or C are in effect, there is also a C<$File::Find::fullname>. The function may set C<$File::Find::prune> to prune the tree unless C was specified. Unless C or C is specified, for compatibility reasons (C, L) there are in addition the following globals available: C<$File::Find::topdir>, C<$File::Find::topdev>, C<$File::Find::topino>, C<$File::Find::topmode> and C<$File::Find::topnlink>. This library is useful for the C tool (distributed with the L CPAN module), which when fed: find2perl / -name .nfs\* -mtime +7 \ -exec rm -f {} \; -o -fstype nfs -prune produces something like: sub wanted { /^\.nfs.*\z/s && (($dev, $ino, $mode, $nlink, $uid, $gid) = lstat($_)) && int(-M _) > 7 && unlink($_) || ($nlink || (($dev, $ino, $mode, $nlink, $uid, $gid) = lstat($_))) && $dev < 0 && ($File::Find::prune = 1); } Notice the C<_> in the above C: the C<_> is a magical filehandle that caches the information from the preceding C, C, or filetest. Here's another interesting wanted function. It will find all symbolic links that don't resolve: sub wanted { -l && !-e && print "bogus link: $File::Find::name\n"; } Note that you may mix directories and (non-directory) files in the list of directories to be searched by the C function. find(\&wanted, "./foo", "./bar", "./baz/epsilon"); In the example above, no file in F<./baz/> other than F<./baz/epsilon> will be evaluated by C. See also the script C on CPAN for a nice application of this module. =head1 WARNINGS If you run your program with the C<-w> switch, or if you use the C pragma, File::Find will report warnings for several weird situations. You can disable these warnings by putting the statement no warnings 'File::Find'; in the appropriate scope. See L for more info about lexical warnings. =head1 BUGS AND CAVEATS =over 4 =item C<$dont_use_nlink> You can set the variable C<$File::Find::dont_use_nlink> to C<0> if you are sure the filesystem you are scanning reflects the number of subdirectories in the parent directory's C count. If you do set C<$File::Find::dont_use_nlink> to 0, you may notice an improvement in speed at the risk of not recursing into subdirectories if a filesystem doesn't populate C as expected. C<$File::Find::dont_use_nlink> now defaults to 1 on all platforms. =item Symlinks Be aware that the option to follow symbolic links can be dangerous. Depending on the structure of the directory tree (including symbolic links to directories) you might traverse a given (physical) directory more than once (only if C is in effect). Furthermore, deleting or changing files in a symbolically linked directory might cause very unpleasant surprises, since you delete or change files in an unknown directory. =back =head1 HISTORY C used to produce incorrect results if called recursively. During the development of perl 5.8 this bug was fixed. The first fixed version of C was 1.01. =head1 SEE ALSO L, L =cut FILEcbb56b69/File/Copy.pm?0# File/Copy.pm. Written in 1994 by Aaron Sherman . This # source code has been placed in the public domain by the author. # Please be kind and preserve the documentation. # # Additions copyright 1996 by Charles Bailey. Permission is granted # to distribute the revised code under the same terms as Perl itself. package File::Copy; use 5.035007; use strict; use warnings; no warnings 'newline'; no warnings 'experimental::builtin'; use builtin 'blessed'; use overload; use File::Spec; use Config; # We want HiRes stat and utime if available BEGIN { eval q{ use Time::HiRes qw( stat utime ) } }; our(@ISA, @EXPORT, @EXPORT_OK, $VERSION, $Too_Big, $Syscopy_is_copy); sub copy; sub syscopy; sub cp; sub mv; $VERSION = '2.41'; require Exporter; @ISA = qw(Exporter); @EXPORT = qw(copy move); @EXPORT_OK = qw(cp mv); $Too_Big = 1024 * 1024 * 2; sub croak { require Carp; goto &Carp::croak; } sub carp { require Carp; goto &Carp::carp; } sub _catname { my($from, $to) = @_; if (not defined &basename) { require File::Basename; File::Basename->import( 'basename' ); } return File::Spec->catfile($to, basename($from)); } # _eq($from, $to) tells whether $from and $to are identical sub _eq { my ($from, $to) = map { blessed($_) && overload::Method($_, q{""}) ? "$_" : $_ } (@_); return '' if ( (ref $from) xor (ref $to) ); return $from == $to if ref $from; return $from eq $to; } sub copy { croak("Usage: copy(FROM, TO [, BUFFERSIZE]) ") unless(@_ == 2 || @_ == 3); my $from = shift; my $to = shift; my $size; if (@_) { $size = shift(@_) + 0; croak("Bad buffer size for copy: $size\n") unless ($size > 0); } my $from_a_handle = (ref($from) ? (ref($from) eq 'GLOB' || UNIVERSAL::isa($from, 'GLOB') || UNIVERSAL::isa($from, 'IO::Handle')) : (ref(\$from) eq 'GLOB')); my $to_a_handle = (ref($to) ? (ref($to) eq 'GLOB' || UNIVERSAL::isa($to, 'GLOB') || UNIVERSAL::isa($to, 'IO::Handle')) : (ref(\$to) eq 'GLOB')); if (_eq($from, $to)) { # works for references, too carp("'$from' and '$to' are identical (not copied)"); return 0; } if (!$from_a_handle && !$to_a_handle && -d $to && ! -d $from) { $to = _catname($from, $to); } if ((($Config{d_symlink} && $Config{d_readlink}) || $Config{d_link}) && !($^O eq 'os2')) { my @fs = stat($from); if (@fs) { my @ts = stat($to); if (@ts && $fs[0] == $ts[0] && $fs[1] eq $ts[1] && !-p $from) { carp("'$from' and '$to' are identical (not copied)"); return 0; } } } elsif (_eq($from, $to)) { carp("'$from' and '$to' are identical (not copied)"); return 0; } if (defined &syscopy && !$Syscopy_is_copy && !$to_a_handle && !($from_a_handle && $^O eq 'os2' ) # OS/2 cannot handle handles && !($from_a_handle && $^O eq 'MSWin32') ) { if ($^O eq 'VMS' && -e $from && ! -d $to && ! -d $from) { # VMS natively inherits path components from the source of a # copy, but we want the Unixy behavior of inheriting from # the current working directory. Also, default in a trailing # dot for null file types. $to = VMS::Filespec::rmsexpand(VMS::Filespec::vmsify($to), '.'); # Get rid of the old versions to be like UNIX 1 while unlink $to; } return syscopy($from, $to) || 0; } my $closefrom = 0; my $closeto = 0; my ($status, $r, $buf); local($\) = ''; my $from_h; if ($from_a_handle) { $from_h = $from; } else { open $from_h, "<", $from or goto fail_open1; binmode $from_h or die "($!,$^E)"; $closefrom = 1; } # Seems most logical to do this here, in case future changes would want to # make this croak for some reason. unless (defined $size) { $size = tied(*$from_h) ? 0 : -s $from_h || 0; $size = 1024 if ($size < 512); $size = $Too_Big if ($size > $Too_Big); } my $to_h; if ($to_a_handle) { $to_h = $to; } else { $to_h = \do { local *FH }; # XXX is this line obsolete? open $to_h, ">", $to or goto fail_open2; binmode $to_h or die "($!,$^E)"; $closeto = 1; } $! = 0; for (;;) { my ($r, $w, $t); defined($r = sysread($from_h, $buf, $size)) or goto fail_inner; last unless $r; for ($w = 0; $w < $r; $w += $t) { $t = syswrite($to_h, $buf, $r - $w, $w) or goto fail_inner; } } close($to_h) || goto fail_open2 if $closeto; close($from_h) || goto fail_open1 if $closefrom; # Use this idiom to avoid uninitialized value warning. return 1; # All of these contortions try to preserve error messages... fail_inner: if ($closeto) { $status = $!; $! = 0; close $to_h; $! = $status unless $!; } fail_open2: if ($closefrom) { $status = $!; $! = 0; close $from_h; $! = $status unless $!; } fail_open1: return 0; } sub cp { my($from,$to) = @_; my(@fromstat) = stat $from; my(@tostat) = stat $to; my $perm; return 0 unless copy(@_) and @fromstat; if (@tostat) { $perm = $tostat[2]; } else { $perm = $fromstat[2] & ~(umask || 0); @tostat = stat $to; } # Might be more robust to look for S_I* in Fcntl, but we're # trying to avoid dependence on any XS-containing modules, # since File::Copy is used during the Perl build. $perm &= 07777; if ($perm & 06000) { croak("Unable to check setuid/setgid permissions for $to: $!") unless @tostat; if ($perm & 04000 and # setuid $fromstat[4] != $tostat[4]) { # owner must match $perm &= ~06000; } if ($perm & 02000 && $> != 0) { # if not root, setgid my $ok = $fromstat[5] == $tostat[5]; # group must match if ($ok) { # and we must be in group $ok = grep { $_ == $fromstat[5] } split /\s+/, $) } $perm &= ~06000 unless $ok; } } return 0 unless @tostat; return 1 if $perm == ($tostat[2] & 07777); return eval { chmod $perm, $to; } ? 1 : 0; } sub _move { croak("Usage: move(FROM, TO) ") unless @_ == 3; my($from,$to,$fallback) = @_; my($fromsz,$tosz1,$tomt1,$tosz2,$tomt2,$sts,$ossts); if (-d $to && ! -d $from) { $to = _catname($from, $to); } ($tosz1,$tomt1) = (stat($to))[7,9]; $fromsz = -s $from; if ($^O eq 'os2' and defined $tosz1 and defined $fromsz) { # will not rename with overwrite unlink $to; } if ($^O eq 'VMS' && -e $from && ! -d $to && ! -d $from) { # VMS natively inherits path components from the source of a # copy, but we want the Unixy behavior of inheriting from # the current working directory. Also, default in a trailing # dot for null file types. $to = VMS::Filespec::rmsexpand(VMS::Filespec::vmsify($to), '.'); # Get rid of the old versions to be like UNIX 1 while unlink $to; } return 1 if rename $from, $to; # Did rename return an error even though it succeeded, because $to # is on a remote NFS file system, and NFS lost the server's ack? return 1 if defined($fromsz) && !-e $from && # $from disappeared (($tosz2,$tomt2) = (stat($to))[7,9]) && # $to's there ((!defined $tosz1) || # not before or ($tosz1 != $tosz2 or $tomt1 != $tomt2)) && # was changed $tosz2 == $fromsz; # it's all there ($tosz1,$tomt1) = (stat($to))[7,9]; # just in case rename did something { local $@; eval { local $SIG{__DIE__}; $fallback->($from,$to) or die; my($atime, $mtime) = (stat($from))[8,9]; utime($atime, $mtime, $to); unlink($from) or die; }; return 1 unless $@; } ($sts,$ossts) = ($! + 0, $^E + 0); ($tosz2,$tomt2) = ((stat($to))[7,9],0,0) if defined $tomt1; unlink($to) if !defined($tomt1) or $tomt1 != $tomt2 or $tosz1 != $tosz2; ($!,$^E) = ($sts,$ossts); return 0; } sub move { _move(@_,\©); } sub mv { _move(@_,\&cp); } # &syscopy is an XSUB under OS/2 unless (defined &syscopy) { if ($^O eq 'VMS') { *syscopy = \&rmscopy; } elsif ($^O eq 'MSWin32' && defined &DynaLoader::boot_DynaLoader) { # Win32::CopyFile() fill only work if we can load Win32.xs *syscopy = sub { return 0 unless @_ == 2; return Win32::CopyFile(@_, 1); }; } else { $Syscopy_is_copy = 1; *syscopy = \© } } 1; __END__ =head1 NAME File::Copy - Copy files or filehandles =head1 SYNOPSIS use File::Copy; copy("sourcefile", "destinationfile") or die "Copy failed: $!"; copy("Copy.pm", \*STDOUT); move("/dev1/sourcefile", "/dev2/destinationfile"); use File::Copy "cp"; my $n = FileHandle->new("/a/file", "r"); cp($n, "x"); =head1 DESCRIPTION The File::Copy module provides two basic functions, C and C, which are useful for getting the contents of a file from one place to another. =over 4 =item copy X X The C function takes two parameters: a file to copy from and a file to copy to. Either argument may be a string, a FileHandle reference or a FileHandle glob. Obviously, if the first argument is a filehandle of some sort, it will be read from, and if it is a file I it will be opened for reading. Likewise, the second argument will be written to. If the second argument does not exist but the parent directory does exist, then it will be created. Trying to copy a file into a non-existent directory is an error. Trying to copy a file on top of itself is also an error. C will not overwrite read-only files. If the destination (second argument) already exists and is a directory, and the source (first argument) is not a filehandle, then the source file will be copied into the directory specified by the destination, using the same base name as the source file. It's a failure to have a filehandle as the source when the destination is a directory. B Files are opened in binary mode where applicable. To get a consistent behaviour when copying from a filehandle to a file, use C on the filehandle. An optional third parameter can be used to specify the buffer size used for copying. This is the number of bytes from the first file, that will be held in memory at any given time, before being written to the second file. The default buffer size depends upon the file, but will generally be the whole file (up to 2MB), or 1k for filehandles that do not reference files (eg. sockets). You may use the syntax C to get at the C alias for this function. The syntax is I the same. The behavior is nearly the same as well: as of version 2.15, C will preserve the source file's permission bits like the shell utility C would do with default options, while C uses the default permissions for the target file (which may depend on the process' C, file ownership, inherited ACLs, etc.). That is, if the destination file already exists, C will leave its permissions unchanged; otherwise the permissions are taken from the source file and modified by the C. If an error occurs in setting permissions, C will return 0, regardless of whether the file was successfully copied. =item move X X X The C function also takes two parameters: the current name and the intended name of the file to be moved. If the destination already exists and is a directory, and the source is not a directory, then the source file will be renamed into the directory specified by the destination. If possible, move() will simply rename the file. Otherwise, it copies the file to the new location and deletes the original. If an error occurs during this copy-and-delete process, you may be left with a (possibly partial) copy of the file under the destination name. You may use the C alias for this function in the same way that you may use the C alias for C. =item syscopy X File::Copy also provides the C routine, which copies the file specified in the first parameter to the file specified in the second parameter, preserving OS-specific attributes and file structure. For Unix systems, this is equivalent to the simple C routine, which doesn't preserve OS-specific attributes. For VMS systems, this calls the C routine (see below). For OS/2 systems, this calls the C XSUB directly. For Win32 systems, this calls C. B is defined (OS/2, VMS and Win32)>: If both arguments to C are not file handles, then C will perform a "system copy" of the input file to a new output file, in order to preserve file attributes, indexed file structure, I The buffer size parameter is ignored. If either argument to C is a handle to an opened file, then data is copied using Perl operators, and no effort is made to preserve file attributes or record structure. The system copy routine may also be called directly under VMS and OS/2 as C (or under VMS as C, which is the routine that does the actual work for syscopy). =item rmscopy($from,$to[,$date_flag]) X The first and second arguments may be strings, typeglobs, typeglob references, or objects inheriting from IO::Handle; they are used in all cases to obtain the I of the input and output files, respectively. The name and type of the input file are used as defaults for the output file, if necessary. A new version of the output file is always created, which inherits the structure and RMS attributes of the input file, except for owner and protections (and possibly timestamps; see below). All data from the input file is copied to the output file; if either of the first two parameters to C is a file handle, its position is unchanged. (Note that this means a file handle pointing to the output file will be associated with an old version of that file after C returns, not the newly created version.) The third parameter is an integer flag, which tells C how to handle timestamps. If it is E 0, none of the input file's timestamps are propagated to the output file. If it is E 0, then it is interpreted as a bitmask: if bit 0 (the LSB) is set, then timestamps other than the revision date are propagated; if bit 1 is set, the revision date is propagated. If the third parameter to C is 0, then it behaves much like the DCL COPY command: if the name or type of the output file was explicitly specified, then no timestamps are propagated, but if they were taken implicitly from the input filespec, then all timestamps other than the revision date are propagated. If this parameter is not supplied, it defaults to 0. C is VMS specific and cannot be exported; it must be referenced by its full name, e.g.: File::Copy::rmscopy($from, $to) or die $!; Like C, C returns 1 on success. If an error occurs, it sets C<$!>, deletes the output file, and returns 0. =back =head1 RETURN All functions return 1 on success, 0 on failure. $! will be set if an error was encountered. =head1 NOTES Before calling copy() or move() on a filehandle, the caller should close or flush() the file to avoid writes being lost. Note that this is the case even for move(), because it may actually copy the file, depending on the OS-specific implementation, and the underlying filesystem(s). =head1 AUTHOR File::Copy was written by Aaron Sherman Iajs@ajs.comE> in 1995, and updated by Charles Bailey Ibailey@newman.upenn.eduE> in 1996. =cut FILE75585812/File/Basename.pm+=head1 NAME File::Basename - Parse file paths into directory, filename and suffix. =head1 SYNOPSIS use File::Basename; my ($name, $path, $suffix) = fileparse($fullname, @suffixlist); my $name = fileparse($fullname, @suffixlist); my $basename = basename($fullname, @suffixlist); my $dirname = dirname($fullname); =head1 DESCRIPTION These routines allow you to parse file paths into their directory, filename and suffix. B: C and C emulate the behaviours, and quirks, of the shell and C functions of the same name. See each function's documentation for details. If your concern is just parsing paths it is safer to use L's C and C methods. It is guaranteed that # Where $path_separator is / for Unix, \ for Windows, etc... dirname($path) . $path_separator . basename($path); is equivalent to the original path for all systems but VMS. =cut package File::Basename; # File::Basename is used during the Perl build, when the re extension may # not be available, but we only actually need it if running under tainting. BEGIN { if (${^TAINT}) { require re; re->import('taint'); } } use strict; use 5.006; use warnings; our(@ISA, @EXPORT, $VERSION, $Fileparse_fstype, $Fileparse_igncase); require Exporter; @ISA = qw(Exporter); @EXPORT = qw(fileparse fileparse_set_fstype basename dirname); $VERSION = "2.86"; fileparse_set_fstype($^O); =over 4 =item C X my($filename, $dirs, $suffix) = fileparse($path); my($filename, $dirs, $suffix) = fileparse($path, @suffixes); my $filename = fileparse($path, @suffixes); The C routine divides a file path into its $dirs, $filename and (optionally) the filename $suffix. $dirs contains everything up to and including the last directory separator in the $path including the volume (if applicable). The remainder of the $path is the $filename. # On Unix returns ("baz", "/foo/bar/", "") fileparse("/foo/bar/baz"); # On Windows returns ("baz", 'C:\foo\bar\', "") fileparse('C:\foo\bar\baz'); # On Unix returns ("", "/foo/bar/baz/", "") fileparse("/foo/bar/baz/"); If @suffixes are given each element is a pattern (either a string or a C) matched against the end of the $filename. The matching portion is removed and becomes the $suffix. # On Unix returns ("baz", "/foo/bar/", ".txt") fileparse("/foo/bar/baz.txt", qr/\.[^.]*/); If type is non-Unix (see L) then the pattern matching for suffix removal is performed case-insensitively, since those systems are not case-sensitive when opening existing files. You are guaranteed that C<$dirs . $filename . $suffix> will denote the same location as the original $path. =cut sub fileparse { my($fullname,@suffices) = @_; unless (defined $fullname) { require Carp; Carp::croak("fileparse(): need a valid pathname"); } my $orig_type = ''; my($type,$igncase) = ($Fileparse_fstype, $Fileparse_igncase); my($taint) = substr($fullname,0,0); # Is $fullname tainted? if ($type eq "VMS" and $fullname =~ m{/} ) { # We're doing Unix emulation $orig_type = $type; $type = 'Unix'; } my($dirpath, $basename); if (grep { $type eq $_ } qw(MSDOS DOS MSWin32 Epoc)) { ($dirpath,$basename) = ($fullname =~ /^((?:.*[:\\\/])?)(.*)/s); $dirpath .= '.\\' unless $dirpath =~ /[\\\/]\z/; } elsif ($type eq "OS2") { ($dirpath,$basename) = ($fullname =~ m#^((?:.*[:\\/])?)(.*)#s); $dirpath = './' unless $dirpath; # Can't be 0 $dirpath .= '/' unless $dirpath =~ m#[\\/]\z#; } elsif ($type eq "MacOS") { ($dirpath,$basename) = ($fullname =~ /^(.*:)?(.*)/s); $dirpath = ':' unless $dirpath; } elsif ($type eq "AmigaOS") { ($dirpath,$basename) = ($fullname =~ /(.*[:\/])?(.*)/s); $dirpath = './' unless $dirpath; } elsif ($type eq 'VMS' ) { ($dirpath,$basename) = ($fullname =~ /^(.*[:>\]])?(.*)/s); $dirpath ||= ''; # should always be defined } else { # Default to Unix semantics. ($dirpath,$basename) = ($fullname =~ m{^(.*/)?(.*)}s); if ($orig_type eq 'VMS' and $fullname =~ m{^(/[^/]+/000000(/|$))(.*)}) { # dev:[000000] is top of VMS tree, similar to Unix '/' # so strip it off and treat the rest as "normal" my $devspec = $1; my $remainder = $3; ($dirpath,$basename) = ($remainder =~ m{^(.*/)?(.*)}s); $dirpath ||= ''; # should always be defined $dirpath = $devspec.$dirpath; } $dirpath = './' unless $dirpath; } my $tail = ''; my $suffix = ''; if (@suffices) { foreach $suffix (@suffices) { my $pat = ($igncase ? '(?i)' : '') . "($suffix)\$"; if ($basename =~ s/$pat//s) { $taint .= substr($suffix,0,0); $tail = $1 . $tail; } } } # Ensure taint is propagated from the path to its pieces. $tail .= $taint; wantarray ? ($basename .= $taint, $dirpath .= $taint, $tail) : ($basename .= $taint); } =item C X X my $filename = basename($path); my $filename = basename($path, @suffixes); This function is provided for compatibility with the Unix shell command C. It does B always return the file name portion of a path as you might expect. To be safe, if you want the file name portion of a path use C. C returns the last level of a filepath even if the last level is clearly directory. In effect, it is acting like C for paths. This differs from C's behaviour. # Both return "bar" basename("/foo/bar"); basename("/foo/bar/"); @suffixes work as in C except all regex metacharacters are quoted. # These two function calls are equivalent. my $filename = basename("/foo/bar/baz.txt", ".txt"); my $filename = fileparse("/foo/bar/baz.txt", qr/\Q.txt\E/); Also note that in order to be compatible with the shell command, C does not strip off a suffix if it is identical to the remaining characters in the filename. =cut sub basename { my($path) = shift; # From BSD basename(1) # The basename utility deletes any prefix ending with the last slash '/' # character present in string (after first stripping trailing slashes) _strip_trailing_sep($path); my($basename, $dirname, $suffix) = fileparse( $path, map("\Q$_\E",@_) ); # From BSD basename(1) # The suffix is not stripped if it is identical to the remaining # characters in string. if( length $suffix and !length $basename ) { $basename = $suffix; } # Ensure that basename '/' == '/' if( !length $basename ) { $basename = $dirname; } return $basename; } =item C X This function is provided for compatibility with the Unix shell command C and has inherited some of its quirks. In spite of its name it does B always return the directory name as you might expect. To be safe, if you want the directory name of a path use C. Only on VMS (where there is no ambiguity between the file and directory portions of a path) and AmigaOS (possibly due to an implementation quirk in this module) does C work like C, returning just the $dirs. # On VMS and AmigaOS my $dirs = dirname($path); When using Unix or MSDOS syntax this emulates the C shell function which is subtly different from how C works. It returns all but the last level of a file path even if the last level is clearly a directory. In effect, it is not returning the directory portion but simply the path one level up acting like C for file paths. Also unlike C, C does not include a trailing slash on its returned path. # returns /foo/bar. fileparse() would return /foo/bar/ dirname("/foo/bar/baz"); # also returns /foo/bar despite the fact that baz is clearly a # directory. fileparse() would return /foo/bar/baz/ dirname("/foo/bar/baz/"); # returns '.'. fileparse() would return 'foo/' dirname("foo/"); Under VMS, if there is no directory information in the $path, then the current default device and directory is used. =cut sub dirname { my $path = shift; my($type) = $Fileparse_fstype; if( $type eq 'VMS' and $path =~ m{/} ) { # Parse as Unix local($File::Basename::Fileparse_fstype) = ''; return dirname($path); } my($basename, $dirname) = fileparse($path); if ($type eq 'VMS') { $dirname ||= $ENV{DEFAULT}; } elsif ($type eq 'MacOS') { if( !length($basename) && $dirname !~ /^[^:]+:\z/) { _strip_trailing_sep($dirname); ($basename,$dirname) = fileparse $dirname; } $dirname .= ":" unless $dirname =~ /:\z/; } elsif (grep { $type eq $_ } qw(MSDOS DOS MSWin32 OS2)) { _strip_trailing_sep($dirname); unless( length($basename) ) { ($basename,$dirname) = fileparse $dirname; _strip_trailing_sep($dirname); } } elsif ($type eq 'AmigaOS') { if ( $dirname =~ /:\z/) { return $dirname } chop $dirname; $dirname =~ s{[^:/]+\z}{} unless length($basename); } else { _strip_trailing_sep($dirname); unless( length($basename) ) { ($basename,$dirname) = fileparse $dirname; _strip_trailing_sep($dirname); } } $dirname; } # Strip the trailing path separator. sub _strip_trailing_sep { my $type = $Fileparse_fstype; if ($type eq 'MacOS') { $_[0] =~ s/([^:]):\z/$1/s; } elsif (grep { $type eq $_ } qw(MSDOS DOS MSWin32 OS2)) { $_[0] =~ s/([^:])[\\\/]*\z/$1/; } else { $_[0] =~ s{(.)/*\z}{$1}s; } } =item C X my $type = fileparse_set_fstype(); my $previous_type = fileparse_set_fstype($type); Normally File::Basename will assume a file path type native to your current operating system (ie. /foo/bar style on Unix, \foo\bar on Windows, etc...). With this function you can override that assumption. Valid $types are "MacOS", "VMS", "AmigaOS", "OS2", "RISCOS", "MSWin32", "DOS" (also "MSDOS" for backwards bug compatibility), "Epoc" and "Unix" (all case-insensitive). If an unrecognized $type is given "Unix" will be assumed. If you've selected VMS syntax, and the file specification you pass to one of these routines contains a "/", they assume you are using Unix emulation and apply the Unix syntax rules instead, for that function call only. =back =cut BEGIN { my @Ignore_Case = qw(MacOS VMS AmigaOS OS2 RISCOS MSWin32 MSDOS DOS Epoc); my @Types = (@Ignore_Case, qw(Unix)); sub fileparse_set_fstype { my $old = $Fileparse_fstype; if (@_) { my $new_type = shift; $Fileparse_fstype = 'Unix'; # default foreach my $type (@Types) { $Fileparse_fstype = $type if $new_type =~ /^$type/i; } $Fileparse_igncase = (grep $Fileparse_fstype eq $_, @Ignore_Case) ? 1 : 0; } return $old; } } 1; =head1 SEE ALSO L, L, L FILEffbea4bc/Exporter/Heavy.pm9package Exporter::Heavy; use strict; no strict 'refs'; our $VERSION = '5.79'; =head1 NAME Exporter::Heavy - Exporter guts =head1 SYNOPSIS (internal use only) =head1 DESCRIPTION No user-serviceable parts inside. =cut # # We go to a lot of trouble not to 'require Carp' at file scope, # because Carp requires Exporter, and something has to give. # sub _rebuild_cache { my ($pkg, $exports, $cache) = @_; s/^&// foreach @$exports; @{$cache}{@$exports} = (1) x @$exports; my $ok = \@{"${pkg}::EXPORT_OK"}; if (@$ok) { s/^&// foreach @$ok; @{$cache}{@$ok} = (1) x @$ok; } } sub heavy_export { # Save the old __WARN__ handler in case it was defined my $oldwarn = $SIG{__WARN__} || sub { warn $_[0] }; # First make import warnings look like they're coming from the "use". local $SIG{__WARN__} = sub { my $text = shift; if ($text =~ s/ at \S*Exporter\S*.pm line \d+.*\n//) { require Carp; local $Carp::CarpLevel = 1; # ignore package calling us too. $oldwarn->(Carp::shortmess($text)); } else { $oldwarn->($text); } }; local $SIG{__DIE__} = sub { require Carp; local $Carp::CarpLevel = 1; # ignore package calling us too. Carp::croak("$_[0]Illegal null symbol in \@${1}::EXPORT") if $_[0] =~ /^Unable to create sub named "(.*?)::"/; }; my($pkg, $callpkg, @imports) = @_; my($type, $sym, $cache_is_current, $oops); my($exports, $export_cache) = (\@{"${pkg}::EXPORT"}, $Exporter::Cache{$pkg} ||= {}); if (@imports) { if (!%$export_cache) { _rebuild_cache ($pkg, $exports, $export_cache); $cache_is_current = 1; } if (grep m{^[/!:]}, @imports) { my $tagsref = \%{"${pkg}::EXPORT_TAGS"}; my $tagdata; my %imports; my($remove, $spec, @names, @allexports); # negated first item implies starting with default set: unshift @imports, ':DEFAULT' if $imports[0] =~ m/^!/; foreach $spec (@imports){ $remove = $spec =~ s/^!//; if ($spec =~ s/^://){ if ($spec eq 'DEFAULT'){ @names = @$exports; } elsif ($tagdata = $tagsref->{$spec}) { @names = @$tagdata; } else { warn qq["$spec" is not defined in %${pkg}::EXPORT_TAGS]; ++$oops; next; } } elsif ($spec =~ m:^/(.*)/$:){ my $patn = $1; @allexports = keys %$export_cache unless @allexports; # only do keys once @names = grep(/$patn/, @allexports); # not anchored by default } else { @names = ($spec); # is a normal symbol name } warn "Import ".($remove ? "del":"add").": @names " if $Exporter::Verbose; if ($remove) { foreach $sym (@names) { delete $imports{$sym} } } else { @imports{@names} = (1) x @names; } } @imports = keys %imports; } my @carp; foreach $sym (@imports) { if (!$export_cache->{$sym}) { if ($sym =~ m/^\d/) { $pkg->VERSION($sym); # inherit from UNIVERSAL # If the version number was the only thing specified # then we should act as if nothing was specified: if (@imports == 1) { @imports = @$exports; last; } # We need a way to emulate 'use Foo ()' but still # allow an easy version check: "use Foo 1.23, ''"; if (@imports == 2 and !$imports[1]) { @imports = (); last; } } elsif ($sym !~ s/^&// || !$export_cache->{$sym}) { # Last chance - see if they've updated EXPORT_OK since we # cached it. unless ($cache_is_current) { %$export_cache = (); _rebuild_cache ($pkg, $exports, $export_cache); $cache_is_current = 1; } if (!$export_cache->{$sym}) { # accumulate the non-exports push @carp, qq["$sym" is not exported by the $pkg module]; $oops++; } } } } if ($oops) { require Carp; Carp::croak(join("\n", @carp, "Can't continue after import errors")); } } else { @imports = @$exports; } my($fail, $fail_cache) = (\@{"${pkg}::EXPORT_FAIL"}, $Exporter::FailCache{$pkg} ||= {}); if (@$fail) { if (!%$fail_cache) { # Build cache of symbols. Optimise the lookup by adding # barewords twice... both with and without a leading &. # (Technique could be applied to $export_cache at cost of memory) my @expanded = map { /^\w/ ? ($_, '&'.$_) : $_ } @$fail; warn "${pkg}::EXPORT_FAIL cached: @expanded" if $Exporter::Verbose; @{$fail_cache}{@expanded} = (1) x @expanded; } my @failed; foreach $sym (@imports) { push(@failed, $sym) if $fail_cache->{$sym} } if (@failed) { @failed = $pkg->export_fail(@failed); foreach $sym (@failed) { require Carp; Carp::carp(qq["$sym" is not implemented by the $pkg module ], "on this architecture"); } if (@failed) { require Carp; Carp::croak("Can't continue after import errors"); } } } warn "Importing into $callpkg from $pkg: ", join(", ",sort @imports) if $Exporter::Verbose; foreach $sym (@imports) { # shortcut for the common case of no type character (*{"${callpkg}::$sym"} = \&{"${pkg}::$sym"}, next) unless $sym =~ s/^(\W)//; $type = $1; no warnings 'once'; *{"${callpkg}::$sym"} = $type eq '&' ? \&{"${pkg}::$sym"} : $type eq '$' ? \${"${pkg}::$sym"} : $type eq '@' ? \@{"${pkg}::$sym"} : $type eq '%' ? \%{"${pkg}::$sym"} : $type eq '*' ? *{"${pkg}::$sym"} : do { require Carp; Carp::croak("Can't export symbol: $type$sym") }; } } sub heavy_export_to_level { my $pkg = shift; my $level = shift; (undef) = shift; # XXX redundant arg my $callpkg = caller($level); $pkg->export($callpkg, @_); } # Utility functions sub _push_tags { my($pkg, $var, $syms) = @_; my @nontag = (); my $export_tags = \%{"${pkg}::EXPORT_TAGS"}; push(@{"${pkg}::$var"}, map { $export_tags->{$_} ? @{$export_tags->{$_}} : scalar(push(@nontag,$_),$_) } (@$syms) ? @$syms : keys %$export_tags); if (@nontag and $^W) { # This may change to a die one day require Carp; Carp::carp(join(", ", @nontag)." are not tags of $pkg"); } } sub heavy_require_version { my($self, $wanted) = @_; my $pkg = ref $self || $self; return ${pkg}->VERSION($wanted); } sub heavy_export_tags { _push_tags((caller)[0], "EXPORT", \@_); } sub heavy_export_ok_tags { _push_tags((caller)[0], "EXPORT_OK", \@_); } 1; FILE57006cdb/Carp/Heavy.pmpackage Carp::Heavy; use Carp (); our $VERSION = '1.54'; $VERSION =~ tr/_//d; # Carp::Heavy was merged into Carp in version 1.12. Any mismatched versions # after this point are not significant and can be ignored. if(($Carp::VERSION || 0) < 1.12) { my $cv = defined($Carp::VERSION) ? $Carp::VERSION : "undef"; die "Version mismatch between Carp $cv ($INC{q(Carp.pm)}) and Carp::Heavy $VERSION ($INC{q(Carp/Heavy.pm)}). Did you alter \@INC after Carp was loaded?\n"; } 1; # Most of the machinery of Carp used to be here. # It has been moved in Carp.pm now, but this placeholder remains for # the benefit of modules that like to preload Carp::Heavy directly. # This must load Carp, because some modules rely on the historical # behaviour of Carp::Heavy loading Carp. FILE81b1434e/Carp.pmpackage Carp; { use 5.006; } use strict; use warnings; BEGIN { # Very old versions of warnings.pm load Carp. This can go wrong due # to the circular dependency. If warnings is invoked before Carp, # then warnings starts by loading Carp, then Carp (above) tries to # invoke warnings, and gets nothing because warnings is in the process # of loading and hasn't defined its import method yet. If we were # only turning on warnings ("use warnings" above) this wouldn't be too # bad, because Carp would just gets the state of the -w switch and so # might not get some warnings that it wanted. The real problem is # that we then want to turn off Unicode warnings, but "no warnings # 'utf8'" won't be effective if we're in this circular-dependency # situation. So, if warnings.pm is an affected version, we turn # off all warnings ourselves by directly setting ${^WARNING_BITS}. # On unaffected versions, we turn off just Unicode warnings, via # the proper API. if(!defined($warnings::VERSION) || eval($warnings::VERSION) < 1.06) { ${^WARNING_BITS} = ""; } else { "warnings"->unimport("utf8"); } } sub _fetch_sub { # fetch sub without autovivifying my($pack, $sub) = @_; $pack .= '::'; # only works with top-level packages return unless exists($::{$pack}); for ($::{$pack}) { return unless ref \$_ eq 'GLOB' && *$_{HASH} && exists $$_{$sub}; for ($$_{$sub}) { return ref \$_ eq 'GLOB' ? *$_{CODE} : undef } } } # UTF8_REGEXP_PROBLEM is a compile-time constant indicating whether Carp # must avoid applying a regular expression to an upgraded (is_utf8) # string. There are multiple problems, on different Perl versions, # that require this to be avoided. All versions prior to 5.13.8 will # load utf8_heavy.pl for the swash system, even if the regexp doesn't # use character classes. Perl 5.6 and Perls [5.11.2, 5.13.11) exhibit # specific problems when Carp is being invoked in the aftermath of a # syntax error. BEGIN { if("$]" < 5.013011) { *UTF8_REGEXP_PROBLEM = sub () { 1 }; } else { *UTF8_REGEXP_PROBLEM = sub () { 0 }; } } # is_utf8() is essentially the utf8::is_utf8() function, which indicates # whether a string is represented in the upgraded form (using UTF-8 # internally). As utf8::is_utf8() is only available from Perl 5.8 # onwards, extra effort is required here to make it work on Perl 5.6. BEGIN { if(defined(my $sub = _fetch_sub utf8 => 'is_utf8')) { *is_utf8 = $sub; } else { # black magic for perl 5.6 *is_utf8 = sub { unpack("C", "\xaa".$_[0]) != 170 }; } } # The downgrade() function defined here is to be used for attempts to # downgrade where it is acceptable to fail. It must be called with a # second argument that is a true value. BEGIN { if(defined(my $sub = _fetch_sub utf8 => 'downgrade')) { *downgrade = \&{"utf8::downgrade"}; } else { *downgrade = sub { my $r = ""; my $l = length($_[0]); for(my $i = 0; $i != $l; $i++) { my $o = ord(substr($_[0], $i, 1)); return if $o > 255; $r .= chr($o); } $_[0] = $r; }; } } # is_safe_printable_codepoint() indicates whether a character, specified # by integer codepoint, is OK to output literally in a trace. Generally # this is if it is a printable character in the ancestral character set # (ASCII or EBCDIC). This is used on some Perls in situations where a # regexp can't be used. BEGIN { *is_safe_printable_codepoint = "$]" >= 5.007_003 ? eval(q(sub ($) { my $u = utf8::native_to_unicode($_[0]); $u >= 0x20 && $u <= 0x7e; })) : ord("A") == 65 ? sub ($) { $_[0] >= 0x20 && $_[0] <= 0x7e } : sub ($) { # Early EBCDIC # 3 EBCDIC code pages supported then; all controls but one # are the code points below SPACE. The other one is 0x5F on # POSIX-BC; FF on the other two. # FIXME: there are plenty of unprintable codepoints other # than those that this code and the comment above identifies # as "controls". $_[0] >= ord(" ") && $_[0] <= 0xff && $_[0] != (ord ("^") == 106 ? 0x5f : 0xff); } ; } sub _univ_mod_loaded { return 0 unless exists($::{"UNIVERSAL::"}); for ($::{"UNIVERSAL::"}) { return 0 unless ref \$_ eq "GLOB" && *$_{HASH} && exists $$_{"$_[0]::"}; for ($$_{"$_[0]::"}) { return 0 unless ref \$_ eq "GLOB" && *$_{HASH} && exists $$_{"VERSION"}; for ($$_{"VERSION"}) { return 0 unless ref \$_ eq "GLOB"; return ${*$_{SCALAR}}; } } } } # _maybe_isa() is usually the UNIVERSAL::isa function. We have to avoid # the latter if the UNIVERSAL::isa module has been loaded, to avoid infi- # nite recursion; in that case _maybe_isa simply returns true. my $isa; BEGIN { if (_univ_mod_loaded('isa')) { *_maybe_isa = sub { 1 } } else { # Since we have already done the check, record $isa for use below # when defining _StrVal. *_maybe_isa = $isa = _fetch_sub(UNIVERSAL => "isa"); } } # We need an overload::StrVal or equivalent function, but we must avoid # loading any modules on demand, as Carp is used from __DIE__ handlers and # may be invoked after a syntax error. # We can copy recent implementations of overload::StrVal and use # overloading.pm, which is the fastest implementation, so long as # overloading is available. If it is not available, we use our own pure- # Perl StrVal. We never actually use overload::StrVal, for various rea- # sons described below. # overload versions are as follows: # undef-1.00 (up to perl 5.8.0) uses bless (avoid!) # 1.01-1.17 (perl 5.8.1 to 5.14) uses Scalar::Util # 1.18+ (perl 5.16+) uses overloading # The ancient 'bless' implementation (that inspires our pure-Perl version) # blesses unblessed references and must be avoided. Those using # Scalar::Util use refaddr, possibly the pure-Perl implementation, which # has the same blessing bug, and must be avoided. Also, Scalar::Util is # loaded on demand. Since we avoid the Scalar::Util implementations, we # end up having to implement our own overloading.pm-based version for perl # 5.10.1 to 5.14. Since it also works just as well in more recent ver- # sions, we use it there, too. BEGIN { if (eval { require "overloading.pm" }) { *_StrVal = eval 'sub { no overloading; "$_[0]" }' } else { # Work around the UNIVERSAL::can/isa modules to avoid recursion. # _mycan is either UNIVERSAL::can, or, in the presence of an # override, overload::mycan. *_mycan = _univ_mod_loaded('can') ? do { require "overload.pm"; _fetch_sub overload => 'mycan' } : \&UNIVERSAL::can; # _blessed is either UNIVERSAL::isa(...), or, in the presence of an # override, a hideous, but fairly reliable, workaround. *_blessed = $isa ? sub { &$isa($_[0], "UNIVERSAL") } : sub { my $probe = "UNIVERSAL::Carp_probe_" . rand; no strict 'refs'; local *$probe = sub { "unlikely string" }; local $@; local $SIG{__DIE__} = sub{}; (eval { $_[0]->$probe } || '') eq 'unlikely string' }; *_StrVal = sub { my $pack = ref $_[0]; # Perl's overload mechanism uses the presence of a special # "method" named "((" or "()" to signal it is in effect. # This test seeks to see if it has been set up. "((" post- # dates overloading.pm, so we can skip it. return "$_[0]" unless _mycan($pack, "()"); # Even at this point, the invocant may not be blessed, so # check for that. return "$_[0]" if not _blessed($_[0]); bless $_[0], "Carp"; my $str = "$_[0]"; bless $_[0], $pack; $pack . substr $str, index $str, "="; } } } our $VERSION = '1.54'; $VERSION =~ tr/_//d; our $MaxEvalLen = 0; our $Verbose = 0; our $CarpLevel = 0; our $MaxArgLen = 64; # How much of each argument to print. 0 = all. our $MaxArgNums = 8; # How many arguments to print. 0 = all. our $RefArgFormatter = undef; # allow caller to format reference arguments require Exporter; our @ISA = ('Exporter'); our @EXPORT = qw(confess croak carp); our @EXPORT_OK = qw(cluck verbose longmess shortmess); our @EXPORT_FAIL = qw(verbose); # hook to enable verbose mode # The members of %Internal are packages that are internal to perl. # Carp will not report errors from within these packages if it # can. The members of %CarpInternal are internal to Perl's warning # system. Carp will not report errors from within these packages # either, and will not report calls *to* these packages for carp and # croak. They replace $CarpLevel, which is deprecated. The # $Max(EvalLen|(Arg(Len|Nums)) variables are used to specify how the eval # text and function arguments should be formatted when printed. our %CarpInternal; our %Internal; # disable these by default, so they can live w/o require Carp $CarpInternal{Carp}++; $CarpInternal{warnings}++; $Internal{Exporter}++; $Internal{'Exporter::Heavy'}++; # if the caller specifies verbose usage ("perl -MCarp=verbose script.pl") # then the following method will be called by the Exporter which knows # to do this thanks to @EXPORT_FAIL, above. $_[1] will contain the word # 'verbose'. sub export_fail { shift; $Verbose = shift if $_[0] eq 'verbose'; @_ } sub _cgc { no strict 'refs'; return \&{"CORE::GLOBAL::caller"} if defined &{"CORE::GLOBAL::caller"}; return; } sub longmess { local($!, $^E); # Icky backwards compatibility wrapper. :-( # # The story is that the original implementation hard-coded the # number of call levels to go back, so calls to longmess were off # by one. Other code began calling longmess and expecting this # behaviour, so the replacement has to emulate that behaviour. my $cgc = _cgc(); my $call_pack = $cgc ? $cgc->() : caller(); if ( $Internal{$call_pack} or $CarpInternal{$call_pack} ) { return longmess_heavy(@_); } else { local $CarpLevel = $CarpLevel + 1; return longmess_heavy(@_); } } our @CARP_NOT; sub shortmess { local($!, $^E); my $cgc = _cgc(); # Icky backwards compatibility wrapper. :-( local @CARP_NOT = scalar( $cgc ? $cgc->() : caller() ); shortmess_heavy(@_); } sub croak { die shortmess @_ } sub confess { die longmess @_ } sub carp { warn shortmess @_ } sub cluck { warn longmess @_ } BEGIN { if("$]" >= 5.015002 || ("$]" >= 5.014002 && "$]" < 5.015) || ("$]" >= 5.012005 && "$]" < 5.013)) { *CALLER_OVERRIDE_CHECK_OK = sub () { 1 }; } else { *CALLER_OVERRIDE_CHECK_OK = sub () { 0 }; } } sub caller_info { my $i = shift(@_) + 1; my %call_info; my $cgc = _cgc(); { # Some things override caller() but forget to implement the # @DB::args part of it, which we need. We check for this by # pre-populating @DB::args with a sentinel which no-one else # has the address of, so that we can detect whether @DB::args # has been properly populated. However, on earlier versions # of perl this check tickles a bug in CORE::caller() which # leaks memory. So we only check on fixed perls. @DB::args = \$i if CALLER_OVERRIDE_CHECK_OK; package DB; @call_info{ qw(pack file line sub has_args wantarray evaltext is_require) } = $cgc ? $cgc->($i) : caller($i); } unless ( defined $call_info{file} ) { return (); } my $sub_name = Carp::get_subname( \%call_info ); if ( $call_info{has_args} ) { # Guard our serialization of the stack from stack refcounting bugs # NOTE this is NOT a complete solution, we cannot 100% guard against # these bugs. However in many cases Perl *is* capable of detecting # them and throws an error when it does. Unfortunately serializing # the arguments on the stack is a perfect way of finding these bugs, # even when they would not affect normal program flow that did not # poke around inside the stack. Inside of Carp.pm it makes little # sense reporting these bugs, as Carp's job is to report the callers # errors, not the ones it might happen to tickle while doing so. # See: https://rt.perl.org/Public/Bug/Display.html?id=131046 # and: https://rt.perl.org/Public/Bug/Display.html?id=52610 # for more details and discussion. - Yves my @args = map { my $arg; local $@= $@; eval { $arg = $_; 1; } or do { $arg = '** argument not available anymore **'; }; $arg; } @DB::args; if (CALLER_OVERRIDE_CHECK_OK && @args == 1 && ref $args[0] eq ref \$i && $args[0] == \$i ) { @args = (); # Don't let anyone see the address of $i local $@; my $where = eval { my $func = $cgc or return ''; my $gv = (_fetch_sub B => 'svref_2object' or return '') ->($func)->GV; my $package = $gv->STASH->NAME; my $subname = $gv->NAME; return unless defined $package && defined $subname; # returning CORE::GLOBAL::caller isn't useful for tracing the cause: return if $package eq 'CORE::GLOBAL' && $subname eq 'caller'; " in &${package}::$subname"; } || ''; @args = "** Incomplete caller override detected$where; \@DB::args were not set **"; } else { my $overflow; if ( $MaxArgNums and @args > $MaxArgNums ) { # More than we want to show? $#args = $MaxArgNums - 1; $overflow = 1; } @args = map { Carp::format_arg($_) } @args; if ($overflow) { push @args, '...'; } } # Push the args onto the subroutine $sub_name .= '(' . join( ', ', @args ) . ')'; } $call_info{sub_name} = $sub_name; return wantarray() ? %call_info : \%call_info; } # Transform an argument to a function into a string. our $in_recurse; sub format_arg { my $arg = shift; if ( my $pack= ref($arg) ) { # legitimate, let's not leak it. if (!$in_recurse && _maybe_isa( $arg, 'UNIVERSAL' ) && do { local $@; local $in_recurse = 1; local $SIG{__DIE__} = sub{}; eval {$arg->can('CARP_TRACE') } }) { return $arg->CARP_TRACE(); } elsif (!$in_recurse && defined($RefArgFormatter) && do { local $@; local $in_recurse = 1; local $SIG{__DIE__} = sub{}; eval {$arg = $RefArgFormatter->($arg); 1} }) { return $arg; } else { # Argument may be blessed into a class with overloading, and so # might have an overloaded stringification. We don't want to # risk getting the overloaded stringification, so we need to # use _StrVal, our overload::StrVal()-equivalent. return _StrVal $arg; } } return "undef" if !defined($arg); downgrade($arg, 1); return $arg if !(UTF8_REGEXP_PROBLEM && is_utf8($arg)) && $arg =~ /\A-?[0-9]+(?:\.[0-9]*)?(?:[eE][-+]?[0-9]+)?\z/; my $suffix = ""; if ( 2 < $MaxArgLen and $MaxArgLen < length($arg) ) { substr ( $arg, $MaxArgLen - 3 ) = ""; $suffix = "..."; } if(UTF8_REGEXP_PROBLEM && is_utf8($arg)) { for(my $i = length($arg); $i--; ) { my $c = substr($arg, $i, 1); my $x = substr($arg, 0, 0); # work around bug on Perl 5.8.{1,2} if($c eq "\"" || $c eq "\\" || $c eq "\$" || $c eq "\@") { substr $arg, $i, 0, "\\"; next; } my $o = ord($c); substr $arg, $i, 1, sprintf("\\x{%x}", $o) unless is_safe_printable_codepoint($o); } } else { $arg =~ s/([\"\\\$\@])/\\$1/g; # This is all the ASCII printables spelled-out. It is portable to all # Perl versions and platforms (such as EBCDIC). There are other more # compact ways to do this, but may not work everywhere every version. $arg =~ s/([^ !"#\$\%\&'()*+,\-.\/0123456789:;<=>?\@ABCDEFGHIJKLMNOPQRSTUVWXYZ\[\\\]^_`abcdefghijklmnopqrstuvwxyz\{|}~])/sprintf("\\x{%x}",ord($1))/eg; } downgrade($arg, 1); return "\"".$arg."\"".$suffix; } sub Regexp::CARP_TRACE { my $arg = "$_[0]"; downgrade($arg, 1); if(UTF8_REGEXP_PROBLEM && is_utf8($arg)) { for(my $i = length($arg); $i--; ) { my $o = ord(substr($arg, $i, 1)); my $x = substr($arg, 0, 0); # work around bug on Perl 5.8.{1,2} substr $arg, $i, 1, sprintf("\\x{%x}", $o) unless is_safe_printable_codepoint($o); } } else { # See comment in format_arg() about this same regex. $arg =~ s/([^ !"#\$\%\&'()*+,\-.\/0123456789:;<=>?\@ABCDEFGHIJKLMNOPQRSTUVWXYZ\[\\\]^_`abcdefghijklmnopqrstuvwxyz\{|}~])/sprintf("\\x{%x}",ord($1))/eg; } downgrade($arg, 1); my $suffix = ""; if($arg =~ /\A\(\?\^?([a-z]*)(?:-[a-z]*)?:(.*)\)\z/s) { ($suffix, $arg) = ($1, $2); } if ( 2 < $MaxArgLen and $MaxArgLen < length($arg) ) { substr ( $arg, $MaxArgLen - 3 ) = ""; $suffix = "...".$suffix; } return "qr($arg)$suffix"; } # Takes an inheritance cache and a package and returns # an anon hash of known inheritances and anon array of # inheritances which consequences have not been figured # for. sub get_status { my $cache = shift; my $pkg = shift; $cache->{$pkg} ||= [ { $pkg => $pkg }, [ trusts_directly($pkg) ] ]; return @{ $cache->{$pkg} }; } # Takes the info from caller() and figures out the name of # the sub/require/eval sub get_subname { my $info = shift; if ( defined( $info->{evaltext} ) ) { my $eval = $info->{evaltext}; if ( $info->{is_require} ) { return "require $eval"; } else { $eval =~ s/([\\\'])/\\$1/g; return "eval '" . str_len_trim( $eval, $MaxEvalLen ) . "'"; } } # this can happen on older perls when the sub (or the stash containing it) # has been deleted if ( !defined( $info->{sub} ) ) { return '__ANON__::__ANON__'; } return ( $info->{sub} eq '(eval)' ) ? 'eval {...}' : $info->{sub}; } # Figures out what call (from the point of view of the caller) # the long error backtrace should start at. sub long_error_loc { my $i; my $lvl = $CarpLevel; { ++$i; my $cgc = _cgc(); my @caller = $cgc ? $cgc->($i) : caller($i); my $pkg = $caller[0]; unless ( defined($pkg) ) { # This *shouldn't* happen. if (%Internal) { local %Internal; $i = long_error_loc(); last; } elsif (defined $caller[2]) { # this can happen when the stash has been deleted # in that case, just assume that it's a reasonable place to # stop (the file and line data will still be intact in any # case) - the only issue is that we can't detect if the # deleted package was internal (so don't do that then) # -doy redo unless 0 > --$lvl; last; } else { return 2; } } redo if $CarpInternal{$pkg}; redo unless 0 > --$lvl; redo if $Internal{$pkg}; } return $i - 1; } sub longmess_heavy { if ( ref( $_[0] ) ) { # don't break references as exceptions return wantarray ? @_ : $_[0]; } my $i = long_error_loc(); return ret_backtrace( $i, @_ ); } BEGIN { if("$]" >= 5.017004) { # The LAST_FH constant is a reference to the variable. $Carp::{LAST_FH} = \eval '\${^LAST_FH}'; } else { eval '*LAST_FH = sub () { 0 }'; } } # Returns a full stack backtrace starting from where it is # told. sub ret_backtrace { my ( $i, @error ) = @_; my $mess; my $err = join '', @error; $i++; my $tid_msg = ''; if ( defined &threads::tid ) { my $tid = threads->tid; $tid_msg = " thread $tid" if $tid; } my %i = caller_info($i); $mess = "$err at $i{file} line $i{line}$tid_msg"; if( $. ) { # Use ${^LAST_FH} if available. if (LAST_FH) { if (${+LAST_FH}) { $mess .= sprintf ", <%s> %s %d", *${+LAST_FH}{NAME}, ($/ eq "\n" ? "line" : "chunk"), $. } } else { local $@ = ''; local $SIG{__DIE__}; eval { CORE::die; }; if($@ =~ /^Died at .*(, <.*?> (?:line|chunk) \d+).$/ ) { $mess .= $1; } } } $mess .= "\.\n"; while ( my %i = caller_info( ++$i ) ) { $mess .= "\t$i{sub_name} called at $i{file} line $i{line}$tid_msg\n"; } return $mess; } sub ret_summary { my ( $i, @error ) = @_; my $err = join '', @error; $i++; my $tid_msg = ''; if ( defined &threads::tid ) { my $tid = threads->tid; $tid_msg = " thread $tid" if $tid; } my %i = caller_info($i); return "$err at $i{file} line $i{line}$tid_msg\.\n"; } sub short_error_loc { # You have to create your (hash)ref out here, rather than defaulting it # inside trusts *on a lexical*, as you want it to persist across calls. # (You can default it on $_[2], but that gets messy) my $cache = {}; my $i = 1; my $lvl = $CarpLevel; { my $cgc = _cgc(); my $called = $cgc ? $cgc->($i) : caller($i); $i++; my $caller = $cgc ? $cgc->($i) : caller($i); if (!defined($caller)) { my @caller = $cgc ? $cgc->($i) : caller($i); if (@caller) { # if there's no package but there is other caller info, then # the package has been deleted - treat this as a valid package # in this case redo if defined($called) && $CarpInternal{$called}; redo unless 0 > --$lvl; last; } else { return 0; } } redo if $Internal{$caller}; redo if $CarpInternal{$caller}; redo if $CarpInternal{$called}; redo if trusts( $called, $caller, $cache ); redo if trusts( $caller, $called, $cache ); redo unless 0 > --$lvl; } return $i - 1; } sub shortmess_heavy { return longmess_heavy(@_) if $Verbose; return @_ if ref( $_[0] ); # don't break references as exceptions my $i = short_error_loc(); if ($i) { ret_summary( $i, @_ ); } else { longmess_heavy(@_); } } # If a string is too long, trims it with ... sub str_len_trim { my $str = shift; my $max = shift || 0; if ( 2 < $max and $max < length($str) ) { substr( $str, $max - 3 ) = '...'; } return $str; } # Takes two packages and an optional cache. Says whether the # first inherits from the second. # # Recursive versions of this have to work to avoid certain # possible endless loops, and when following long chains of # inheritance are less efficient. sub trusts { my $child = shift; my $parent = shift; my $cache = shift; my ( $known, $partial ) = get_status( $cache, $child ); # Figure out consequences until we have an answer while ( @$partial and not exists $known->{$parent} ) { my $anc = shift @$partial; next if exists $known->{$anc}; $known->{$anc}++; my ( $anc_knows, $anc_partial ) = get_status( $cache, $anc ); my @found = keys %$anc_knows; @$known{@found} = (); push @$partial, @$anc_partial; } return exists $known->{$parent}; } # Takes a package and gives a list of those trusted directly sub trusts_directly { my $class = shift; no strict 'refs'; my $stash = \%{"$class\::"}; for my $var (qw/ CARP_NOT ISA /) { # Don't try using the variable until we know it exists, # to avoid polluting the caller's namespace. if ( $stash->{$var} && ref \$stash->{$var} eq 'GLOB' && *{$stash->{$var}}{ARRAY} && @{$stash->{$var}} ) { return @{$stash->{$var}} } } return; } if(!defined($warnings::VERSION) || do { no warnings "numeric"; $warnings::VERSION < 1.03 }) { # Very old versions of warnings.pm import from Carp. This can go # wrong due to the circular dependency. If Carp is invoked before # warnings, then Carp starts by loading warnings, then warnings # tries to import from Carp, and gets nothing because Carp is in # the process of loading and hasn't defined its import method yet. # So we work around that by manually exporting to warnings here. no strict "refs"; *{"warnings::$_"} = \&$_ foreach @EXPORT; } 1; __END__ =head1 NAME Carp - alternative warn and die for modules =head1 SYNOPSIS use Carp; # warn user (from perspective of caller) carp "string trimmed to 80 chars"; # die of errors (from perspective of caller) croak "We're outta here!"; # die of errors with stack backtrace confess "not implemented"; # cluck, longmess and shortmess not exported by default use Carp qw(cluck longmess shortmess); cluck "This is how we got here!"; # warn with stack backtrace my $long_message = longmess( "message from cluck() or confess()" ); my $short_message = shortmess( "message from carp() or croak()" ); =head1 DESCRIPTION The Carp routines are useful in your own modules because they act like C or C, but with a message which is more likely to be useful to a user of your module. In the case of C and C, that context is a summary of every call in the call-stack; C returns the contents of the error message. For a shorter message you can use C or C which report the error as being from where your module was called. C returns the contents of this error message. There is no guarantee that that is where the error was, but it is a good educated guess. C takes care not to clobber the status variables C<$!> and C<$^E> in the course of assembling its error messages. This means that a C<$SIG{__DIE__}> or C<$SIG{__WARN__}> handler can capture the error information held in those variables, if it is required to augment the error message, and if the code calling C left useful values there. Of course, C can't guarantee the latter. You can also alter the way the output and logic of C works, by changing some global variables in the C namespace. See the section on L below. Here is a more complete description of how C and C work. What they do is search the call-stack for a function call stack where they have not been told that there shouldn't be an error. If every call is marked safe, they give up and give a full stack backtrace instead. In other words they presume that the first likely looking potential suspect is guilty. Their rules for telling whether a call shouldn't generate errors work as follows: =over 4 =item 1. Any call from a package to itself is safe. =item 2. Packages claim that there won't be errors on calls to or from packages explicitly marked as safe by inclusion in C<@CARP_NOT>, or (if that array is empty) C<@ISA>. The ability to override what @ISA says is new in 5.8. =item 3. The trust in item 2 is transitive. If A trusts B, and B trusts C, then A trusts C. So if you do not override C<@ISA> with C<@CARP_NOT>, then this trust relationship is identical to, "inherits from". =item 4. Any call from an internal Perl module is safe. (Nothing keeps user modules from marking themselves as internal to Perl, but this practice is discouraged.) =item 5. Any call to Perl's warning system (eg Carp itself) is safe. (This rule is what keeps it from reporting the error at the point where you call C or C.) =item 6. C<$Carp::CarpLevel> can be set to skip a fixed number of additional call levels. Using this is not recommended because it is very difficult to get it to behave correctly. =back =head2 Forcing a Stack Trace As a debugging aid, you can force Carp to treat a croak as a confess and a carp as a cluck across I modules. In other words, force a detailed stack trace to be given. This can be very helpful when trying to understand why, or from where, a warning or error is being generated. This feature is enabled by 'importing' the non-existent symbol 'verbose'. You would typically enable it by saying perl -MCarp=verbose script.pl or by including the string C<-MCarp=verbose> in the PERL5OPT environment variable. Alternately, you can set the global variable C<$Carp::Verbose> to true. See the L section below. =head2 Stack Trace formatting At each stack level, the subroutine's name is displayed along with its parameters. For simple scalars, this is sufficient. For complex data types, such as objects and other references, this can simply display C<'HASH(0x1ab36d8)'>. Carp gives two ways to control this. =over 4 =item 1. For objects, a method, C, will be called, if it exists. If this method doesn't exist, or it recurses into C, or it otherwise throws an exception, this is skipped, and Carp moves on to the next option, otherwise checking stops and the string returned is used. It is recommended that the object's type is part of the string to make debugging easier. =item 2. For any type of reference, C<$Carp::RefArgFormatter> is checked (see below). This variable is expected to be a code reference, and the current parameter is passed in. If this function doesn't exist (the variable is undef), or it recurses into C, or it otherwise throws an exception, this is skipped, and Carp moves on to the next option, otherwise checking stops and the string returned is used. =item 3. Otherwise, if neither C nor C<$Carp::RefArgFormatter> is available, stringify the value ignoring any overloading. =back =head1 GLOBAL VARIABLES =head2 $Carp::MaxEvalLen This variable determines how many characters of a string-eval are to be shown in the output. Use a value of C<0> to show all text. Defaults to C<0>. =head2 $Carp::MaxArgLen This variable determines how many characters of each argument to a function to print. Use a value of C<0> to show the full length of the argument. Defaults to C<64>. =head2 $Carp::MaxArgNums This variable determines how many arguments to each function to show. Use a false value to show all arguments to a function call. To suppress all arguments, use C<-1> or C<'0 but true'>. Defaults to C<8>. =head2 $Carp::Verbose This variable makes C and C generate stack backtraces just like C and C. This is how C is implemented internally. Defaults to C<0>. =head2 $Carp::RefArgFormatter This variable sets a general argument formatter to display references. Plain scalars and objects that implement C will not go through this formatter. Calling C from within this function is not supported. local $Carp::RefArgFormatter = sub { require Data::Dumper; Data::Dumper->Dump($_[0]); # not necessarily safe }; =head2 @CARP_NOT This variable, I, says which packages are I to be considered as the location of an error. The C and C functions will skip over callers when reporting where an error occurred. NB: This variable must be in the package's symbol table, thus: # These work our @CARP_NOT; # file scope use vars qw(@CARP_NOT); # package scope @My::Package::CARP_NOT = ... ; # explicit package variable # These don't work sub xyz { ... @CARP_NOT = ... } # w/o declarations above my @CARP_NOT; # even at top-level Example of use: package My::Carping::Package; use Carp; our @CARP_NOT; sub bar { .... or _error('Wrong input') } sub _error { # temporary control of where'ness, __PACKAGE__ is implicit local @CARP_NOT = qw(My::Friendly::Caller); carp(@_) } This would make C report the error as coming from a caller not in C, nor from C. Also read the L section above, about how C decides where the error is reported from. Use C<@CARP_NOT>, instead of C<$Carp::CarpLevel>. Overrides C's use of C<@ISA>. =head2 %Carp::Internal This says what packages are internal to Perl. C will never report an error as being from a line in a package that is internal to Perl. For example: $Carp::Internal{ (__PACKAGE__) }++; # time passes... sub foo { ... or confess("whatever") }; would give a full stack backtrace starting from the first caller outside of __PACKAGE__. (Unless that package was also internal to Perl.) =head2 %Carp::CarpInternal This says which packages are internal to Perl's warning system. For generating a full stack backtrace this is the same as being internal to Perl, the stack backtrace will not start inside packages that are listed in C<%Carp::CarpInternal>. But it is slightly different for the summary message generated by C or C. There errors will not be reported on any lines that are calling packages in C<%Carp::CarpInternal>. For example C itself is listed in C<%Carp::CarpInternal>. Therefore the full stack backtrace from C will not start inside of C, and the short message from calling C is not placed on the line where C was called. =head2 $Carp::CarpLevel This variable determines how many additional call frames are to be skipped that would not otherwise be when reporting where an error occurred on a call to one of C's functions. It is fairly easy to count these call frames on calls that generate a full stack backtrace. However it is much harder to do this accounting for calls that generate a short message. Usually people skip too many call frames. If they are lucky they skip enough that C goes all of the way through the call stack, realizes that something is wrong, and then generates a full stack backtrace. If they are unlucky then the error is reported from somewhere misleading very high in the call stack. Therefore it is best to avoid C<$Carp::CarpLevel>. Instead use C<@CARP_NOT>, C<%Carp::Internal> and C<%Carp::CarpInternal>. Defaults to C<0>. =head1 BUGS The Carp routines don't handle exception objects currently. If called with a first argument that is a reference, they simply call die() or warn(), as appropriate. =head1 SEE ALSO L, L =head1 CONTRIBUTING L is maintained by the perl 5 porters as part of the core perl 5 version control repository. Please see the L perldoc for how to submit patches and contribute to it. =head1 AUTHOR The Carp module first appeared in Larry Wall's perl 5.000 distribution. Since then it has been modified by several of the perl 5 porters. Andrew Main (Zefram) divested Carp into an independent distribution. =head1 COPYRIGHT Copyright (C) 1994-2013 Larry Wall Copyright (C) 2011, 2012, 2013 Andrew Main (Zefram) =head1 LICENSE This module is free software; you can redistribute it and/or modify it under the same terms as Perl itself. FILEfc7a47f7/Compress/Zlib.pm/ package Compress::Zlib; require 5.006 ; require Exporter; use Carp ; use IO::Handle ; use Scalar::Util qw(dualvar); use IO::Compress::Base::Common 2.213 ; use Compress::Raw::Zlib 2.213 ; use IO::Compress::Gzip 2.213 ; use IO::Uncompress::Gunzip 2.213 ; use strict ; use warnings ; use bytes ; our ($VERSION, $XS_VERSION, @ISA, @EXPORT, @EXPORT_OK, %EXPORT_TAGS); $VERSION = '2.213'; $XS_VERSION = $VERSION; $VERSION = eval $VERSION; @ISA = qw(Exporter); # Items to export into callers namespace by default. Note: do not export # names by default without a very good reason. Use EXPORT_OK instead. # Do not simply export all your public functions/methods/constants. @EXPORT = qw( deflateInit inflateInit compress uncompress gzopen $gzerrno ); push @EXPORT, @Compress::Raw::Zlib::EXPORT ; @EXPORT_OK = qw(memGunzip memGzip zlib_version); %EXPORT_TAGS = ( ALL => \@EXPORT ); BEGIN { *zlib_version = \&Compress::Raw::Zlib::zlib_version; } use constant FLAG_APPEND => 1 ; use constant FLAG_CRC => 2 ; use constant FLAG_ADLER => 4 ; use constant FLAG_CONSUME_INPUT => 8 ; our (@my_z_errmsg); @my_z_errmsg = ( "need dictionary", # Z_NEED_DICT 2 "stream end", # Z_STREAM_END 1 "", # Z_OK 0 "file error", # Z_ERRNO (-1) "stream error", # Z_STREAM_ERROR (-2) "data error", # Z_DATA_ERROR (-3) "insufficient memory", # Z_MEM_ERROR (-4) "buffer error", # Z_BUF_ERROR (-5) "incompatible version",# Z_VERSION_ERROR(-6) ); sub _set_gzerr { my $value = shift ; if ($value == 0) { $Compress::Zlib::gzerrno = 0 ; } elsif ($value == Z_ERRNO() || $value > 2) { $Compress::Zlib::gzerrno = $! ; } else { $Compress::Zlib::gzerrno = dualvar($value+0, $my_z_errmsg[2 - $value]); } return $value ; } sub _set_gzerr_undef { _set_gzerr(@_); return undef; } sub _save_gzerr { my $gz = shift ; my $test_eof = shift ; my $value = $gz->errorNo() || 0 ; my $eof = $gz->eof() ; if ($test_eof) { # gzread uses Z_STREAM_END to denote a successful end $value = Z_STREAM_END() if $gz->eof() && $value == 0 ; } _set_gzerr($value) ; } sub gzopen($$) { my ($file, $mode) = @_ ; my $gz ; my %defOpts = (Level => Z_DEFAULT_COMPRESSION(), Strategy => Z_DEFAULT_STRATEGY(), ); my $writing ; $writing = ! ($mode =~ /r/i) ; $writing = ($mode =~ /[wa]/i) ; $defOpts{Level} = $1 if $mode =~ /(\d)/; $defOpts{Strategy} = Z_FILTERED() if $mode =~ /f/i; $defOpts{Strategy} = Z_HUFFMAN_ONLY() if $mode =~ /h/i; $defOpts{Append} = 1 if $mode =~ /a/i; my $infDef = $writing ? 'deflate' : 'inflate'; my @params = () ; croak "gzopen: file parameter is not a filehandle or filename" unless isaFilehandle $file || isaFilename $file || (ref $file && ref $file eq 'SCALAR'); return undef unless $mode =~ /[rwa]/i ; _set_gzerr(0) ; if ($writing) { $gz = IO::Compress::Gzip->new($file, Minimal => 1, AutoClose => 1, %defOpts) or $Compress::Zlib::gzerrno = $IO::Compress::Gzip::GzipError; } else { $gz = IO::Uncompress::Gunzip->new($file, Transparent => 1, Append => 0, AutoClose => 1, MultiStream => 1, Strict => 0) or $Compress::Zlib::gzerrno = $IO::Uncompress::Gunzip::GunzipError; } return undef if ! defined $gz ; bless [$gz, $infDef], 'Compress::Zlib::gzFile'; } sub Compress::Zlib::gzFile::gzread { my $self = shift ; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'inflate'; my $len = defined $_[1] ? $_[1] : 4096 ; my $gz = $self->[0] ; if ($self->gzeof() || $len == 0) { # Zap the output buffer to match ver 1 behaviour. $_[0] = "" ; _save_gzerr($gz, 1); return 0 ; } my $status = $gz->read($_[0], $len) ; _save_gzerr($gz, 1); return $status ; } sub Compress::Zlib::gzFile::gzreadline { my $self = shift ; my $gz = $self->[0] ; { # Maintain backward compatibility with 1.x behaviour # It didn't support $/, so this can't either. local $/ = "\n" ; $_[0] = $gz->getline() ; } _save_gzerr($gz, 1); return defined $_[0] ? length $_[0] : 0 ; } sub Compress::Zlib::gzFile::gzwrite { my $self = shift ; my $gz = $self->[0] ; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'deflate'; $] >= 5.008 and (utf8::downgrade($_[0], 1) or croak "Wide character in gzwrite"); my $status = $gz->write($_[0]) ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gztell { my $self = shift ; my $gz = $self->[0] ; my $status = $gz->tell() ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzseek { my $self = shift ; my $offset = shift ; my $whence = shift ; my $gz = $self->[0] ; my $status ; eval { local $SIG{__DIE__}; $status = $gz->seek($offset, $whence) ; }; if ($@) { my $error = $@; $error =~ s/^.*: /gzseek: /; $error =~ s/ at .* line \d+\s*$//; croak $error; } _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzflush { my $self = shift ; my $f = shift ; my $gz = $self->[0] ; my $status = $gz->flush($f) ; my $err = _save_gzerr($gz); return $status ? 0 : $err; } sub Compress::Zlib::gzFile::gzclose { my $self = shift ; my $gz = $self->[0] ; my $status = $gz->close() ; my $err = _save_gzerr($gz); return $status ? 0 : $err; } sub Compress::Zlib::gzFile::gzeof { my $self = shift ; my $gz = $self->[0] ; return 0 if $self->[1] ne 'inflate'; my $status = $gz->eof() ; _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzsetparams { my $self = shift ; croak "Usage: Compress::Zlib::gzFile::gzsetparams(file, level, strategy)" unless @_ eq 2 ; my $gz = $self->[0] ; my $level = shift ; my $strategy = shift; return _set_gzerr(Z_STREAM_ERROR()) if $self->[1] ne 'deflate'; my $status = *$gz->{Compress}->deflateParams(-Level => $level, -Strategy => $strategy); _save_gzerr($gz); return $status ; } sub Compress::Zlib::gzFile::gzerror { my $self = shift ; my $gz = $self->[0] ; return $Compress::Zlib::gzerrno ; } sub compress($;$) { my ($x, $output, $err, $in) =('', '', '', '') ; if (ref $_[0] ) { $in = $_[0] ; croak "not a scalar reference" unless ref $in eq 'SCALAR' ; } else { $in = \$_[0] ; } $] >= 5.008 and (utf8::downgrade($$in, 1) or croak "Wide character in compress"); my $level = (@_ == 2 ? $_[1] : Z_DEFAULT_COMPRESSION() ); $x = Compress::Raw::Zlib::_deflateInit(FLAG_APPEND, $level, Z_DEFLATED, MAX_WBITS, MAX_MEM_LEVEL, Z_DEFAULT_STRATEGY, 4096, '') or return undef ; $err = $x->deflate($in, $output) ; return undef unless $err == Z_OK() ; $err = $x->flush($output) ; return undef unless $err == Z_OK() ; return $output ; } sub uncompress($) { my ($output, $in) =('', '') ; if (ref $_[0] ) { $in = $_[0] ; croak "not a scalar reference" unless ref $in eq 'SCALAR' ; } else { $in = \$_[0] ; } $] >= 5.008 and (utf8::downgrade($$in, 1) or croak "Wide character in uncompress"); my ($obj, $status) = Compress::Raw::Zlib::_inflateInit(0, MAX_WBITS, 4096, "") ; $status == Z_OK or return undef; $obj->inflate($in, $output) == Z_STREAM_END or return undef; return $output; } sub deflateInit(@) { my ($got) = ParseParameters(0, { 'bufsize' => [IO::Compress::Base::Common::Parse_unsigned, 4096], 'level' => [IO::Compress::Base::Common::Parse_signed, Z_DEFAULT_COMPRESSION()], 'method' => [IO::Compress::Base::Common::Parse_unsigned, Z_DEFLATED()], 'windowbits' => [IO::Compress::Base::Common::Parse_signed, MAX_WBITS()], 'memlevel' => [IO::Compress::Base::Common::Parse_unsigned, MAX_MEM_LEVEL()], 'strategy' => [IO::Compress::Base::Common::Parse_unsigned, Z_DEFAULT_STRATEGY()], 'dictionary' => [IO::Compress::Base::Common::Parse_any, ""], }, @_ ) ; croak "Compress::Zlib::deflateInit: Bufsize must be >= 1, you specified " . $got->getValue('bufsize') unless $got->getValue('bufsize') >= 1; my $obj ; my $status = 0 ; ($obj, $status) = Compress::Raw::Zlib::_deflateInit(0, $got->getValue('level'), $got->getValue('method'), $got->getValue('windowbits'), $got->getValue('memlevel'), $got->getValue('strategy'), $got->getValue('bufsize'), $got->getValue('dictionary')) ; my $x = ($status == Z_OK() ? bless $obj, "Zlib::OldDeflate" : undef) ; return wantarray ? ($x, $status) : $x ; } sub inflateInit(@) { my ($got) = ParseParameters(0, { 'bufsize' => [IO::Compress::Base::Common::Parse_unsigned, 4096], 'windowbits' => [IO::Compress::Base::Common::Parse_signed, MAX_WBITS()], 'dictionary' => [IO::Compress::Base::Common::Parse_any, ""], }, @_) ; croak "Compress::Zlib::inflateInit: Bufsize must be >= 1, you specified " . $got->getValue('bufsize') unless $got->getValue('bufsize') >= 1; my $status = 0 ; my $obj ; ($obj, $status) = Compress::Raw::Zlib::_inflateInit(FLAG_CONSUME_INPUT, $got->getValue('windowbits'), $got->getValue('bufsize'), $got->getValue('dictionary')) ; my $x = ($status == Z_OK() ? bless $obj, "Zlib::OldInflate" : undef) ; wantarray ? ($x, $status) : $x ; } package Zlib::OldDeflate ; our (@ISA); @ISA = qw(Compress::Raw::Zlib::deflateStream); sub deflate { my $self = shift ; my $output ; my $status = $self->SUPER::deflate($_[0], $output) ; wantarray ? ($output, $status) : $output ; } sub flush { my $self = shift ; my $output ; my $flag = shift || Compress::Zlib::Z_FINISH(); my $status = $self->SUPER::flush($output, $flag) ; wantarray ? ($output, $status) : $output ; } package Zlib::OldInflate ; our (@ISA); @ISA = qw(Compress::Raw::Zlib::inflateStream); sub inflate { my $self = shift ; my $output ; my $status = $self->SUPER::inflate($_[0], $output) ; wantarray ? ($output, $status) : $output ; } package Compress::Zlib ; use IO::Compress::Gzip::Constants 2.213 ; sub memGzip($) { _set_gzerr(0); my $x = Compress::Raw::Zlib::_deflateInit(FLAG_APPEND|FLAG_CRC, Z_BEST_COMPRESSION, Z_DEFLATED, -MAX_WBITS(), MAX_MEM_LEVEL, Z_DEFAULT_STRATEGY, 4096, '') or return undef ; # if the deflation buffer isn't a reference, make it one my $string = (ref $_[0] ? $_[0] : \$_[0]) ; $] >= 5.008 and (utf8::downgrade($$string, 1) or croak "Wide character in memGzip"); my $out; my $status ; $x->deflate($string, $out) == Z_OK or return undef ; $x->flush($out) == Z_OK or return undef ; return IO::Compress::Gzip::Constants::GZIP_MINIMUM_HEADER . $out . pack("V V", $x->crc32(), $x->total_in()); } sub _removeGzipHeader($) { my $string = shift ; return Z_DATA_ERROR() if length($$string) < GZIP_MIN_HEADER_SIZE ; my ($magic1, $magic2, $method, $flags, $time, $xflags, $oscode) = unpack ('CCCCVCC', $$string); return Z_DATA_ERROR() unless $magic1 == GZIP_ID1 and $magic2 == GZIP_ID2 and $method == Z_DEFLATED() and !($flags & GZIP_FLG_RESERVED) ; substr($$string, 0, GZIP_MIN_HEADER_SIZE) = '' ; # skip extra field if ($flags & GZIP_FLG_FEXTRA) { return Z_DATA_ERROR() if length($$string) < GZIP_FEXTRA_HEADER_SIZE ; my ($extra_len) = unpack ('v', $$string); $extra_len += GZIP_FEXTRA_HEADER_SIZE; return Z_DATA_ERROR() if length($$string) < $extra_len ; substr($$string, 0, $extra_len) = ''; } # skip orig name if ($flags & GZIP_FLG_FNAME) { my $name_end = index ($$string, GZIP_NULL_BYTE); return Z_DATA_ERROR() if $name_end == -1 ; substr($$string, 0, $name_end + 1) = ''; } # skip comment if ($flags & GZIP_FLG_FCOMMENT) { my $comment_end = index ($$string, GZIP_NULL_BYTE); return Z_DATA_ERROR() if $comment_end == -1 ; substr($$string, 0, $comment_end + 1) = ''; } # skip header crc if ($flags & GZIP_FLG_FHCRC) { return Z_DATA_ERROR() if length ($$string) < GZIP_FHCRC_SIZE ; substr($$string, 0, GZIP_FHCRC_SIZE) = ''; } return Z_OK(); } sub _ret_gun_error { $Compress::Zlib::gzerrno = $IO::Uncompress::Gunzip::GunzipError; return undef; } sub memGunzip($) { # if the buffer isn't a reference, make it one my $string = (ref $_[0] ? $_[0] : \$_[0]); $] >= 5.008 and (utf8::downgrade($$string, 1) or croak "Wide character in memGunzip"); _set_gzerr(0); my $status = _removeGzipHeader($string) ; $status == Z_OK() or return _set_gzerr_undef($status); my $bufsize = length $$string > 4096 ? length $$string : 4096 ; my $x = Compress::Raw::Zlib::_inflateInit(FLAG_CRC | FLAG_CONSUME_INPUT, -MAX_WBITS(), $bufsize, '') or return _ret_gun_error(); my $output = '' ; $status = $x->inflate($string, $output); if ( $status == Z_OK() ) { _set_gzerr(Z_DATA_ERROR()); return undef; } return _ret_gun_error() if ($status != Z_STREAM_END()); if (length $$string >= 8) { my ($crc, $len) = unpack ("VV", substr($$string, 0, 8)); substr($$string, 0, 8) = ''; return _set_gzerr_undef(Z_DATA_ERROR()) unless $len == length($output) and $crc == Compress::Raw::Zlib::crc32($output); } else { $$string = ''; } return $output; } # Autoload methods go after __END__, and are processed by the autosplit program. 1; __END__ =head1 NAME Compress::Zlib - Interface to zlib compression library =head1 SYNOPSIS use Compress::Zlib ; ($d, $status) = deflateInit( [OPT] ) ; $status = $d->deflate($input, $output) ; $status = $d->flush([$flush_type]) ; $d->deflateParams(OPTS) ; $d->deflateTune(OPTS) ; $d->dict_adler() ; $d->crc32() ; $d->adler32() ; $d->total_in() ; $d->total_out() ; $d->msg() ; $d->get_Strategy(); $d->get_Level(); $d->get_BufSize(); ($i, $status) = inflateInit( [OPT] ) ; $status = $i->inflate($input, $output [, $eof]) ; $status = $i->inflateSync($input) ; $i->dict_adler() ; $d->crc32() ; $d->adler32() ; $i->total_in() ; $i->total_out() ; $i->msg() ; $d->get_BufSize(); $dest = compress($source) ; $dest = uncompress($source) ; $gz = gzopen($filename or filehandle, $mode) ; $bytesread = $gz->gzread($buffer [,$size]) ; $bytesread = $gz->gzreadline($line) ; $byteswritten = $gz->gzwrite($buffer) ; $status = $gz->gzflush($flush) ; $offset = $gz->gztell() ; $status = $gz->gzseek($offset, $whence) ; $status = $gz->gzclose() ; $status = $gz->gzeof() ; $status = $gz->gzsetparams($level, $strategy) ; $errstring = $gz->gzerror() ; $gzerrno $dest = Compress::Zlib::memGzip($buffer) ; $dest = Compress::Zlib::memGunzip($buffer) ; $crc = adler32($buffer [,$crc]) ; $crc = crc32($buffer [,$crc]) ; $crc = crc32_combine($crc1, $crc2, $len2); $adler = adler32_combine($adler1, $adler2, $len2); my $version = Compress::Raw::Zlib::zlib_version(); =head1 DESCRIPTION The I module provides a Perl interface to the I compression library (see L for details about where to get I). The C module can be split into two general areas of functionality, namely a simple read/write interface to I files and a low-level in-memory compression/decompression interface. Each of these areas will be discussed in the following sections. =head2 Notes for users of Compress::Zlib version 1 The main change in C version 2.x is that it does not now interface directly to the zlib library. Instead it uses the C and C modules for reading/writing gzip files, and the C module for some low-level zlib access. The interface provided by version 2 of this module should be 100% backward compatible with version 1. If you find a difference in the expected behaviour please contact the author (See L). See L With the creation of the C and C modules no new features are planned for C - the new modules do everything that C does and then some. Development on C will be limited to bug fixes only. If you are writing new code, your first port of call should be one of the new C or C modules. =head1 GZIP INTERFACE A number of functions are supplied in I for reading and writing I files that conform to RFC 1952. This module provides an interface to most of them. If you have previously used C 1.x, the following enhancements/changes have been made to the C interface: =over 5 =item 1 If you want to open either STDIN or STDOUT with C, you can now optionally use the special filename "C<->" as a synonym for C<\*STDIN> and C<\*STDOUT>. =item 2 In C version 1.x, C used the zlib library to open the underlying file. This made things especially tricky when a Perl filehandle was passed to C. Behind the scenes the numeric C file descriptor had to be extracted from the Perl filehandle and this passed to the zlib library. Apart from being non-portable to some operating systems, this made it difficult to use C in situations where you wanted to extract/create a gzip data stream that is embedded in a larger file, without having to resort to opening and closing the file multiple times. It also made it impossible to pass a perl filehandle that wasn't associated with a real filesystem file, like, say, an C. In C version 2.x, the C interface has been completely rewritten to use the L for writing gzip files and L for reading gzip files. None of the limitations mentioned above apply. =item 3 Addition of C to provide a restricted C interface. =item 4. Added C. =back A more complete and flexible interface for reading/writing gzip files/buffers is included with the module C. See L and L for more details. =over 5 =item B<$gz = gzopen($filename, $mode)> =item B<$gz = gzopen($filehandle, $mode)> This function opens either the I file C<$filename> for reading or writing or attaches to the opened filehandle, C<$filehandle>. It returns an object on success and C on failure. When writing a gzip file this interface will I create the smallest possible gzip header (exactly 10 bytes). If you want greater control over what gets stored in the gzip header (like the original filename or a comment) use L instead. Similarly if you want to read the contents of the gzip header use L. The second parameter, C<$mode>, is used to specify whether the file is opened for reading or writing and to optionally specify a compression level and compression strategy when writing. The format of the C<$mode> parameter is similar to the mode parameter to the 'C' function C, so "rb" is used to open for reading, "wb" for writing and "ab" for appending (writing at the end of the file). To specify a compression level when writing, append a digit between 0 and 9 to the mode string -- 0 means no compression and 9 means maximum compression. If no compression level is specified Z_DEFAULT_COMPRESSION is used. To specify the compression strategy when writing, append 'f' for filtered data, 'h' for Huffman only compression, or 'R' for run-length encoding. If no strategy is specified Z_DEFAULT_STRATEGY is used. So, for example, "wb9" means open for writing with the maximum compression using the default strategy and "wb4R" means open for writing with compression level 4 and run-length encoding. Refer to the I documentation for the exact format of the C<$mode> parameter. =item B<$bytesread = $gz-Egzread($buffer [, $size]) ;> Reads C<$size> bytes from the compressed file into C<$buffer>. If C<$size> is not specified, it will default to 4096. If the scalar C<$buffer> is not large enough, it will be extended automatically. Returns the number of bytes actually read. On EOF it returns 0 and in the case of an error, -1. =item B<$bytesread = $gz-Egzreadline($line) ;> Reads the next line from the compressed file into C<$line>. Returns the number of bytes actually read. On EOF it returns 0 and in the case of an error, -1. It is legal to intermix calls to C and C. To maintain backward compatibility with version 1.x of this module C ignores the C<$/> variable - it I uses the string C<"\n"> as the line delimiter. If you want to read a gzip file a line at a time and have it respect the C<$/> variable (or C<$INPUT_RECORD_SEPARATOR>, or C<$RS> when C is in use) see L. =item B<$byteswritten = $gz-Egzwrite($buffer) ;> Writes the contents of C<$buffer> to the compressed file. Returns the number of bytes actually written, or 0 on error. =item B<$status = $gz-Egzflush($flush_type) ;> Flushes all pending output into the compressed file. This method takes an optional parameter, C<$flush_type>, that controls how the flushing will be carried out. By default the C<$flush_type> used is C. Other valid values for C<$flush_type> are C, C, C and C. It is strongly recommended that you only set the C parameter if you fully understand the implications of what it does - overuse of C can seriously degrade the level of compression achieved. See the C documentation for details. Returns 0 on success. =item B<$offset = $gz-Egztell() ;> Returns the uncompressed file offset. =item B<$status = $gz-Egzseek($offset, $whence) ;> Provides a sub-set of the C functionality, with the restriction that it is only legal to seek forward in the compressed file. It is a fatal error to attempt to seek backward. When opened for writing, empty parts of the file will have NULL (0x00) bytes written to them. The C<$whence> parameter should be one of SEEK_SET, SEEK_CUR or SEEK_END. Returns 1 on success, 0 on failure. =item B<$gz-Egzclose> Closes the compressed file. Any pending data is flushed to the file before it is closed. Returns 0 on success. =item B<$gz-Egzsetparams($level, $strategy> Change settings for the deflate stream C<$gz>. The list of the valid options is shown below. Options not specified will remain unchanged. Note: This method is only available if you are running zlib 1.0.6 or better. =over 5 =item B<$level> Defines the compression level. Valid values are 0 through 9, C, C, C, and C. =item B<$strategy> Defines the strategy used to tune the compression. The valid values are C, C and C. =back =item B<$gz-Egzerror> Returns the I error message or number for the last operation associated with C<$gz>. The return value will be the I error number when used in a numeric context and the I error message when used in a string context. The I error number constants, shown below, are available for use. Z_OK Z_STREAM_END Z_ERRNO Z_STREAM_ERROR Z_DATA_ERROR Z_MEM_ERROR Z_BUF_ERROR =item B<$gzerrno> The C<$gzerrno> scalar holds the error code associated with the most recent I routine. Note that unlike C, the error is I associated with a particular file. As with C it returns an error number in numeric context and an error message in string context. Unlike C though, the error message will correspond to the I message when the error is associated with I itself, or the UNIX error message when it is not (i.e. I returned C). As there is an overlap between the error numbers used by I and UNIX, C<$gzerrno> should only be used to check for the presence of I error in numeric context. Use C to check for specific I errors. The I example below shows how the variable can be used safely. =back =head2 Examples Here is an example script which uses the interface. It implements a I function. use strict ; use warnings ; use Compress::Zlib ; # use stdin if no files supplied @ARGV = '-' unless @ARGV ; foreach my $file (@ARGV) { my $buffer ; my $gz = gzopen($file, "rb") or die "Cannot open $file: $gzerrno\n" ; print $buffer while $gz->gzread($buffer) > 0 ; die "Error reading from $file: $gzerrno" . ($gzerrno+0) . "\n" if $gzerrno != Z_STREAM_END ; $gz->gzclose() ; } Below is a script which makes use of C. It implements a very simple I like script. use strict ; use warnings ; use Compress::Zlib ; die "Usage: gzgrep pattern [file...]\n" unless @ARGV >= 1; my $pattern = shift ; # use stdin if no files supplied @ARGV = '-' unless @ARGV ; foreach my $file (@ARGV) { my $gz = gzopen($file, "rb") or die "Cannot open $file: $gzerrno\n" ; while ($gz->gzreadline($_) > 0) { print if /$pattern/ ; } die "Error reading from $file: $gzerrno\n" if $gzerrno != Z_STREAM_END ; $gz->gzclose() ; } This script, I, does the opposite of the I script above. It reads from standard input and writes a gzip data stream to standard output. use strict ; use warnings ; use Compress::Zlib ; binmode STDOUT; # gzopen only sets it on the fd my $gz = gzopen(\*STDOUT, "wb") or die "Cannot open stdout: $gzerrno\n" ; while (<>) { $gz->gzwrite($_) or die "error writing: $gzerrno\n" ; } $gz->gzclose ; =head2 Compress::Zlib::memGzip This function is used to create an in-memory gzip file with the minimum possible gzip header (exactly 10 bytes). $dest = Compress::Zlib::memGzip($buffer) or die "Cannot compress: $gzerrno\n"; If successful, it returns the in-memory gzip file. Otherwise it returns C and the C<$gzerrno> variable will store the zlib error code. The C<$buffer> parameter can either be a scalar or a scalar reference. See L for an alternative way to carry out in-memory gzip compression. =head2 Compress::Zlib::memGunzip This function is used to uncompress an in-memory gzip file. $dest = Compress::Zlib::memGunzip($buffer) or die "Cannot uncompress: $gzerrno\n"; If successful, it returns the uncompressed gzip file. Otherwise it returns C and the C<$gzerrno> variable will store the zlib error code. The C<$buffer> parameter can either be a scalar or a scalar reference. The contents of the C<$buffer> parameter are destroyed after calling this function. If C<$buffer> consists of multiple concatenated gzip data streams only the first will be uncompressed. Use C with the C option in the C module if you need to deal with concatenated data streams. See L for an alternative way to carry out in-memory gzip uncompression. =head1 COMPRESS/UNCOMPRESS Two functions are provided to perform in-memory compression/uncompression of RFC 1950 data streams. They are called C and C. =over 5 =item B<$dest = compress($source [, $level] ) ;> Compresses C<$source>. If successful it returns the compressed data. Otherwise it returns I. The source buffer, C<$source>, can either be a scalar or a scalar reference. The C<$level> parameter defines the compression level. Valid values are 0 through 9, C, C, C, and C. If C<$level> is not specified C will be used. =item B<$dest = uncompress($source) ;> Uncompresses C<$source>. If successful it returns the uncompressed data. Otherwise it returns I. The source buffer can either be a scalar or a scalar reference. =back Please note: the two functions defined above are I compatible with the Unix commands of the same name. See L and L included with this distribution for an alternative interface for reading/writing RFC 1950 files/buffers. =head1 Deflate Interface This section defines an interface that allows in-memory compression using the I interface provided by zlib. Here is a definition of the interface available: =head2 B<($d, $status) = deflateInit( [OPT] )> Initialises a deflation stream. It combines the features of the I functions C, C and C. If successful, it will return the initialised deflation stream, C<$d> and C<$status> of C in a list context. In scalar context it returns the deflation stream, C<$d>, only. If not successful, the returned deflation stream (C<$d>) will be I and C<$status> will hold the exact I error code. The function optionally takes a number of named options specified as C<< -Name=>value >> pairs. This allows individual options to be tailored without having to specify them all in the parameter list. For backward compatibility, it is also possible to pass the parameters as a reference to a hash containing the name=>value pairs. The function takes one optional parameter, a reference to a hash. The contents of the hash allow the deflation interface to be tailored. Here is a list of the valid options: =over 5 =item B<-Level> Defines the compression level. Valid values are 0 through 9, C, C, C, and C. The default is Z_DEFAULT_COMPRESSION. =item B<-Method> Defines the compression method. The only valid value at present (and the default) is Z_DEFLATED. =item B<-WindowBits> To create an RFC 1950 data stream, set C to a positive number. To create an RFC 1951 data stream, set C to C<-MAX_WBITS>. For a full definition of the meaning and valid values for C refer to the I documentation for I. Defaults to MAX_WBITS. =item B<-MemLevel> For a definition of the meaning and valid values for C refer to the I documentation for I. Defaults to MAX_MEM_LEVEL. =item B<-Strategy> Defines the strategy used to tune the compression. The valid values are C, C and C. The default is Z_DEFAULT_STRATEGY. =item B<-Dictionary> When a dictionary is specified I will automatically call C directly after calling C. The Adler32 value for the dictionary can be obtained by calling the method C<< $d->dict_adler() >>. The default is no dictionary. =item B<-Bufsize> Sets the initial size for the deflation buffer. If the buffer has to be reallocated to increase the size, it will grow in increments of C. The default is 4096. =back Here is an example of using the C optional parameter list to override the default buffer size and compression level. All other options will take their default values. deflateInit( -Bufsize => 300, -Level => Z_BEST_SPEED ) ; =head2 B<($out, $status) = $d-Edeflate($buffer)> Deflates the contents of C<$buffer>. The buffer can either be a scalar or a scalar reference. When finished, C<$buffer> will be completely processed (assuming there were no errors). If the deflation was successful it returns the deflated output, C<$out>, and a status value, C<$status>, of C. On error, C<$out> will be I and C<$status> will contain the I error code. In a scalar context C will return C<$out> only. As with the I function in I, it is not necessarily the case that any output will be produced by this method. So don't rely on the fact that C<$out> is empty for an error test. =head2 B<($out, $status) = $d-Eflush()> =head2 B<($out, $status) = $d-Eflush($flush_type)> Typically used to finish the deflation. Any pending output will be returned via C<$out>. C<$status> will have a value C if successful. In a scalar context C will return C<$out> only. Note that flushing can seriously degrade the compression ratio, so it should only be used to terminate a decompression (using C) or when you want to create a I (using C). By default the C used is C. Other valid values for C are C, C, C and C. It is strongly recommended that you only set the C parameter if you fully understand the implications of what it does. See the C documentation for details. =head2 B<$status = $d-EdeflateParams([OPT])> Change settings for the deflate stream C<$d>. The list of the valid options is shown below. Options not specified will remain unchanged. =over 5 =item B<-Level> Defines the compression level. Valid values are 0 through 9, C, C, C, and C. =item B<-Strategy> Defines the strategy used to tune the compression. The valid values are C, C and C. =back =head2 B<$d-Edict_adler()> Returns the adler32 value for the dictionary. =head2 B<$d-Emsg()> Returns the last error message generated by zlib. =head2 B<$d-Etotal_in()> Returns the total number of bytes uncompressed bytes input to deflate. =head2 B<$d-Etotal_out()> Returns the total number of compressed bytes output from deflate. =head2 Example Here is a trivial example of using C. It simply reads standard input, deflates it and writes it to standard output. use strict ; use warnings ; use Compress::Zlib ; binmode STDIN; binmode STDOUT; my $x = deflateInit() or die "Cannot create a deflation stream\n" ; my ($output, $status) ; while (<>) { ($output, $status) = $x->deflate($_) ; $status == Z_OK or die "deflation failed\n" ; print $output ; } ($output, $status) = $x->flush() ; $status == Z_OK or die "deflation failed\n" ; print $output ; =head1 Inflate Interface This section defines the interface available that allows in-memory uncompression using the I interface provided by zlib. Here is a definition of the interface: =head2 B<($i, $status) = inflateInit()> Initialises an inflation stream. In a list context it returns the inflation stream, C<$i>, and the I status code in C<$status>. In a scalar context it returns the inflation stream only. If successful, C<$i> will hold the inflation stream and C<$status> will be C. If not successful, C<$i> will be I and C<$status> will hold the I error code. The function optionally takes a number of named options specified as C<< -Name=>value >> pairs. This allows individual options to be tailored without having to specify them all in the parameter list. For backward compatibility, it is also possible to pass the parameters as a reference to a hash containing the name=>value pairs. The function takes one optional parameter, a reference to a hash. The contents of the hash allow the deflation interface to be tailored. Here is a list of the valid options: =over 5 =item B<-WindowBits> To uncompress an RFC 1950 data stream, set C to a positive number. To uncompress an RFC 1951 data stream, set C to C<-MAX_WBITS>. For a full definition of the meaning and valid values for C refer to the I documentation for I. Defaults to MAX_WBITS. =item B<-Bufsize> Sets the initial size for the inflation buffer. If the buffer has to be reallocated to increase the size, it will grow in increments of C. Default is 4096. =item B<-Dictionary> The default is no dictionary. =back Here is an example of using the C optional parameter to override the default buffer size. inflateInit( -Bufsize => 300 ) ; =head2 B<($out, $status) = $i-Einflate($buffer)> Inflates the complete contents of C<$buffer>. The buffer can either be a scalar or a scalar reference. Returns C if successful and C if the end of the compressed data has been successfully reached. If not successful, C<$out> will be I and C<$status> will hold the I error code. The C<$buffer> parameter is modified by C. On completion it will contain what remains of the input buffer after inflation. This means that C<$buffer> will be an empty string when the return status is C. When the return status is C the C<$buffer> parameter will contains what (if anything) was stored in the input buffer after the deflated data stream. This feature is useful when processing a file format that encapsulates a compressed data stream (e.g. gzip, zip). =head2 B<$status = $i-EinflateSync($buffer)> Scans C<$buffer> until it reaches either a I or the end of the buffer. If a I is found, C is returned and C<$buffer> will be have all data up to the flush point removed. This can then be passed to the C method. Any other return code means that a flush point was not found. If more data is available, C can be called repeatedly with more compressed data until the flush point is found. =head2 B<$i-Edict_adler()> Returns the adler32 value for the dictionary. =head2 B<$i-Emsg()> Returns the last error message generated by zlib. =head2 B<$i-Etotal_in()> Returns the total number of bytes compressed bytes input to inflate. =head2 B<$i-Etotal_out()> Returns the total number of uncompressed bytes output from inflate. =head2 Example Here is an example of using C. use strict ; use warnings ; use Compress::Zlib ; my $x = inflateInit() or die "Cannot create a inflation stream\n" ; my $input = '' ; binmode STDIN; binmode STDOUT; my ($output, $status) ; while (read(STDIN, $input, 4096)) { ($output, $status) = $x->inflate(\$input) ; print $output if $status == Z_OK or $status == Z_STREAM_END ; last if $status != Z_OK ; } die "inflation failed\n" unless $status == Z_STREAM_END ; =head1 CHECKSUM FUNCTIONS Two functions are provided by I to calculate checksums. For the Perl interface, the order of the two parameters in both functions has been reversed. This allows both running checksums and one off calculations to be done. $crc = adler32($buffer [,$crc]) ; $crc = crc32($buffer [,$crc]) ; The buffer parameters can either be a scalar or a scalar reference. If the $crc parameters is C, the crc value will be reset. If you have built this module with zlib 1.2.3 or better, two more CRC-related functions are available. $crc = crc32_combine($crc1, $crc2, $len2); $adler = adler32_combine($adler1, $adler2, $len2); These functions allow checksums to be merged. Refer to the I documentation for more details. =head1 Misc =head2 my $version = Compress::Zlib::zlib_version(); Returns the version of the zlib library. =head1 CONSTANTS All the I constants are automatically imported when you make use of I. =head1 SUPPORT General feedback/questions/bug reports should be sent to L (preferred) or L. =head1 SEE ALSO L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L L L, L, L, L For RFC 1950, 1951 and 1952 see L, L and L The I compression library was written by Jean-loup Gailly C and Mark Adler C. The primary site for the I compression library is L. The primary site for the I compression library is L. The primary site for gzip is L. =head1 AUTHOR This module was written by Paul Marquess, C. =head1 MODIFICATION HISTORY See the Changes file. =head1 COPYRIGHT AND LICENSE Copyright (c) 1995-2024 Paul Marquess. All rights reserved. This program is free software; you can redistribute it and/or modify it under the same terms as Perl itself. FILE3f6ee9b5/Exporter.pmK package Exporter; use strict; no strict 'refs'; our $Debug = 0; our $ExportLevel = 0; our $Verbose ||= 0; our $VERSION = '5.79'; our %Cache; sub as_heavy { require Exporter::Heavy; # Unfortunately, this does not work if the caller is aliased as *name = \&foo # Thus the need to create a lot of identical subroutines my $c = (caller(1))[3]; $c =~ s/.*:://; \&{"Exporter::Heavy::heavy_$c"}; } sub export { goto &{as_heavy()}; } sub import { my $pkg = shift; my $callpkg = caller($ExportLevel); if ($pkg eq "Exporter" and @_ and $_[0] eq "import") { *{$callpkg."::import"} = \&import; return; } # We *need* to treat @{"$pkg\::EXPORT_FAIL"} since Carp uses it :-( my $exports = \@{"$pkg\::EXPORT"}; # But, avoid creating things if they don't exist, which saves a couple of # hundred bytes per package processed. my $fail = ${$pkg . '::'}{EXPORT_FAIL} && \@{"$pkg\::EXPORT_FAIL"}; return export $pkg, $callpkg, @_ if $Verbose or $Debug or $fail && @$fail > 1; my $export_cache = ($Cache{$pkg} ||= {}); my $args = @_ or @_ = @$exports; if ($args and not %$export_cache) { s/^&//, $export_cache->{$_} = 1 foreach (@$exports, @{"$pkg\::EXPORT_OK"}); } my $heavy; # Try very hard not to use {} and hence have to enter scope on the foreach # We bomb out of the loop with last as soon as heavy is set. if ($args or $fail) { ($heavy = (/\W/ or $args and not exists $export_cache->{$_} or $fail and @$fail and $_ eq $fail->[0])) and last foreach (@_); } else { ($heavy = /\W/) and last foreach (@_); } return export $pkg, $callpkg, ($args ? @_ : ()) if $heavy; local $SIG{__WARN__} = sub {require Carp; &Carp::carp} if not $SIG{__WARN__}; # shortcut for the common case of no type character *{"$callpkg\::$_"} = \&{"$pkg\::$_"} foreach @_; } # Default methods sub export_fail { my $self = shift; @_; } # Unfortunately, caller(1)[3] "does not work" if the caller is aliased as # *name = \&foo. Thus the need to create a lot of identical subroutines # Otherwise we could have aliased them to export(). sub export_to_level { goto &{as_heavy()}; } sub export_tags { goto &{as_heavy()}; } sub export_ok_tags { goto &{as_heavy()}; } sub require_version { goto &{as_heavy()}; } 1; __END__ =head1 NAME Exporter - Implements default import method for modules =head1 SYNOPSIS In module F: package YourModule; use Exporter 'import'; our @EXPORT_OK = qw(munge frobnicate); # symbols to export on request or package YourModule; require Exporter; our @ISA = qw(Exporter); # inherit all of Exporter's methods our @EXPORT_OK = qw(munge frobnicate); # symbols to export on request or package YourModule; use parent 'Exporter'; # inherit all of Exporter's methods our @EXPORT_OK = qw(munge frobnicate); # symbols to export on request In other files which wish to use C: use YourModule qw(frobnicate); # import listed symbols frobnicate ($left, $right) # calls YourModule::frobnicate Take a look at L for some variants you will like to use in modern Perl code. =head1 DESCRIPTION The Exporter module implements an C method which allows a module to export functions and variables to its users' namespaces. Many modules use Exporter rather than implementing their own C method because Exporter provides a highly flexible interface, with an implementation optimised for the common case. Perl automatically calls the C method when processing a C statement for a module. Modules and C are documented in L and L. Understanding the concept of modules and how the C statement operates is important to understanding the Exporter. =head2 How to Export The arrays C<@EXPORT> and C<@EXPORT_OK> in a module hold lists of symbols that are going to be exported into the users name space by default, or which they can request to be exported, respectively. The symbols can represent functions, scalars, arrays, hashes, or typeglobs. The symbols must be given by full name with the exception that the ampersand in front of a function is optional, e.g. our @EXPORT = qw(afunc $scalar @array); # afunc is a function our @EXPORT_OK = qw(&bfunc %hash *typeglob); # explicit prefix on &bfunc If you are only exporting function names it is recommended to omit the ampersand, as the implementation is faster this way. =head2 Selecting What to Export Do B export method names! Do B export anything else by default without a good reason! Exports pollute the namespace of the module user. If you must export try to use C<@EXPORT_OK> in preference to C<@EXPORT> and avoid short or common symbol names to reduce the risk of name clashes. Generally anything not exported is still accessible from outside the module using the C (or C<< $blessed_ref->method >>) syntax. By convention you can use a leading underscore on names to informally indicate that they are 'internal' and not for public use. (It is actually possible to get private functions by saying: my $subref = sub { ... }; $subref->(@args); # Call it as a function $obj->$subref(@args); # Use it as a method However if you use them for methods it is up to you to figure out how to make inheritance work.) As a general rule, if the module is trying to be object oriented then export nothing. If it's just a collection of functions then C<@EXPORT_OK> anything but use C<@EXPORT> with caution. For function and method names use barewords in preference to names prefixed with ampersands for the export lists. Other module design guidelines can be found in L. =head2 How to Import In other files which wish to use your module there are three basic ways for them to load your module and import its symbols: =over 4 =item C This imports all the symbols from YourModule's C<@EXPORT> into the namespace of the C statement. =item C This causes perl to load your module but does not import any symbols. =item C This imports only the symbols listed by the caller into their namespace. All listed symbols must be in your C<@EXPORT> or C<@EXPORT_OK>, else an error occurs. The advanced export features of Exporter are accessed like this, but with list entries that are syntactically distinct from symbol names. =back Unless you want to use its advanced features, this is probably all you need to know to use Exporter. =head1 Advanced Features =head2 Specialised Import Lists If any of the entries in an import list begins with !, : or / then the list is treated as a series of specifications which either add to or delete from the list of names to import. They are processed left to right. Specifications are in the form: [!]name This name only [!]:DEFAULT All names in @EXPORT [!]:tag All names in $EXPORT_TAGS{tag} anonymous array [!]/pattern/ All names in @EXPORT and @EXPORT_OK which match A leading ! indicates that matching names should be deleted from the list of names to import. If the first specification is a deletion it is treated as though preceded by :DEFAULT. If you just want to import extra names in addition to the default set you will still need to include :DEFAULT explicitly. e.g., F defines: our @EXPORT = qw(A1 A2 A3 A4 A5); our @EXPORT_OK = qw(B1 B2 B3 B4 B5); our %EXPORT_TAGS = (T1 => [qw(A1 A2 B1 B2)], T2 => [qw(A1 A2 B3 B4)]); Note that you cannot use tags in @EXPORT or @EXPORT_OK. Names in EXPORT_TAGS must also appear in @EXPORT or @EXPORT_OK. An application using Module can say something like: use Module qw(:DEFAULT :T2 !B3 A3); Other examples include: use Socket qw(!/^[AP]F_/ !SOMAXCONN !SOL_SOCKET); use POSIX qw(:errno_h :termios_h !TCSADRAIN !/^EXIT/); Remember that most patterns (using //) will need to be anchored with a leading ^, e.g., C rather than C. You can say C to see how the specifications are being processed and what is actually being imported into modules. =head2 Exporting Without Using Exporter's import Method Exporter has a special method, 'export_to_level' which is used in situations where you can't directly call Exporter's import method. The export_to_level method looks like: MyPackage->export_to_level( $where_to_export, $package, @what_to_export ); where C<$where_to_export> is an integer telling how far up the calling stack to export your symbols, and C<@what_to_export> is an array telling what symbols *to* export (usually this is C<@_>). The C<$package> argument is currently unused. For example, suppose that you have a module, A, which already has an import function: package A; our @ISA = qw(Exporter); our @EXPORT_OK = qw($b); sub import { $A::b = 1; # not a very useful import method } and you want to Export symbol C<$A::b> back to the module that called package A. Since Exporter relies on the import method to work, via inheritance, as it stands Exporter::import() will never get called. Instead, say the following: package A; our @ISA = qw(Exporter); our @EXPORT_OK = qw($b); sub import { $A::b = 1; A->export_to_level(1, @_); } This will export the symbols one level 'above' the current package - ie: to the program or module that used package A. Note: Be careful not to modify C<@_> at all before you call export_to_level - or people using your package will get very unexplained results! =head2 Exporting Without Inheriting from Exporter By including Exporter in your C<@ISA> you inherit an Exporter's import() method but you also inherit several other helper methods which you probably don't want and complicate the inheritance tree. To avoid this you can do: package YourModule; use Exporter qw(import); which will export Exporter's own import() method into YourModule. Everything will work as before but you won't need to include Exporter in C<@YourModule::ISA>. Note: This feature was introduced in version 5.57 of Exporter, released with perl 5.8.3. =head2 Module Version Checking The Exporter module will convert an attempt to import a number from a module into a call to C<< $module_name->VERSION($value) >>. This can be used to validate that the version of the module being used is greater than or equal to the required version. For historical reasons, Exporter supplies a C method that simply delegates to C. Originally, before C existed, Exporter would call C. Since the C method treats the C<$VERSION> number as a simple numeric value it will regard version 1.10 as lower than 1.9. For this reason it is strongly recommended that you use numbers with at least two decimal places, e.g., 1.09. =head2 Managing Unknown Symbols In some situations you may want to prevent certain symbols from being exported. Typically this applies to extensions which have functions or constants that may not exist on some systems. The names of any symbols that cannot be exported should be listed in the C<@EXPORT_FAIL> array. If a module attempts to import any of these symbols the Exporter will give the module an opportunity to handle the situation before generating an error. The Exporter will call an export_fail method with a list of the failed symbols: @failed_symbols = $module_name->export_fail(@failed_symbols); If the C method returns an empty list then no error is recorded and all the requested symbols are exported. If the returned list is not empty then an error is generated for each symbol and the export fails. The Exporter provides a default C method which simply returns the list unchanged. Uses for the C method include giving better error messages for some symbols and performing lazy architectural checks (put more symbols into C<@EXPORT_FAIL> by default and then take them out if someone actually tries to use them and an expensive check shows that they are usable on that platform). =head2 Tag Handling Utility Functions Since the symbols listed within C<%EXPORT_TAGS> must also appear in either C<@EXPORT> or C<@EXPORT_OK>, two utility functions are provided which allow you to easily add tagged sets of symbols to C<@EXPORT> or C<@EXPORT_OK>: our %EXPORT_TAGS = (foo => [qw(aa bb cc)], bar => [qw(aa cc dd)]); Exporter::export_tags('foo'); # add aa, bb and cc to @EXPORT Exporter::export_ok_tags('bar'); # add aa, cc and dd to @EXPORT_OK Any names which are not tags are added to C<@EXPORT> or C<@EXPORT_OK> unchanged but will trigger a warning (with C<-w>) to avoid misspelt tags names being silently added to C<@EXPORT> or C<@EXPORT_OK>. Future versions may make this a fatal error. =head2 Generating Combined Tags If several symbol categories exist in C<%EXPORT_TAGS>, it's usually useful to create the utility ":all" to simplify "use" statements. The simplest way to do this is: our %EXPORT_TAGS = (foo => [qw(aa bb cc)], bar => [qw(aa cc dd)]); # add all the other ":class" tags to the ":all" class, # deleting duplicates { my %seen; push @{$EXPORT_TAGS{all}}, grep {!$seen{$_}++} @{$EXPORT_TAGS{$_}} foreach keys %EXPORT_TAGS; } F creates an ":all" tag which contains some (but not really all) of its categories. That could be done with one small change: # add some of the other ":class" tags to the ":all" class, # deleting duplicates { my %seen; push @{$EXPORT_TAGS{all}}, grep {!$seen{$_}++} @{$EXPORT_TAGS{$_}} foreach qw/html2 html3 netscape form cgi internal/; } Note that the tag names in C<%EXPORT_TAGS> don't have the leading ':'. =head2 Ced Constants Many modules make use of Cing for constant subroutines to avoid having to compile and waste memory on rarely used values (see L for details on constant subroutines). Calls to such constant subroutines are not optimized away at compile time because they can't be checked at compile time for constancy. Even if a prototype is available at compile time, the body of the subroutine is not (it hasn't been Ced yet). perl needs to examine both the C<()> prototype and the body of a subroutine at compile time to detect that it can safely replace calls to that subroutine with the constant value. A workaround for this is to call the constants once in a C block: package My ; use Socket ; foo( SO_LINGER ); ## SO_LINGER NOT optimized away; called at runtime BEGIN { SO_LINGER } foo( SO_LINGER ); ## SO_LINGER optimized away at compile time. This forces the C for C to take place before SO_LINGER is encountered later in C package. If you are writing a package that Cs, consider forcing an C for any constants explicitly imported by other packages or which are usually used when your package is Cd. =head1 Good Practices =head2 Declaring C<@EXPORT_OK> and Friends When using C with the standard C and C pragmas, the C keyword is needed to declare the package variables C<@EXPORT_OK>, C<@EXPORT>, C<@ISA>, etc. our @ISA = qw(Exporter); our @EXPORT_OK = qw(munge frobnicate); If backward compatibility for Perls B 5.6 is important, one must write instead a C statement. use vars qw(@ISA @EXPORT_OK); @ISA = qw(Exporter); @EXPORT_OK = qw(munge frobnicate); =head2 Playing Safe There are some caveats with the use of runtime statements like C and the assignment to package variables, which can be very subtle for the unaware programmer. This may happen for instance with mutually recursive modules, which are affected by the time the relevant constructions are executed. The ideal way to never have to think about that is to use C blocks and the simple import method. So the first part of the L code could be rewritten as: package YourModule; use strict; use warnings; use Exporter 'import'; BEGIN { our @EXPORT_OK = qw(munge frobnicate); # symbols to export on request } Or if you need to inherit from Exporter: package YourModule; use strict; use warnings; BEGIN { require Exporter; our @ISA = qw(Exporter); # inherit all of Exporter's methods our @EXPORT_OK = qw(munge frobnicate); # symbols to export on request } The C will assure that the loading of F and the assignments to C<@ISA> and C<@EXPORT_OK> happen immediately like C, leaving no room for something to get awry or just plain wrong. With respect to loading C and inheriting, there are alternatives with the use of modules like C and C. use base qw(Exporter); # or use parent qw(Exporter); Any of these statements are nice replacements for C with the same compile-time effect. The basic difference is that C code interacts with declared C while C is a streamlined version of the older C code to just establish the IS-A relationship. For more details, see the documentation and code of L and L. Another thorough remedy to that runtime vs. compile-time trap is to use L, which is a wrapper of Exporter that allows all boilerplate code at a single gulp in the use statement. use Exporter::Easy ( OK => [ qw(munge frobnicate) ], ); # @ISA setup is automatic # all assignments happen at compile time =head2 What Not to Export You have been warned already in L to not export: =over 4 =item * method names (because you don't need to and that's likely to not do what you want), =item * anything by default (because you don't want to surprise your users... badly) =item * anything you don't need to (because less is more) =back There's one more item to add to this list. Do B export variable names. Just because C lets you do that, it does not mean you should. @EXPORT_OK = qw($svar @avar %hvar); # DON'T! Exporting variables is not a good idea. They can change under the hood, provoking horrible effects at-a-distance that are too hard to track and to fix. Trust me: they are not worth it. To provide the capability to set/get class-wide settings, it is best instead to provide accessors as subroutines or class methods instead. =head1 SEE ALSO C is definitely not the only module with symbol exporter capabilities. At CPAN, you may find a bunch of them. Some are lighter. Some provide improved APIs and features. Pick the one that fits your needs. The following is a sample list of such modules. Exporter::Easy Exporter::Lite Exporter::Renaming Exporter::Tidy Sub::Exporter / Sub::Installer Perl6::Export / Perl6::Export::Attrs =head1 LICENSE This library is free software. You can redistribute it and/or modify it under the same terms as Perl itself. =cut FILEb956cb79/Digest/base.pmpackage Digest::base; use strict; use warnings; our $VERSION = "1.20"; # subclass is supposed to implement at least these sub new; sub clone; sub add; sub digest; sub reset { my $self = shift; $self->new(@_); # ugly } sub addfile { my ( $self, $handle ) = @_; my $n; my $buf = ""; while ( ( $n = read( $handle, $buf, 4 * 1024 ) ) ) { $self->add($buf); } unless ( defined $n ) { require Carp; Carp::croak("Read failed: $!"); } $self; } sub add_bits { my $self = shift; my $bits; my $nbits; if ( @_ == 1 ) { my $arg = shift; $bits = pack( "B*", $arg ); $nbits = length($arg); } else { ( $bits, $nbits ) = @_; } if ( ( $nbits % 8 ) != 0 ) { require Carp; Carp::croak("Number of bits must be multiple of 8 for this algorithm"); } return $self->add( substr( $bits, 0, $nbits / 8 ) ); } sub hexdigest { my $self = shift; return unpack( "H*", $self->digest(@_) ); } sub b64digest { my $self = shift; my $b64 = $self->base64_padded_digest; $b64 =~ s/=+$//; return $b64; } sub base64_padded_digest { my $self = shift; require MIME::Base64; return MIME::Base64::encode( $self->digest(@_), "" ); } 1; __END__ =head1 NAME Digest::base - Digest base class =head1 SYNOPSIS package Digest::Foo; use base 'Digest::base'; =head1 DESCRIPTION The C class provide implementations of the methods C and C in terms of C, and of the methods C and C in terms of C. Digest implementations might want to inherit from this class to get this implementations of the alternative I and I methods. A minimal subclass needs to implement the following methods by itself: new clone add digest The arguments and expected behaviour of these methods are described in L. =head1 SEE ALSO L FILE8902686e/File/Path.pmpackage File::Path; use 5.005_04; use strict; use Cwd 'getcwd'; use File::Basename (); use File::Spec (); BEGIN { if ( $] < 5.006 ) { # can't say 'opendir my $dh, $dirname' # need to initialise $dh eval 'use Symbol'; } } use Exporter (); use vars qw($VERSION @ISA @EXPORT @EXPORT_OK); $VERSION = '2.18'; $VERSION = eval $VERSION; @ISA = qw(Exporter); @EXPORT = qw(mkpath rmtree); @EXPORT_OK = qw(make_path remove_tree); BEGIN { for (qw(VMS MacOS MSWin32 os2)) { no strict 'refs'; *{"_IS_\U$_"} = $^O eq $_ ? sub () { 1 } : sub () { 0 }; } # These OSes complain if you want to remove a file that you have no # write permission to: *_FORCE_WRITABLE = ( grep { $^O eq $_ } qw(amigaos dos epoc MSWin32 MacOS os2) ) ? sub () { 1 } : sub () { 0 }; # Unix-like systems need to stat each directory in order to detect # race condition. MS-Windows is immune to this particular attack. *_NEED_STAT_CHECK = !(_IS_MSWIN32()) ? sub () { 1 } : sub () { 0 }; } sub _carp { require Carp; goto &Carp::carp; } sub _croak { require Carp; goto &Carp::croak; } sub _error { my $arg = shift; my $message = shift; my $object = shift; if ( $arg->{error} ) { $object = '' unless defined $object; $message .= ": $!" if $!; push @{ ${ $arg->{error} } }, { $object => $message }; } else { _carp( defined($object) ? "$message for $object: $!" : "$message: $!" ); } } sub __is_arg { my ($arg) = @_; # If client code blessed an array ref to HASH, this will not work # properly. We could have done $arg->isa() wrapped in eval, but # that would be expensive. This implementation should suffice. # We could have also used Scalar::Util:blessed, but we choose not # to add this dependency return ( ref $arg eq 'HASH' ); } sub make_path { push @_, {} unless @_ and __is_arg( $_[-1] ); goto &mkpath; } sub mkpath { my $old_style = !( @_ and __is_arg( $_[-1] ) ); my $data; my $paths; if ($old_style) { my ( $verbose, $mode ); ( $paths, $verbose, $mode ) = @_; $paths = [$paths] unless UNIVERSAL::isa( $paths, 'ARRAY' ); $data->{verbose} = $verbose; $data->{mode} = defined $mode ? $mode : oct '777'; } else { my %args_permitted = map { $_ => 1 } ( qw| chmod error group mask mode owner uid user verbose | ); my %not_on_win32_args = map { $_ => 1 } ( qw| group owner uid user | ); my @bad_args = (); my @win32_implausible_args = (); my $arg = pop @_; for my $k (sort keys %{$arg}) { if (! $args_permitted{$k}) { push @bad_args, $k; } elsif ($not_on_win32_args{$k} and _IS_MSWIN32) { push @win32_implausible_args, $k; } else { $data->{$k} = $arg->{$k}; } } _carp("Unrecognized option(s) passed to mkpath() or make_path(): @bad_args") if @bad_args; _carp("Option(s) implausible on Win32 passed to mkpath() or make_path(): @win32_implausible_args") if @win32_implausible_args; $data->{mode} = delete $data->{mask} if exists $data->{mask}; $data->{mode} = oct '777' unless exists $data->{mode}; ${ $data->{error} } = [] if exists $data->{error}; unless (@win32_implausible_args) { $data->{owner} = delete $data->{user} if exists $data->{user}; $data->{owner} = delete $data->{uid} if exists $data->{uid}; if ( exists $data->{owner} and $data->{owner} =~ /\D/ ) { my $uid = ( getpwnam $data->{owner} )[2]; if ( defined $uid ) { $data->{owner} = $uid; } else { _error( $data, "unable to map $data->{owner} to a uid, ownership not changed" ); delete $data->{owner}; } } if ( exists $data->{group} and $data->{group} =~ /\D/ ) { my $gid = ( getgrnam $data->{group} )[2]; if ( defined $gid ) { $data->{group} = $gid; } else { _error( $data, "unable to map $data->{group} to a gid, group ownership not changed" ); delete $data->{group}; } } if ( exists $data->{owner} and not exists $data->{group} ) { $data->{group} = -1; # chown will leave group unchanged } if ( exists $data->{group} and not exists $data->{owner} ) { $data->{owner} = -1; # chown will leave owner unchanged } } $paths = [@_]; } return _mkpath( $data, $paths ); } sub _mkpath { my $data = shift; my $paths = shift; my ( @created ); foreach my $path ( @{$paths} ) { next unless defined($path) and length($path); $path .= '/' if _IS_OS2 and $path =~ /^\w:\z/s; # feature of CRT # Logic wants Unix paths, so go with the flow. if (_IS_VMS) { next if $path eq '/'; $path = VMS::Filespec::unixify($path); } next if -d $path; my $parent = File::Basename::dirname($path); # Coverage note: It's not clear how we would test the condition: # '-d $parent or $path eq $parent' unless ( -d $parent or $path eq $parent ) { push( @created, _mkpath( $data, [$parent] ) ); } print "mkdir $path\n" if $data->{verbose}; if ( mkdir( $path, $data->{mode} ) ) { push( @created, $path ); if ( exists $data->{owner} ) { # NB: $data->{group} guaranteed to be set during initialisation if ( !chown $data->{owner}, $data->{group}, $path ) { _error( $data, "Cannot change ownership of $path to $data->{owner}:$data->{group}" ); } } if ( exists $data->{chmod} ) { # Coverage note: It's not clear how we would trigger the next # 'if' block. Failure of 'chmod' might first result in a # system error: "Permission denied". if ( !chmod $data->{chmod}, $path ) { _error( $data, "Cannot change permissions of $path to $data->{chmod}" ); } } } else { my $save_bang = $!; # From 'perldoc perlvar': $EXTENDED_OS_ERROR ($^E) is documented # as: # Error information specific to the current operating system. At the # moment, this differs from "$!" under only VMS, OS/2, and Win32 # (and for MacPerl). On all other platforms, $^E is always just the # same as $!. my ( $e, $e1 ) = ( $save_bang, $^E ); $e .= "; $e1" if $e ne $e1; # allow for another process to have created it meanwhile if ( ! -d $path ) { $! = $save_bang; if ( $data->{error} ) { push @{ ${ $data->{error} } }, { $path => $e }; } else { _croak("mkdir $path: $e"); } } } } return @created; } sub remove_tree { push @_, {} unless @_ and __is_arg( $_[-1] ); goto &rmtree; } sub _is_subdir { my ( $dir, $test ) = @_; my ( $dv, $dd ) = File::Spec->splitpath( $dir, 1 ); my ( $tv, $td ) = File::Spec->splitpath( $test, 1 ); # not on same volume return 0 if $dv ne $tv; my @d = File::Spec->splitdir($dd); my @t = File::Spec->splitdir($td); # @t can't be a subdir if it's shorter than @d return 0 if @t < @d; return join( '/', @d ) eq join( '/', splice @t, 0, +@d ); } sub rmtree { my $old_style = !( @_ and __is_arg( $_[-1] ) ); my ($arg, $data, $paths); if ($old_style) { my ( $verbose, $safe ); ( $paths, $verbose, $safe ) = @_; $data->{verbose} = $verbose; $data->{safe} = defined $safe ? $safe : 0; if ( defined($paths) and length($paths) ) { $paths = [$paths] unless UNIVERSAL::isa( $paths, 'ARRAY' ); } else { _carp("No root path(s) specified\n"); return 0; } } else { my %args_permitted = map { $_ => 1 } ( qw| error keep_root result safe verbose | ); my @bad_args = (); my $arg = pop @_; for my $k (sort keys %{$arg}) { if (! $args_permitted{$k}) { push @bad_args, $k; } else { $data->{$k} = $arg->{$k}; } } _carp("Unrecognized option(s) passed to remove_tree(): @bad_args") if @bad_args; ${ $data->{error} } = [] if exists $data->{error}; ${ $data->{result} } = [] if exists $data->{result}; # Wouldn't it make sense to do some validation on @_ before assigning # to $paths here? # In the $old_style case we guarantee that each path is both defined # and non-empty. We don't check that here, which means we have to # check it later in the first condition in this line: # if ( $ortho_root_length && _is_subdir( $ortho_root, $ortho_cwd ) ) { # Granted, that would be a change in behavior for the two # non-old-style interfaces. $paths = [@_]; } $data->{prefix} = ''; $data->{depth} = 0; my @clean_path; $data->{cwd} = getcwd() or do { _error( $data, "cannot fetch initial working directory" ); return 0; }; for ( $data->{cwd} ) { /\A(.*)\Z/s; $_ = $1 } # untaint for my $p (@$paths) { # need to fixup case and map \ to / on Windows my $ortho_root = _IS_MSWIN32 ? _slash_lc($p) : $p; my $ortho_cwd = _IS_MSWIN32 ? _slash_lc( $data->{cwd} ) : $data->{cwd}; my $ortho_root_length = length($ortho_root); $ortho_root_length-- if _IS_VMS; # don't compare '.' with ']' if ( $ortho_root_length && _is_subdir( $ortho_root, $ortho_cwd ) ) { local $! = 0; _error( $data, "cannot remove path when cwd is $data->{cwd}", $p ); next; } if (_IS_MACOS) { $p = ":$p" unless $p =~ /:/; $p .= ":" unless $p =~ /:\z/; } elsif ( _IS_MSWIN32 ) { $p =~ s{[/\\]\z}{}; } else { $p =~ s{/\z}{}; } push @clean_path, $p; } @{$data}{qw(device inode)} = ( lstat $data->{cwd} )[ 0, 1 ] or do { _error( $data, "cannot stat initial working directory", $data->{cwd} ); return 0; }; return _rmtree( $data, \@clean_path ); } sub _rmtree { my $data = shift; my $paths = shift; my $count = 0; my $curdir = File::Spec->curdir(); my $updir = File::Spec->updir(); my ( @files, $root ); ROOT_DIR: foreach my $root (@$paths) { # since we chdir into each directory, it may not be obvious # to figure out where we are if we generate a message about # a file name. We therefore construct a semi-canonical # filename, anchored from the directory being unlinked (as # opposed to being truly canonical, anchored from the root (/). my $canon = $data->{prefix} ? File::Spec->catfile( $data->{prefix}, $root ) : $root; my ( $ldev, $lino, $perm ) = ( lstat $root )[ 0, 1, 2 ] or next ROOT_DIR; if ( -d _ ) { $root = VMS::Filespec::vmspath( VMS::Filespec::pathify($root) ) if _IS_VMS; if ( !chdir($root) ) { # see if we can escalate privileges to get in # (e.g. funny protection mask such as -w- instead of rwx) # This uses fchmod to avoid traversing outside of the proper # location (CVE-2017-6512) my $root_fh; if (open($root_fh, '<', $root)) { my ($fh_dev, $fh_inode) = (stat $root_fh )[0,1]; $perm &= oct '7777'; my $nperm = $perm | oct '700'; local $@; if ( !( $data->{safe} or $nperm == $perm or !-d _ or $fh_dev ne $ldev or $fh_inode ne $lino or eval { chmod( $nperm, $root_fh ) } ) ) { _error( $data, "cannot make child directory read-write-exec", $canon ); next ROOT_DIR; } close $root_fh; } if ( !chdir($root) ) { _error( $data, "cannot chdir to child", $canon ); next ROOT_DIR; } } my ( $cur_dev, $cur_inode, $perm ) = ( stat $curdir )[ 0, 1, 2 ] or do { _error( $data, "cannot stat current working directory", $canon ); next ROOT_DIR; }; if (_NEED_STAT_CHECK) { ( $ldev eq $cur_dev and $lino eq $cur_inode ) or _croak( "directory $canon changed before chdir, expected dev=$ldev ino=$lino, actual dev=$cur_dev ino=$cur_inode, aborting." ); } $perm &= oct '7777'; # don't forget setuid, setgid, sticky bits my $nperm = $perm | oct '700'; # notabene: 0700 is for making readable in the first place, # it's also intended to change it to writable in case we have # to recurse in which case we are better than rm -rf for # subtrees with strange permissions if ( !( $data->{safe} or $nperm == $perm or chmod( $nperm, $curdir ) ) ) { _error( $data, "cannot make directory read+writeable", $canon ); $nperm = $perm; } my $d; $d = gensym() if $] < 5.006; if ( !opendir $d, $curdir ) { _error( $data, "cannot opendir", $canon ); @files = (); } else { if ( !defined ${^TAINT} or ${^TAINT} ) { # Blindly untaint dir names if taint mode is active @files = map { /\A(.*)\z/s; $1 } readdir $d; } else { @files = readdir $d; } closedir $d; } if (_IS_VMS) { # Deleting large numbers of files from VMS Files-11 # filesystems is faster if done in reverse ASCIIbetical order. # include '.' to '.;' from blead patch #31775 @files = map { $_ eq '.' ? '.;' : $_ } reverse @files; } @files = grep { $_ ne $updir and $_ ne $curdir } @files; if (@files) { # remove the contained files before the directory itself my $narg = {%$data}; @{$narg}{qw(device inode cwd prefix depth)} = ( $cur_dev, $cur_inode, $updir, $canon, $data->{depth} + 1 ); $count += _rmtree( $narg, \@files ); } # restore directory permissions of required now (in case the rmdir # below fails), while we are still in the directory and may do so # without a race via '.' if ( $nperm != $perm and not chmod( $perm, $curdir ) ) { _error( $data, "cannot reset chmod", $canon ); } # don't leave the client code in an unexpected directory chdir( $data->{cwd} ) or _croak("cannot chdir to $data->{cwd} from $canon: $!, aborting."); # ensure that a chdir upwards didn't take us somewhere other # than we expected (see CVE-2002-0435) ( $cur_dev, $cur_inode ) = ( stat $curdir )[ 0, 1 ] or _croak( "cannot stat prior working directory $data->{cwd}: $!, aborting." ); if (_NEED_STAT_CHECK) { ( $data->{device} eq $cur_dev and $data->{inode} eq $cur_inode ) or _croak( "previous directory $data->{cwd} " . "changed before entering $canon, " . "expected dev=$ldev ino=$lino, " . "actual dev=$cur_dev ino=$cur_inode, aborting." ); } if ( $data->{depth} or !$data->{keep_root} ) { if ( $data->{safe} && ( _IS_VMS ? !&VMS::Filespec::candelete($root) : !-w $root ) ) { print "skipped $root\n" if $data->{verbose}; next ROOT_DIR; } if ( _FORCE_WRITABLE and !chmod $perm | oct '700', $root ) { _error( $data, "cannot make directory writeable", $canon ); } print "rmdir $root\n" if $data->{verbose}; if ( rmdir $root ) { push @{ ${ $data->{result} } }, $root if $data->{result}; ++$count; } else { _error( $data, "cannot remove directory", $canon ); if ( _FORCE_WRITABLE && !chmod( $perm, ( _IS_VMS ? VMS::Filespec::fileify($root) : $root ) ) ) { _error( $data, sprintf( "cannot restore permissions to 0%o", $perm ), $canon ); } } } } else { # not a directory $root = VMS::Filespec::vmsify("./$root") if _IS_VMS && !File::Spec->file_name_is_absolute($root) && ( $root !~ m/(?]+/ ); # not already in VMS syntax if ( $data->{safe} && ( _IS_VMS ? !&VMS::Filespec::candelete($root) : !( -l $root || -w $root ) ) ) { print "skipped $root\n" if $data->{verbose}; next ROOT_DIR; } my $nperm = $perm & oct '7777' | oct '600'; if ( _FORCE_WRITABLE and $nperm != $perm and not chmod $nperm, $root ) { _error( $data, "cannot make file writeable", $canon ); } print "unlink $canon\n" if $data->{verbose}; # delete all versions under VMS for ( ; ; ) { if ( unlink $root ) { push @{ ${ $data->{result} } }, $root if $data->{result}; } else { _error( $data, "cannot unlink file", $canon ); _FORCE_WRITABLE and chmod( $perm, $root ) or _error( $data, sprintf( "cannot restore permissions to 0%o", $perm ), $canon ); last; } ++$count; last unless _IS_VMS && lstat $root; } } } return $count; } sub _slash_lc { # fix up slashes and case on MSWin32 so that we can determine that # c:\path\to\dir is underneath C:/Path/To my $path = shift; $path =~ tr{\\}{/}; return lc($path); } 1; __END__ =head1 NAME File::Path - Create or remove directory trees =head1 VERSION 2.18 - released November 4 2020. =head1 SYNOPSIS use File::Path qw(make_path remove_tree); @created = make_path('foo/bar/baz', '/zug/zwang'); @created = make_path('foo/bar/baz', '/zug/zwang', { verbose => 1, mode => 0711, }); make_path('foo/bar/baz', '/zug/zwang', { chmod => 0777, }); $removed_count = remove_tree('foo/bar/baz', '/zug/zwang', { verbose => 1, error => \my $err_list, safe => 1, }); # legacy (interface promoted before v2.00) @created = mkpath('/foo/bar/baz'); @created = mkpath('/foo/bar/baz', 1, 0711); @created = mkpath(['/foo/bar/baz', 'blurfl/quux'], 1, 0711); $removed_count = rmtree('foo/bar/baz', 1, 1); $removed_count = rmtree(['foo/bar/baz', 'blurfl/quux'], 1, 1); # legacy (interface promoted before v2.06) @created = mkpath('foo/bar/baz', '/zug/zwang', { verbose => 1, mode => 0711 }); $removed_count = rmtree('foo/bar/baz', '/zug/zwang', { verbose => 1, mode => 0711 }); =head1 DESCRIPTION This module provides a convenient way to create directories of arbitrary depth and to delete an entire directory subtree from the filesystem. The following functions are provided: =over =item make_path( $dir1, $dir2, .... ) =item make_path( $dir1, $dir2, ...., \%opts ) The C function creates the given directories if they don't exist before, much like the Unix command C. The function accepts a list of directories to be created. Its behaviour may be tuned by an optional hashref appearing as the last parameter on the call. The function returns the list of directories actually created during the call; in scalar context the number of directories created. The following keys are recognised in the option hash: =over =item mode => $num The numeric permissions mode to apply to each created directory (defaults to C<0777>), to be modified by the current C. If the directory already exists (and thus does not need to be created), the permissions will not be modified. C is recognised as an alias for this parameter. =item chmod => $num Takes a numeric mode to apply to each created directory (not modified by the current C). If the directory already exists (and thus does not need to be created), the permissions will not be modified. =item verbose => $bool If present, will cause C to print the name of each directory as it is created. By default nothing is printed. =item error => \$err If present, it should be a reference to a scalar. This scalar will be made to reference an array, which will be used to store any errors that are encountered. See the L section for more information. If this parameter is not used, certain error conditions may raise a fatal error that will cause the program to halt, unless trapped in an C block. =item owner => $owner =item user => $owner =item uid => $owner If present, will cause any created directory to be owned by C<$owner>. If the value is numeric, it will be interpreted as a uid; otherwise a username is assumed. An error will be issued if the username cannot be mapped to a uid, the uid does not exist or the process lacks the privileges to change ownership. Ownership of directories that already exist will not be changed. C and C are aliases of C. =item group => $group If present, will cause any created directory to be owned by the group C<$group>. If the value is numeric, it will be interpreted as a gid; otherwise a group name is assumed. An error will be issued if the group name cannot be mapped to a gid, the gid does not exist or the process lacks the privileges to change group ownership. Group ownership of directories that already exist will not be changed. make_path '/var/tmp/webcache', {owner=>'nobody', group=>'nogroup'}; =back =item mkpath( $dir ) =item mkpath( $dir, $verbose, $mode ) =item mkpath( [$dir1, $dir2,...], $verbose, $mode ) =item mkpath( $dir1, $dir2,..., \%opt ) The C function provide the legacy interface of C with a different interpretation of the arguments passed. The behaviour and return value of the function is otherwise identical to C. =item remove_tree( $dir1, $dir2, .... ) =item remove_tree( $dir1, $dir2, ...., \%opts ) The C function deletes the given directories and any files and subdirectories they might contain, much like the Unix command C or the Windows commands C and C. The function accepts a list of directories to be removed. (In point of fact, it will also accept filesystem entries which are not directories, such as regular files and symlinks. But, as its name suggests, its intent is to remove trees rather than individual files.) C's behaviour may be tuned by an optional hashref appearing as the last parameter on the call. If an empty string is passed to C, an error will occur. B For security reasons, we strongly advise use of the hashref-as-final-argument syntax -- specifically, with a setting of the C element to a true value. remove_tree( $dir1, $dir2, ...., { safe => 1, ... # other key-value pairs }, ); The function returns the number of files successfully deleted. The following keys are recognised in the option hash: =over =item verbose => $bool If present, will cause C to print the name of each file as it is unlinked. By default nothing is printed. =item safe => $bool When set to a true value, will cause C to skip the files for which the process lacks the required privileges needed to delete files, such as delete privileges on VMS. In other words, the code will make no attempt to alter file permissions. Thus, if the process is interrupted, no filesystem object will be left in a more permissive mode. =item keep_root => $bool When set to a true value, will cause all files and subdirectories to be removed, except the initially specified directories. This comes in handy when cleaning out an application's scratch directory. remove_tree( '/tmp', {keep_root => 1} ); =item result => \$res If present, it should be a reference to a scalar. This scalar will be made to reference an array, which will be used to store all files and directories unlinked during the call. If nothing is unlinked, the array will be empty. remove_tree( '/tmp', {result => \my $list} ); print "unlinked $_\n" for @$list; This is a useful alternative to the C key. =item error => \$err If present, it should be a reference to a scalar. This scalar will be made to reference an array, which will be used to store any errors that are encountered. See the L section for more information. Removing things is a much more dangerous proposition than creating things. As such, there are certain conditions that C may encounter that are so dangerous that the only sane action left is to kill the program. Use C to trap all that is reasonable (problems with permissions and the like), and let it die if things get out of hand. This is the safest course of action. =back =item rmtree( $dir ) =item rmtree( $dir, $verbose, $safe ) =item rmtree( [$dir1, $dir2,...], $verbose, $safe ) =item rmtree( $dir1, $dir2,..., \%opt ) The C function provide the legacy interface of C with a different interpretation of the arguments passed. The behaviour and return value of the function is otherwise identical to C. B For security reasons, we strongly advise use of the hashref-as-final-argument syntax, specifically with a setting of the C element to a true value. rmtree( $dir1, $dir2, ...., { safe => 1, ... # other key-value pairs }, ); =back =head2 ERROR HANDLING =over 4 =item B The following error handling mechanism is consistent throughout all code paths EXCEPT in cases where the ROOT node is nonexistent. In version 2.11 the maintainers attempted to rectify this inconsistency but too many downstream modules encountered problems. In such case, if you require root node evaluation or error checking prior to calling C or C, you should take additional precautions. =back If C or C encounters an error, a diagnostic message will be printed to C via C (for non-fatal errors) or via C (for fatal errors). If this behaviour is not desirable, the C attribute may be used to hold a reference to a variable, which will be used to store the diagnostics. The variable is made a reference to an array of hash references. Each hash contain a single key/value pair where the key is the name of the file, and the value is the error message (including the contents of C<$!> when appropriate). If a general error is encountered the diagnostic key will be empty. An example usage looks like: remove_tree( 'foo/bar', 'bar/rat', {error => \my $err} ); if ($err && @$err) { for my $diag (@$err) { my ($file, $message) = %$diag; if ($file eq '') { print "general error: $message\n"; } else { print "problem unlinking $file: $message\n"; } } } else { print "No error encountered\n"; } Note that if no errors are encountered, C<$err> will reference an empty array. This means that C<$err> will always end up TRUE; so you need to test C<@$err> to determine if errors occurred. =head2 NOTES C blindly exports C and C into the current namespace. These days, this is considered bad style, but to change it now would break too much code. Nonetheless, you are invited to specify what it is you are expecting to use: use File::Path 'rmtree'; The routines C and C are B exported by default. You must specify which ones you want to use. use File::Path 'remove_tree'; Note that a side-effect of the above is that C and C are no longer exported at all. This is due to the way the C module works. If you are migrating a codebase to use the new interface, you will have to list everything explicitly. But that's just good practice anyway. use File::Path qw(remove_tree rmtree); =head3 API CHANGES The API was changed in the 2.0 branch. For a time, C and C tried, unsuccessfully, to deal with the two different calling mechanisms. This approach was considered a failure. The new semantics are now only available with C and C. The old semantics are only available through C and C. Users are strongly encouraged to upgrade to at least 2.08 in order to avoid surprises. =head3 SECURITY CONSIDERATIONS There were race conditions in the 1.x implementations of File::Path's C function (although sometimes patched depending on the OS distribution or platform). The 2.0 version contains code to avoid the problem mentioned in CVE-2002-0435. See the following pages for more information: http://bugs.debian.org/cgi-bin/bugreport.cgi?bug=286905 http://www.nntp.perl.org/group/perl.perl5.porters/2005/01/msg97623.html http://www.debian.org/security/2005/dsa-696 Additionally, unless the C parameter is set (or the third parameter in the traditional interface is TRUE), should a C be interrupted, files that were originally in read-only mode may now have their permissions set to a read-write (or "delete OK") mode. The following CVE reports were previously filed against File-Path and are believed to have been addressed: =over 4 =item * L =item * L =back In February 2017 the cPanel Security Team reported an additional vulnerability in File-Path. The C logic to make directories traversable can be abused to set the mode on an attacker-chosen file to an attacker-chosen value. This is due to the time-of-check-to-time-of-use (TOCTTOU) race condition (L) between the C that decides the inode is a directory and the C that tries to make it user-rwx. CPAN versions 2.13 and later incorporate a patch provided by John Lightsey to address this problem. This vulnerability has been reported as CVE-2017-6512. =head1 DIAGNOSTICS FATAL errors will cause the program to halt (C), since the problem is so severe that it would be dangerous to continue. (This can always be trapped with C, but it's not a good idea. Under the circumstances, dying is the best thing to do). SEVERE errors may be trapped using the modern interface. If the they are not trapped, or if the old interface is used, such an error will cause the program will halt. All other errors may be trapped using the modern interface, otherwise they will be Ced about. Program execution will not be halted. =over 4 =item mkdir [path]: [errmsg] (SEVERE) C was unable to create the path. Probably some sort of permissions error at the point of departure or insufficient resources (such as free inodes on Unix). =item No root path(s) specified C was not given any paths to create. This message is only emitted if the routine is called with the traditional interface. The modern interface will remain silent if given nothing to do. =item No such file or directory On Windows, if C gives you this warning, it may mean that you have exceeded your filesystem's maximum path length. =item cannot fetch initial working directory: [errmsg] C attempted to determine the initial directory by calling C, but the call failed for some reason. No attempt will be made to delete anything. =item cannot stat initial working directory: [errmsg] C attempted to stat the initial directory (after having successfully obtained its name via C), however, the call failed for some reason. No attempt will be made to delete anything. =item cannot chdir to [dir]: [errmsg] C attempted to set the working directory in order to begin deleting the objects therein, but was unsuccessful. This is usually a permissions issue. The routine will continue to delete other things, but this directory will be left intact. =item directory [dir] changed before chdir, expected dev=[n] ino=[n], actual dev=[n] ino=[n], aborting. (FATAL) C recorded the device and inode of a directory, and then moved into it. It then performed a C on the current directory and detected that the device and inode were no longer the same. As this is at the heart of the race condition problem, the program will die at this point. =item cannot make directory [dir] read+writeable: [errmsg] C attempted to change the permissions on the current directory to ensure that subsequent unlinkings would not run into problems, but was unable to do so. The permissions remain as they were, and the program will carry on, doing the best it can. =item cannot read [dir]: [errmsg] C tried to read the contents of the directory in order to acquire the names of the directory entries to be unlinked, but was unsuccessful. This is usually a permissions issue. The program will continue, but the files in this directory will remain after the call. =item cannot reset chmod [dir]: [errmsg] C, after having deleted everything in a directory, attempted to restore its permissions to the original state but failed. The directory may wind up being left behind. =item cannot remove [dir] when cwd is [dir] The current working directory of the program is F and you are attempting to remove an ancestor, such as F. The directory tree is left untouched. The solution is to C out of the child directory to a place outside the directory tree to be removed. =item cannot chdir to [parent-dir] from [child-dir]: [errmsg], aborting. (FATAL) C, after having deleted everything and restored the permissions of a directory, was unable to chdir back to the parent. The program halts to avoid a race condition from occurring. =item cannot stat prior working directory [dir]: [errmsg], aborting. (FATAL) C was unable to stat the parent directory after having returned from the child. Since there is no way of knowing if we returned to where we think we should be (by comparing device and inode) the only way out is to C. =item previous directory [parent-dir] changed before entering [child-dir], expected dev=[n] ino=[n], actual dev=[n] ino=[n], aborting. (FATAL) When C returned from deleting files in a child directory, a check revealed that the parent directory it returned to wasn't the one it started out from. This is considered a sign of malicious activity. =item cannot make directory [dir] writeable: [errmsg] Just before removing a directory (after having successfully removed everything it contained), C attempted to set the permissions on the directory to ensure it could be removed and failed. Program execution continues, but the directory may possibly not be deleted. =item cannot remove directory [dir]: [errmsg] C attempted to remove a directory, but failed. This may be because some objects that were unable to be removed remain in the directory, or it could be a permissions issue. The directory will be left behind. =item cannot restore permissions of [dir] to [0nnn]: [errmsg] After having failed to remove a directory, C was unable to restore its permissions from a permissive state back to a possibly more restrictive setting. (Permissions given in octal). =item cannot make file [file] writeable: [errmsg] C attempted to force the permissions of a file to ensure it could be deleted, but failed to do so. It will, however, still attempt to unlink the file. =item cannot unlink file [file]: [errmsg] C failed to remove a file. Probably a permissions issue. =item cannot restore permissions of [file] to [0nnn]: [errmsg] After having failed to remove a file, C was also unable to restore the permissions on the file to a possibly less permissive setting. (Permissions given in octal). =item unable to map [owner] to a uid, ownership not changed"); C was instructed to give the ownership of created directories to the symbolic name [owner], but C did not return the corresponding numeric uid. The directory will be created, but ownership will not be changed. =item unable to map [group] to a gid, group ownership not changed C was instructed to give the group ownership of created directories to the symbolic name [group], but C did not return the corresponding numeric gid. The directory will be created, but group ownership will not be changed. =back =head1 SEE ALSO =over 4 =item * L Allows files and directories to be moved to the Trashcan/Recycle Bin (where they may later be restored if necessary) if the operating system supports such functionality. This feature may one day be made available directly in C. =item * L When removing directory trees, if you want to examine each file to decide whether to delete it (and possibly leaving large swathes alone), F offers a convenient and flexible approach to examining directory trees. =back =head1 BUGS AND LIMITATIONS The following describes F limitations and how to report bugs. =head2 MULTITHREADED APPLICATIONS F C and C will not work with multithreaded applications due to its use of C. At this time, no warning or error is generated in this situation. You will certainly encounter unexpected results. The implementation that surfaces this limitation will not be changed. See the F module for functionality similar to F but which does not C. =head2 NFS Mount Points F is not responsible for triggering the automounts, mirror mounts, and the contents of network mounted filesystems. If your NFS implementation requires an action to be performed on the filesystem in order for F to perform operations, it is strongly suggested you assure filesystem availability by reading the root of the mounted filesystem. =head2 REPORTING BUGS Please report all bugs on the RT queue, either via the web interface: L or by email: bug-File-Path@rt.cpan.org In either case, please B patches to the bug report rather than including them inline in the web post or the body of the email. You can also send pull requests to the Github repository: L =head1 ACKNOWLEDGEMENTS Paul Szabo identified the race condition originally, and Brendan O'Dea wrote an implementation for Debian that addressed the problem. That code was used as a basis for the current code. Their efforts are greatly appreciated. Gisle Aas made a number of improvements to the documentation for 2.07 and his advice and assistance is also greatly appreciated. =head1 AUTHORS Prior authors and maintainers: Tim Bunce, Charles Bailey, and David Landgren >. Current maintainers are Richard Elberger > and James (Jim) Keenan >. =head1 CONTRIBUTORS Contributors to File::Path, in alphabetical order by first name. =over 1 =item > =item Charlie Gonzalez > =item Craig A. Berry > =item James E Keenan > =item John Lightsey > =item Nigel Horne > =item Richard Elberger > =item Ryan Yee > =item Skye Shaw > =item Tom Lutz > =item Will Sheppard > =back =head1 COPYRIGHT This module is copyright (C) Charles Bailey, Tim Bunce, David Landgren, James Keenan and Richard Elberger 1995-2020. All rights reserved. =head1 LICENSE This library is free software; you can redistribute it and/or modify it under the same terms as Perl itself. =cut FILE66058cac/File/Temp.pm]package File::Temp; # git description: v0.2310-3-gc7148fe # ABSTRACT: return name and handle of a temporary file safely our $VERSION = '0.2311'; #pod =begin :__INTERNALS #pod #pod =head1 PORTABILITY #pod #pod This section is at the top in order to provide easier access to #pod porters. It is not expected to be rendered by a standard pod #pod formatting tool. Please skip straight to the SYNOPSIS section if you #pod are not trying to port this module to a new platform. #pod #pod This module is designed to be portable across operating systems and it #pod currently supports Unix, VMS, DOS, OS/2, Windows and Mac OS #pod (Classic). When porting to a new OS there are generally three main #pod issues that have to be solved: #pod #pod =over 4 #pod #pod =item * #pod #pod Can the OS unlink an open file? If it can not then the #pod C<_can_unlink_opened_file> method should be modified. #pod #pod =item * #pod #pod Are the return values from C reliable? By default all the #pod return values from C are compared when unlinking a temporary #pod file using the filename and the handle. Operating systems other than #pod unix do not always have valid entries in all fields. If utility function #pod C fails then the C comparison should be #pod modified accordingly. #pod #pod =item * #pod #pod Security. Systems that can not support a test for the sticky bit #pod on a directory can not use the MEDIUM and HIGH security tests. #pod The C<_can_do_level> method should be modified accordingly. #pod #pod =back #pod #pod =end :__INTERNALS #pod #pod =head1 SYNOPSIS #pod #pod use File::Temp qw/ tempfile tempdir /; #pod #pod $fh = tempfile(); #pod ($fh, $filename) = tempfile(); #pod #pod ($fh, $filename) = tempfile( $template, DIR => $dir); #pod ($fh, $filename) = tempfile( $template, SUFFIX => '.dat'); #pod ($fh, $filename) = tempfile( $template, TMPDIR => 1 ); #pod #pod binmode( $fh, ":utf8" ); #pod #pod $dir = tempdir( CLEANUP => 1 ); #pod ($fh, $filename) = tempfile( DIR => $dir ); #pod #pod Object interface: #pod #pod require File::Temp; #pod use File::Temp (); #pod use File::Temp qw/ :seekable /; #pod #pod $fh = File::Temp->new(); #pod $fname = $fh->filename; #pod #pod $fh = File::Temp->new(TEMPLATE => $template); #pod $fname = $fh->filename; #pod #pod $tmp = File::Temp->new( UNLINK => 0, SUFFIX => '.dat' ); #pod print $tmp "Some data\n"; #pod print "Filename is $tmp\n"; #pod $tmp->seek( 0, SEEK_END ); #pod #pod $dir = File::Temp->newdir(); # CLEANUP => 1 by default #pod #pod The following interfaces are provided for compatibility with #pod existing APIs. They should not be used in new code. #pod #pod MkTemp family: #pod #pod use File::Temp qw/ :mktemp /; #pod #pod ($fh, $file) = mkstemp( "tmpfileXXXXX" ); #pod ($fh, $file) = mkstemps( "tmpfileXXXXXX", $suffix); #pod #pod $tmpdir = mkdtemp( $template ); #pod #pod $unopened_file = mktemp( $template ); #pod #pod POSIX functions: #pod #pod use File::Temp qw/ :POSIX /; #pod #pod $file = tmpnam(); #pod $fh = tmpfile(); #pod #pod ($fh, $file) = tmpnam(); #pod #pod Compatibility functions: #pod #pod $unopened_file = File::Temp::tempnam( $dir, $pfx ); #pod #pod =head1 DESCRIPTION #pod #pod C can be used to create and open temporary files in a safe #pod way. There is both a function interface and an object-oriented #pod interface. The File::Temp constructor or the tempfile() function can #pod be used to return the name and the open filehandle of a temporary #pod file. The tempdir() function can be used to create a temporary #pod directory. #pod #pod The security aspect of temporary file creation is emphasized such that #pod a filehandle and filename are returned together. This helps guarantee #pod that a race condition can not occur where the temporary file is #pod created by another process between checking for the existence of the #pod file and its opening. Additional security levels are provided to #pod check, for example, that the sticky bit is set on world writable #pod directories. See L<"safe_level"> for more information. #pod #pod For compatibility with popular C library functions, Perl implementations of #pod the mkstemp() family of functions are provided. These are, mkstemp(), #pod mkstemps(), mkdtemp() and mktemp(). #pod #pod Additionally, implementations of the standard L #pod tmpnam() and tmpfile() functions are provided if required. #pod #pod Implementations of mktemp(), tmpnam(), and tempnam() are provided, #pod but should be used with caution since they return only a filename #pod that was valid when function was called, so cannot guarantee #pod that the file will not exist by the time the caller opens the filename. #pod #pod Filehandles returned by these functions support the seekable methods. #pod #pod =cut # Toolchain targets v5.8.1, but we'll try to support back to v5.6 anyway. # It might be possible to make this v5.5, but many v5.6isms are creeping # into the code and tests. use 5.006; use strict; use Carp; use File::Spec 0.8; use Cwd (); use File::Path 2.06 qw/ rmtree /; use Fcntl 1.03; use IO::Seekable; # For SEEK_* use Errno; use Scalar::Util 'refaddr'; require VMS::Stdio if $^O eq 'VMS'; # pre-emptively load Carp::Heavy. If we don't when we run out of file # handles and attempt to call croak() we get an error message telling # us that Carp::Heavy won't load rather than an error telling us we # have run out of file handles. We either preload croak() or we # switch the calls to croak from _gettemp() to use die. eval { require Carp::Heavy; }; # Need the Symbol package if we are running older perl require Symbol if $] < 5.006; ### For the OO interface use parent 0.221 qw/ IO::Handle IO::Seekable /; use overload '""' => "STRINGIFY", '0+' => "NUMIFY", fallback => 1; our $DEBUG = 0; our $KEEP_ALL = 0; # We are exporting functions use Exporter 5.57 'import'; # 5.57 lets us import 'import' # Export list - to allow fine tuning of export table our @EXPORT_OK = qw{ tempfile tempdir tmpnam tmpfile mktemp mkstemp mkstemps mkdtemp unlink0 cleanup SEEK_SET SEEK_CUR SEEK_END }; # Groups of functions for export our %EXPORT_TAGS = ( 'POSIX' => [qw/ tmpnam tmpfile /], 'mktemp' => [qw/ mktemp mkstemp mkstemps mkdtemp/], 'seekable' => [qw/ SEEK_SET SEEK_CUR SEEK_END /], ); # add contents of these tags to @EXPORT Exporter::export_tags('POSIX','mktemp','seekable'); # This is a list of characters that can be used in random filenames my @CHARS = (qw/ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9 _ /); # Maximum number of tries to make a temp file before failing use constant MAX_TRIES => 1000; # Minimum number of X characters that should be in a template use constant MINX => 4; # Default template when no template supplied use constant TEMPXXX => 'X' x 10; # Constants for the security level use constant STANDARD => 0; use constant MEDIUM => 1; use constant HIGH => 2; # OPENFLAGS. If we defined the flag to use with Sysopen here this gives # us an optimisation when many temporary files are requested my $OPENFLAGS = O_CREAT | O_EXCL | O_RDWR; my $LOCKFLAG; unless ($^O eq 'MacOS') { for my $oflag (qw/ NOFOLLOW BINARY LARGEFILE NOINHERIT /) { my ($bit, $func) = (0, "Fcntl::O_" . $oflag); no strict 'refs'; $OPENFLAGS |= $bit if eval { # Make sure that redefined die handlers do not cause problems # e.g. CGI::Carp local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; $bit = &$func(); 1; }; } # Special case O_EXLOCK $LOCKFLAG = eval { local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; &Fcntl::O_EXLOCK(); }; } # On some systems the O_TEMPORARY flag can be used to tell the OS # to automatically remove the file when it is closed. This is fine # in most cases but not if tempfile is called with UNLINK=>0 and # the filename is requested -- in the case where the filename is to # be passed to another routine. This happens on windows. We overcome # this by using a second open flags variable my $OPENTEMPFLAGS = $OPENFLAGS; unless ($^O eq 'MacOS') { for my $oflag (qw/ TEMPORARY /) { my ($bit, $func) = (0, "Fcntl::O_" . $oflag); local($@); no strict 'refs'; $OPENTEMPFLAGS |= $bit if eval { # Make sure that redefined die handlers do not cause problems # e.g. CGI::Carp local $SIG{__DIE__} = sub {}; local $SIG{__WARN__} = sub {}; $bit = &$func(); 1; }; } } # Private hash tracking which files have been created by each process id via the OO interface my %FILES_CREATED_BY_OBJECT; # INTERNAL ROUTINES - not to be used outside of package # Generic routine for getting a temporary filename # modelled on OpenBSD _gettemp() in mktemp.c # The template must contain X's that are to be replaced # with the random values # Arguments: # TEMPLATE - string containing the XXXXX's that is converted # to a random filename and opened if required # Optionally, a hash can also be supplied containing specific options # "open" => if true open the temp file, else just return the name # default is 0 # "mkdir"=> if true, we are creating a temp directory rather than tempfile # default is 0 # "suffixlen" => number of characters at end of PATH to be ignored. # default is 0. # "unlink_on_close" => indicates that, if possible, the OS should remove # the file as soon as it is closed. Usually indicates # use of the O_TEMPORARY flag to sysopen. # Usually irrelevant on unix # "use_exlock" => Indicates that O_EXLOCK should be used. Default is false. # "file_permissions" => file permissions for sysopen(). Default is 0600. # Optionally a reference to a scalar can be passed into the function # On error this will be used to store the reason for the error # "ErrStr" => \$errstr # "open" and "mkdir" can not both be true # "unlink_on_close" is not used when "mkdir" is true. # The default options are equivalent to mktemp(). # Returns: # filehandle - open file handle (if called with doopen=1, else undef) # temp name - name of the temp file or directory # For example: # ($fh, $name) = _gettemp($template, "open" => 1); # for the current version, failures are associated with # stored in an error string and returned to give the reason whilst debugging # This routine is not called by any external function sub _gettemp { croak 'Usage: ($fh, $name) = _gettemp($template, OPTIONS);' unless scalar(@_) >= 1; # the internal error string - expect it to be overridden # Need this in case the caller decides not to supply us a value # need an anonymous scalar my $tempErrStr; # Default options my %options = ( "open" => 0, "mkdir" => 0, "suffixlen" => 0, "unlink_on_close" => 0, "use_exlock" => 0, "ErrStr" => \$tempErrStr, "file_permissions" => undef, ); # Read the template my $template = shift; if (ref($template)) { # Use a warning here since we have not yet merged ErrStr carp "File::Temp::_gettemp: template must not be a reference"; return (); } # Check that the number of entries on stack are even if (scalar(@_) % 2 != 0) { # Use a warning here since we have not yet merged ErrStr carp "File::Temp::_gettemp: Must have even number of options"; return (); } # Read the options and merge with defaults %options = (%options, @_) if @_; # Make sure the error string is set to undef ${$options{ErrStr}} = undef; # Can not open the file and make a directory in a single call if ($options{"open"} && $options{"mkdir"}) { ${$options{ErrStr}} = "doopen and domkdir can not both be true\n"; return (); } # Find the start of the end of the Xs (position of last X) # Substr starts from 0 my $start = length($template) - 1 - $options{"suffixlen"}; # Check that we have at least MINX x X (e.g. 'XXXX") at the end of the string # (taking suffixlen into account). Any fewer is insecure. # Do it using substr - no reason to use a pattern match since # we know where we are looking and what we are looking for if (substr($template, $start - MINX + 1, MINX) ne 'X' x MINX) { ${$options{ErrStr}} = "The template must end with at least ". MINX . " 'X' characters\n"; return (); } # Replace all the X at the end of the substring with a # random character or just all the XX at the end of a full string. # Do it as an if, since the suffix adjusts which section to replace # and suffixlen=0 returns nothing if used in the substr directly # and generate a full path from the template my $path = _replace_XX($template, $options{"suffixlen"}); # Split the path into constituent parts - eventually we need to check # whether the directory exists # We need to know whether we are making a temp directory # or a tempfile my ($volume, $directories, $file); my $parent; # parent directory if ($options{"mkdir"}) { # There is no filename at the end ($volume, $directories, $file) = File::Spec->splitpath( $path, 1); # The parent is then $directories without the last directory # Split the directory and put it back together again my @dirs = File::Spec->splitdir($directories); # If @dirs only has one entry (i.e. the directory template) that means # we are in the current directory if ($#dirs == 0) { $parent = File::Spec->curdir; } else { if ($^O eq 'VMS') { # need volume to avoid relative dir spec $parent = File::Spec->catdir($volume, @dirs[0..$#dirs-1]); $parent = 'sys$disk:[]' if $parent eq ''; } else { # Put it back together without the last one $parent = File::Spec->catdir(@dirs[0..$#dirs-1]); # ...and attach the volume (no filename) $parent = File::Spec->catpath($volume, $parent, ''); } } } else { # Get rid of the last filename (use File::Basename for this?) ($volume, $directories, $file) = File::Spec->splitpath( $path ); # Join up without the file part $parent = File::Spec->catpath($volume,$directories,''); # If $parent is empty replace with curdir $parent = File::Spec->curdir unless $directories ne ''; } # Check that the parent directories exist # Do this even for the case where we are simply returning a name # not a file -- no point returning a name that includes a directory # that does not exist or is not writable unless (-e $parent) { ${$options{ErrStr}} = "Parent directory ($parent) does not exist"; return (); } unless (-d $parent) { ${$options{ErrStr}} = "Parent directory ($parent) is not a directory"; return (); } # Check the stickiness of the directory and chown giveaway if required # If the directory is world writable the sticky bit # must be set if (File::Temp->safe_level == MEDIUM) { my $safeerr; unless (_is_safe($parent,\$safeerr)) { ${$options{ErrStr}} = "Parent directory ($parent) is not safe ($safeerr)"; return (); } } elsif (File::Temp->safe_level == HIGH) { my $safeerr; unless (_is_verysafe($parent, \$safeerr)) { ${$options{ErrStr}} = "Parent directory ($parent) is not safe ($safeerr)"; return (); } } my $perms = $options{file_permissions}; my $has_perms = defined $perms; $perms = 0600 unless $has_perms; # Now try MAX_TRIES time to open the file for (my $i = 0; $i < MAX_TRIES; $i++) { # Try to open the file if requested if ($options{"open"}) { my $fh; # If we are running before perl5.6.0 we can not auto-vivify if ($] < 5.006) { $fh = &Symbol::gensym; } # Try to make sure this will be marked close-on-exec # XXX: Win32 doesn't respect this, nor the proper fcntl, # but may have O_NOINHERIT. This may or may not be in Fcntl. local $^F = 2; # Attempt to open the file my $open_success = undef; if ( $^O eq 'VMS' and $options{"unlink_on_close"} && !$KEEP_ALL) { # make it auto delete on close by setting FAB$V_DLT bit $fh = VMS::Stdio::vmssysopen($path, $OPENFLAGS, $perms, 'fop=dlt'); $open_success = $fh; } else { my $flags = ( ($options{"unlink_on_close"} && !$KEEP_ALL) ? $OPENTEMPFLAGS : $OPENFLAGS ); $flags |= $LOCKFLAG if (defined $LOCKFLAG && $options{use_exlock}); $open_success = sysopen($fh, $path, $flags, $perms); } if ( $open_success ) { # in case of odd umask force rw chmod($perms, $path) unless $has_perms; # Opened successfully - return file handle and name return ($fh, $path); } else { # Error opening file - abort with error # if the reason was anything but EEXIST unless ($!{EEXIST}) { ${$options{ErrStr}} = "Could not create temp file $path: $!"; return (); } # Loop round for another try } } elsif ($options{"mkdir"}) { # Open the temp directory if (mkdir( $path, 0700)) { # in case of odd umask chmod(0700, $path); return undef, $path; } else { # Abort with error if the reason for failure was anything # except EEXIST unless ($!{EEXIST}) { ${$options{ErrStr}} = "Could not create directory $path: $!"; return (); } # Loop round for another try } } else { # Return true if the file can not be found # Directory has been checked previously return (undef, $path) unless -e $path; # Try again until MAX_TRIES } # Did not successfully open the tempfile/dir # so try again with a different set of random letters # No point in trying to increment unless we have only # 1 X say and the randomness could come up with the same # file MAX_TRIES in a row. # Store current attempt - in principle this implies that the # 3rd time around the open attempt that the first temp file # name could be generated again. Probably should store each # attempt and make sure that none are repeated my $original = $path; my $counter = 0; # Stop infinite loop my $MAX_GUESS = 50; do { # Generate new name from original template $path = _replace_XX($template, $options{"suffixlen"}); $counter++; } until ($path ne $original || $counter > $MAX_GUESS); # Check for out of control looping if ($counter > $MAX_GUESS) { ${$options{ErrStr}} = "Tried to get a new temp name different to the previous value $MAX_GUESS times.\nSomething wrong with template?? ($template)"; return (); } } # If we get here, we have run out of tries ${ $options{ErrStr} } = "Have exceeded the maximum number of attempts (" . MAX_TRIES . ") to open temp file/dir"; return (); } # Internal routine to replace the XXXX... with random characters # This has to be done by _gettemp() every time it fails to # open a temp file/dir # Arguments: $template (the template with XXX), # $ignore (number of characters at end to ignore) # Returns: modified template sub _replace_XX { croak 'Usage: _replace_XX($template, $ignore)' unless scalar(@_) == 2; my ($path, $ignore) = @_; # Do it as an if, since the suffix adjusts which section to replace # and suffixlen=0 returns nothing if used in the substr directly # Alternatively, could simply set $ignore to length($path)-1 # Don't want to always use substr when not required though. my $end = ( $] >= 5.006 ? "\\z" : "\\Z" ); if ($ignore) { substr($path, 0, - $ignore) =~ s/X(?=X*$end)/$CHARS[ int( rand( @CHARS ) ) ]/ge; } else { $path =~ s/X(?=X*$end)/$CHARS[ int( rand( @CHARS ) ) ]/ge; } return $path; } # Internal routine to force a temp file to be writable after # it is created so that we can unlink it. Windows seems to occasionally # force a file to be readonly when written to certain temp locations sub _force_writable { my $file = shift; chmod 0600, $file; } # internal routine to check to see if the directory is safe # First checks to see if the directory is not owned by the # current user or root. Then checks to see if anyone else # can write to the directory and if so, checks to see if # it has the sticky bit set # Will not work on systems that do not support sticky bit #Args: directory path to check # Optionally: reference to scalar to contain error message # Returns true if the path is safe and false otherwise. # Returns undef if can not even run stat() on the path # This routine based on version written by Tom Christiansen # Presumably, by the time we actually attempt to create the # file or directory in this directory, it may not be safe # anymore... Have to run _is_safe directly after the open. sub _is_safe { my $path = shift; my $err_ref = shift; # Stat path my @info = stat($path); unless (scalar(@info)) { $$err_ref = "stat(path) returned no values"; return 0; } ; return 1 if $^O eq 'VMS'; # owner delete control at file level # Check to see whether owner is neither superuser (or a system uid) nor me # Use the effective uid from the $> variable # UID is in [4] if ($info[4] > File::Temp->top_system_uid() && $info[4] != $>) { Carp::cluck(sprintf "uid=$info[4] topuid=%s euid=$> path='$path'", File::Temp->top_system_uid()); $$err_ref = "Directory owned neither by root nor the current user" if ref($err_ref); return 0; } # check whether group or other can write file # use 066 to detect either reading or writing # use 022 to check writability # Do it with S_IWOTH and S_IWGRP for portability (maybe) # mode is in info[2] if (($info[2] & &Fcntl::S_IWGRP) || # Is group writable? ($info[2] & &Fcntl::S_IWOTH) ) { # Is world writable? # Must be a directory unless (-d $path) { $$err_ref = "Path ($path) is not a directory" if ref($err_ref); return 0; } # Must have sticky bit set unless (-k $path) { $$err_ref = "Sticky bit not set on $path when dir is group|world writable" if ref($err_ref); return 0; } } return 1; } # Internal routine to check whether a directory is safe # for temp files. Safer than _is_safe since it checks for # the possibility of chown giveaway and if that is a possibility # checks each directory in the path to see if it is safe (with _is_safe) # If _PC_CHOWN_RESTRICTED is not set, does the full test of each # directory anyway. # Takes optional second arg as scalar ref to error reason sub _is_verysafe { # Need POSIX - but only want to bother if really necessary due to overhead require POSIX; my $path = shift; print "_is_verysafe testing $path\n" if $DEBUG; return 1 if $^O eq 'VMS'; # owner delete control at file level my $err_ref = shift; # Should Get the value of _PC_CHOWN_RESTRICTED if it is defined # and If it is not there do the extensive test local($@); my $chown_restricted; $chown_restricted = &POSIX::_PC_CHOWN_RESTRICTED() if eval { &POSIX::_PC_CHOWN_RESTRICTED(); 1}; # If chown_resticted is set to some value we should test it if (defined $chown_restricted) { # Return if the current directory is safe return _is_safe($path,$err_ref) if POSIX::sysconf( $chown_restricted ); } # To reach this point either, the _PC_CHOWN_RESTRICTED symbol # was not available or the symbol was there but chown giveaway # is allowed. Either way, we now have to test the entire tree for # safety. # Convert path to an absolute directory if required unless (File::Spec->file_name_is_absolute($path)) { $path = File::Spec->rel2abs($path); } # Split directory into components - assume no file my ($volume, $directories, undef) = File::Spec->splitpath( $path, 1); # Slightly less efficient than having a function in File::Spec # to chop off the end of a directory or even a function that # can handle ../ in a directory tree # Sometimes splitdir() returns a blank at the end # so we will probably check the bottom directory twice in some cases my @dirs = File::Spec->splitdir($directories); # Concatenate one less directory each time around foreach my $pos (0.. $#dirs) { # Get a directory name my $dir = File::Spec->catpath($volume, File::Spec->catdir(@dirs[0.. $#dirs - $pos]), '' ); print "TESTING DIR $dir\n" if $DEBUG; # Check the directory return 0 unless _is_safe($dir,$err_ref); } return 1; } # internal routine to determine whether unlink works on this # platform for files that are currently open. # Returns true if we can, false otherwise. # Currently WinNT, OS/2 and VMS can not unlink an opened file # On VMS this is because the O_EXCL flag is used to open the # temporary file. Currently I do not know enough about the issues # on VMS to decide whether O_EXCL is a requirement. sub _can_unlink_opened_file { if (grep $^O eq $_, qw/MSWin32 os2 VMS dos MacOS haiku/) { return 0; } else { return 1; } } # internal routine to decide which security levels are allowed # see safe_level() for more information on this # Controls whether the supplied security level is allowed # $cando = _can_do_level( $level ) sub _can_do_level { # Get security level my $level = shift; # Always have to be able to do STANDARD return 1 if $level == STANDARD; # Currently, the systems that can do HIGH or MEDIUM are identical if ( $^O eq 'MSWin32' || $^O eq 'os2' || $^O eq 'cygwin' || $^O eq 'dos' || $^O eq 'MacOS' || $^O eq 'mpeix') { return 0; } else { return 1; } } # This routine sets up a deferred unlinking of a specified # filename and filehandle. It is used in the following cases: # - Called by unlink0 if an opened file can not be unlinked # - Called by tempfile() if files are to be removed on shutdown # - Called by tempdir() if directories are to be removed on shutdown # Arguments: # _deferred_unlink( $fh, $fname, $isdir ); # # - filehandle (so that it can be explicitly closed if open # - filename (the thing we want to remove) # - isdir (flag to indicate that we are being given a directory) # [and hence no filehandle] # Status is not referred to since all the magic is done with an END block { # Will set up two lexical variables to contain all the files to be # removed. One array for files, another for directories They will # only exist in this block. # This means we only have to set up a single END block to remove # all files. # in order to prevent child processes inadvertently deleting the parent # temp files we use a hash to store the temp files and directories # created by a particular process id. # %files_to_unlink contains values that are references to an array of # array references containing the filehandle and filename associated with # the temp file. my (%files_to_unlink, %dirs_to_unlink); # Set up an end block to use these arrays END { local($., $@, $!, $^E, $?); cleanup(at_exit => 1); } # Cleanup function. Always triggered on END (with at_exit => 1) but # can be invoked manually. sub cleanup { my %h = @_; my $at_exit = delete $h{at_exit}; $at_exit = 0 if not defined $at_exit; { my @k = sort keys %h; die "unrecognized parameters: @k" if @k } if (!$KEEP_ALL) { # Files my @files = (exists $files_to_unlink{$$} ? @{ $files_to_unlink{$$} } : () ); foreach my $file (@files) { # close the filehandle without checking its state # in order to make real sure that this is closed # if its already closed then I don't care about the answer # probably a better way to do this close($file->[0]); # file handle is [0] if (-f $file->[1]) { # file name is [1] _force_writable( $file->[1] ); # for windows unlink $file->[1] or warn "Error removing ".$file->[1]; } } # Dirs my @dirs = (exists $dirs_to_unlink{$$} ? @{ $dirs_to_unlink{$$} } : () ); my ($cwd, $cwd_to_remove); foreach my $dir (@dirs) { if (-d $dir) { # Some versions of rmtree will abort if you attempt to remove # the directory you are sitting in. For automatic cleanup # at program exit, we avoid this by chdir()ing out of the way # first. If not at program exit, it's best not to mess with the # current directory, so just let it fail with a warning. if ($at_exit) { $cwd = Cwd::abs_path(File::Spec->curdir) if not defined $cwd; my $abs = Cwd::abs_path($dir); if ($abs eq $cwd) { $cwd_to_remove = $dir; next; } } eval { rmtree($dir, $DEBUG, 0); }; warn $@ if ($@ && $^W); } } if (defined $cwd_to_remove) { # We do need to clean up the current directory, and everything # else is done, so get out of there and remove it. chdir $cwd_to_remove or die "cannot chdir to $cwd_to_remove: $!"; my $updir = File::Spec->updir; chdir $updir or die "cannot chdir to $updir: $!"; eval { rmtree($cwd_to_remove, $DEBUG, 0); }; warn $@ if ($@ && $^W); } # clear the arrays @{ $files_to_unlink{$$} } = () if exists $files_to_unlink{$$}; @{ $dirs_to_unlink{$$} } = () if exists $dirs_to_unlink{$$}; } } # This is the sub called to register a file for deferred unlinking # This could simply store the input parameters and defer everything # until the END block. For now we do a bit of checking at this # point in order to make sure that (1) we have a file/dir to delete # and (2) we have been called with the correct arguments. sub _deferred_unlink { croak 'Usage: _deferred_unlink($fh, $fname, $isdir)' unless scalar(@_) == 3; my ($fh, $fname, $isdir) = @_; warn "Setting up deferred removal of $fname\n" if $DEBUG; # make sure we save the absolute path for later cleanup # OK to untaint because we only ever use this internally # as a file path, never interpolating into the shell $fname = Cwd::abs_path($fname); ($fname) = $fname =~ /^(.*)$/; # If we have a directory, check that it is a directory if ($isdir) { if (-d $fname) { # Directory exists so store it # first on VMS turn []foo into [.foo] for rmtree $fname = VMS::Filespec::vmspath($fname) if $^O eq 'VMS'; $dirs_to_unlink{$$} = [] unless exists $dirs_to_unlink{$$}; push (@{ $dirs_to_unlink{$$} }, $fname); } else { carp "Request to remove directory $fname could not be completed since it does not exist!\n" if $^W; } } else { if (-f $fname) { # file exists so store handle and name for later removal $files_to_unlink{$$} = [] unless exists $files_to_unlink{$$}; push(@{ $files_to_unlink{$$} }, [$fh, $fname]); } else { carp "Request to remove file $fname could not be completed since it is not there!\n" if $^W; } } } } # normalize argument keys to upper case and do consistent handling # of leading template vs TEMPLATE sub _parse_args { my $leading_template = (scalar(@_) % 2 == 1 ? shift(@_) : '' ); my %args = @_; %args = map +(uc($_) => $args{$_}), keys %args; # template (store it in an array so that it will # disappear from the arg list of tempfile) my @template = ( exists $args{TEMPLATE} ? $args{TEMPLATE} : $leading_template ? $leading_template : () ); delete $args{TEMPLATE}; return( \@template, \%args ); } #pod =head1 OBJECT-ORIENTED INTERFACE #pod #pod This is the primary interface for interacting with #pod C. Using the OO interface a temporary file can be created #pod when the object is constructed and the file can be removed when the #pod object is no longer required. #pod #pod Note that there is no method to obtain the filehandle from the #pod C object. The object itself acts as a filehandle. The object #pod isa C and isa C so all those methods are #pod available. #pod #pod Also, the object is configured such that it stringifies to the name of the #pod temporary file and so can be compared to a filename directly. It numifies #pod to the C the same as other handles and so can be compared to other #pod handles with C<==>. #pod #pod $fh eq $filename # as a string #pod $fh != \*STDOUT # as a number #pod #pod Available since 0.14. #pod #pod =over 4 #pod #pod =item B #pod #pod Create a temporary file object. #pod #pod my $tmp = File::Temp->new(); #pod #pod by default the object is constructed as if C #pod was called without options, but with the additional behaviour #pod that the temporary file is removed by the object destructor #pod if UNLINK is set to true (the default). #pod #pod Supported arguments are the same as for C: UNLINK #pod (defaulting to true), DIR, EXLOCK, PERMS and SUFFIX. #pod Additionally, the filename #pod template is specified using the TEMPLATE option. The OPEN option #pod is not supported (the file is always opened). #pod #pod $tmp = File::Temp->new( TEMPLATE => 'tempXXXXX', #pod DIR => 'mydir', #pod SUFFIX => '.dat'); #pod #pod Arguments are case insensitive. #pod #pod Can call croak() if an error occurs. #pod #pod Available since 0.14. #pod #pod TEMPLATE available since 0.23 #pod #pod =cut sub new { my $proto = shift; my $class = ref($proto) || $proto; my ($maybe_template, $args) = _parse_args(@_); # see if they are unlinking (defaulting to yes) my $unlink = (exists $args->{UNLINK} ? $args->{UNLINK} : 1 ); delete $args->{UNLINK}; # Protect OPEN delete $args->{OPEN}; # Open the file and retain file handle and file name my ($fh, $path) = tempfile( @$maybe_template, %$args ); print "Tmp: $fh - $path\n" if $DEBUG; # Store the filename in the scalar slot ${*$fh} = $path; # Cache the filename by pid so that the destructor can decide whether to remove it $FILES_CREATED_BY_OBJECT{$$}{$path} = 1; # Store unlink information in hash slot (plus other constructor info) %{*$fh} = %$args; # create the object bless $fh, $class; # final method-based configuration $fh->unlink_on_destroy( $unlink ); return $fh; } #pod =item B #pod #pod Create a temporary directory using an object oriented interface. #pod #pod $dir = File::Temp->newdir(); #pod #pod By default the directory is deleted when the object goes out of scope. #pod #pod Supports the same options as the C function. Note that directories #pod created with this method default to CLEANUP => 1. #pod #pod $dir = File::Temp->newdir( $template, %options ); #pod #pod A template may be specified either with a leading template or #pod with a TEMPLATE argument. #pod #pod Available since 0.19. #pod #pod TEMPLATE available since 0.23. #pod #pod =cut sub newdir { my $self = shift; my ($maybe_template, $args) = _parse_args(@_); # handle CLEANUP without passing CLEANUP to tempdir my $cleanup = (exists $args->{CLEANUP} ? $args->{CLEANUP} : 1 ); delete $args->{CLEANUP}; my $tempdir = tempdir( @$maybe_template, %$args); # get a safe absolute path for cleanup, just like # happens in _deferred_unlink my $real_dir = Cwd::abs_path( $tempdir ); ($real_dir) = $real_dir =~ /^(.*)$/; return bless { DIRNAME => $tempdir, REALNAME => $real_dir, CLEANUP => $cleanup, LAUNCHPID => $$, }, "File::Temp::Dir"; } #pod =item B #pod #pod Return the name of the temporary file associated with this object #pod (if the object was created using the "new" constructor). #pod #pod $filename = $tmp->filename; #pod #pod This method is called automatically when the object is used as #pod a string. #pod #pod Current API available since 0.14 #pod #pod =cut sub filename { my $self = shift; return ${*$self}; } sub STRINGIFY { my $self = shift; return $self->filename; } # For reference, can't use '0+'=>\&Scalar::Util::refaddr directly because # refaddr() demands one parameter only, whereas overload.pm calls with three # even for unary operations like '0+'. sub NUMIFY { return refaddr($_[0]); } #pod =item B #pod #pod Return the name of the temporary directory associated with this #pod object (if the object was created using the "newdir" constructor). #pod #pod $dirname = $tmpdir->dirname; #pod #pod This method is called automatically when the object is used in string context. #pod #pod =item B #pod #pod Control whether the file is unlinked when the object goes out of scope. #pod The file is removed if this value is true and $KEEP_ALL is not. #pod #pod $fh->unlink_on_destroy( 1 ); #pod #pod Default is for the file to be removed. #pod #pod Current API available since 0.15 #pod #pod =cut sub unlink_on_destroy { my $self = shift; if (@_) { ${*$self}{UNLINK} = shift; } return ${*$self}{UNLINK}; } #pod =item B #pod #pod When the object goes out of scope, the destructor is called. This #pod destructor will attempt to unlink the file (using L) #pod if the constructor was called with UNLINK set to 1 (the default state #pod if UNLINK is not specified). #pod #pod No error is given if the unlink fails. #pod #pod If the object has been passed to a child process during a fork, the #pod file will be deleted when the object goes out of scope in the parent. #pod #pod For a temporary directory object the directory will be removed unless #pod the CLEANUP argument was used in the constructor (and set to false) or #pod C was modified after creation. Note that if a temp #pod directory is your current directory, it cannot be removed - a warning #pod will be given in this case. C out of the directory before #pod letting the object go out of scope. #pod #pod If the global variable $KEEP_ALL is true, the file or directory #pod will not be removed. #pod #pod =cut sub DESTROY { local($., $@, $!, $^E, $?); my $self = shift; # Make sure we always remove the file from the global hash # on destruction. This prevents the hash from growing uncontrollably # and post-destruction there is no reason to know about the file. my $file = $self->filename; my $was_created_by_proc; if (exists $FILES_CREATED_BY_OBJECT{$$}{$file}) { $was_created_by_proc = 1; delete $FILES_CREATED_BY_OBJECT{$$}{$file}; } if (${*$self}{UNLINK} && !$KEEP_ALL) { print "# ---------> Unlinking $self\n" if $DEBUG; # only delete if this process created it return unless $was_created_by_proc; # The unlink1 may fail if the file has been closed # by the caller. This leaves us with the decision # of whether to refuse to remove the file or simply # do an unlink without test. Seems to be silly # to do this when we are trying to be careful # about security _force_writable( $file ); # for windows unlink1( $self, $file ) or unlink($file); } } #pod =back #pod #pod =head1 FUNCTIONS #pod #pod This section describes the recommended interface for generating #pod temporary files and directories. #pod #pod =over 4 #pod #pod =item B #pod #pod This is the basic function to generate temporary files. #pod The behaviour of the file can be changed using various options: #pod #pod $fh = tempfile(); #pod ($fh, $filename) = tempfile(); #pod #pod Create a temporary file in the directory specified for temporary #pod files, as specified by the tmpdir() function in L. #pod #pod ($fh, $filename) = tempfile($template); #pod #pod Create a temporary file in the current directory using the supplied #pod template. Trailing `X' characters are replaced with random letters to #pod generate the filename. At least four `X' characters must be present #pod at the end of the template. #pod #pod ($fh, $filename) = tempfile($template, SUFFIX => $suffix) #pod #pod Same as previously, except that a suffix is added to the template #pod after the `X' translation. Useful for ensuring that a temporary #pod filename has a particular extension when needed by other applications. #pod But see the WARNING at the end. #pod #pod ($fh, $filename) = tempfile($template, DIR => $dir); #pod #pod Translates the template as before except that a directory name #pod is specified. #pod #pod ($fh, $filename) = tempfile($template, TMPDIR => 1); #pod #pod Equivalent to specifying a DIR of "File::Spec->tmpdir", writing the file #pod into the same temporary directory as would be used if no template was #pod specified at all. #pod #pod ($fh, $filename) = tempfile($template, UNLINK => 1); #pod #pod Return the filename and filehandle as before except that the file is #pod automatically removed when the program exits (dependent on #pod $KEEP_ALL). Default is for the file to be removed if a file handle is #pod requested and to be kept if the filename is requested. In a scalar #pod context (where no filename is returned) the file is always deleted #pod either (depending on the operating system) on exit or when it is #pod closed (unless $KEEP_ALL is true when the temp file is created). #pod #pod Use the object-oriented interface if fine-grained control of when #pod a file is removed is required. #pod #pod If the template is not specified, a template is always #pod automatically generated. This temporary file is placed in tmpdir() #pod (L) unless a directory is specified explicitly with the #pod DIR option. #pod #pod $fh = tempfile( DIR => $dir ); #pod #pod If called in scalar context, only the filehandle is returned and the #pod file will automatically be deleted when closed on operating systems #pod that support this (see the description of tmpfile() elsewhere in this #pod document). This is the preferred mode of operation, as if you only #pod have a filehandle, you can never create a race condition by fumbling #pod with the filename. On systems that can not unlink an open file or can #pod not mark a file as temporary when it is opened (for example, Windows #pod NT uses the C flag) the file is marked for deletion when #pod the program ends (equivalent to setting UNLINK to 1). The C #pod flag is ignored if present. #pod #pod (undef, $filename) = tempfile($template, OPEN => 0); #pod #pod This will return the filename based on the template but #pod will not open this file. Cannot be used in conjunction with #pod UNLINK set to true. Default is to always open the file #pod to protect from possible race conditions. A warning is issued #pod if warnings are turned on. Consider using the tmpnam() #pod and mktemp() functions described elsewhere in this document #pod if opening the file is not required. #pod #pod To open the temporary filehandle with O_EXLOCK (open with exclusive #pod file lock) use C<< EXLOCK=>1 >>. This is supported only by some #pod operating systems (most notably BSD derived systems). By default #pod EXLOCK will be false. Former C versions set EXLOCK to #pod true, so to be sure to get an unlocked filehandle also with older #pod versions, explicitly set C<< EXLOCK=>0 >>. #pod #pod ($fh, $filename) = tempfile($template, EXLOCK => 1); #pod #pod By default, the temp file is created with 0600 file permissions. #pod Use C to change this: #pod #pod ($fh, $filename) = tempfile($template, PERMS => 0666); #pod #pod Options can be combined as required. #pod #pod Will croak() if there is an error. #pod #pod Available since 0.05. #pod #pod UNLINK flag available since 0.10. #pod #pod TMPDIR flag available since 0.19. #pod #pod EXLOCK flag available since 0.19. #pod #pod PERMS flag available since 0.2310. #pod #pod =cut sub tempfile { if ( @_ && $_[0] eq 'File::Temp' ) { croak "'tempfile' can't be called as a method"; } # Can not check for argument count since we can have any # number of args # Default options my %options = ( "DIR" => undef, # Directory prefix "SUFFIX" => '', # Template suffix "UNLINK" => 0, # Do not unlink file on exit "OPEN" => 1, # Open file "TMPDIR" => 0, # Place tempfile in tempdir if template specified "EXLOCK" => 0, # Open file with O_EXLOCK "PERMS" => undef, # File permissions ); # Check to see whether we have an odd or even number of arguments my ($maybe_template, $args) = _parse_args(@_); my $template = @$maybe_template ? $maybe_template->[0] : undef; # Read the options and merge with defaults %options = (%options, %$args); # First decision is whether or not to open the file if (! $options{"OPEN"}) { warn "tempfile(): temporary filename requested but not opened.\nPossibly unsafe, consider using tempfile() with OPEN set to true\n" if $^W; } if ($options{"DIR"} and $^O eq 'VMS') { # on VMS turn []foo into [.foo] for concatenation $options{"DIR"} = VMS::Filespec::vmspath($options{"DIR"}); } # Construct the template # Have a choice of trying to work around the mkstemp/mktemp/tmpnam etc # functions or simply constructing a template and using _gettemp() # explicitly. Go for the latter # First generate a template if not defined and prefix the directory # If no template must prefix the temp directory if (defined $template) { # End up with current directory if neither DIR not TMPDIR are set if ($options{"DIR"}) { $template = File::Spec->catfile($options{"DIR"}, $template); } elsif ($options{TMPDIR}) { $template = File::Spec->catfile(_wrap_file_spec_tmpdir(), $template ); } } else { if ($options{"DIR"}) { $template = File::Spec->catfile($options{"DIR"}, TEMPXXX); } else { $template = File::Spec->catfile(_wrap_file_spec_tmpdir(), TEMPXXX); } } # Now add a suffix $template .= $options{"SUFFIX"}; # Determine whether we should tell _gettemp to unlink the file # On unix this is irrelevant and can be worked out after the file is # opened (simply by unlinking the open filehandle). On Windows or VMS # we have to indicate temporary-ness when we open the file. In general # we only want a true temporary file if we are returning just the # filehandle - if the user wants the filename they probably do not # want the file to disappear as soon as they close it (which may be # important if they want a child process to use the file) # For this reason, tie unlink_on_close to the return context regardless # of OS. my $unlink_on_close = ( wantarray ? 0 : 1); # Create the file my ($fh, $path, $errstr); croak "Error in tempfile() using template $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => $options{OPEN}, "mkdir" => 0, "unlink_on_close" => $unlink_on_close, "suffixlen" => length($options{SUFFIX}), "ErrStr" => \$errstr, "use_exlock" => $options{EXLOCK}, "file_permissions" => $options{PERMS}, ) ); # Set up an exit handler that can do whatever is right for the # system. This removes files at exit when requested explicitly or when # system is asked to unlink_on_close but is unable to do so because # of OS limitations. # The latter should be achieved by using a tied filehandle. # Do not check return status since this is all done with END blocks. _deferred_unlink($fh, $path, 0) if $options{"UNLINK"}; # Return if (wantarray()) { if ($options{'OPEN'}) { return ($fh, $path); } else { return (undef, $path); } } else { # Unlink the file. It is up to unlink0 to decide what to do with # this (whether to unlink now or to defer until later) unlink0($fh, $path) or croak "Error unlinking file $path using unlink0"; # Return just the filehandle. return $fh; } } # On Windows under taint mode, File::Spec could suggest "C:\" as a tempdir # which might not be writable. If that is the case, we fallback to a # user directory. See https://rt.cpan.org/Ticket/Display.html?id=60340 { my ($alt_tmpdir, $checked); sub _wrap_file_spec_tmpdir { return File::Spec->tmpdir unless $^O eq "MSWin32" && ${^TAINT}; if ( $checked ) { return $alt_tmpdir ? $alt_tmpdir : File::Spec->tmpdir; } # probe what File::Spec gives and find a fallback my $xxpath = _replace_XX( "X" x 10, 0 ); # First, see if File::Spec->tmpdir is writable my $tmpdir = File::Spec->tmpdir; my $testpath = File::Spec->catdir( $tmpdir, $xxpath ); if (mkdir( $testpath, 0700) ) { $checked = 1; rmdir $testpath; return $tmpdir; } # Next, see if CSIDL_LOCAL_APPDATA is writable require Win32; my $local_app = File::Spec->catdir( Win32::GetFolderPath( Win32::CSIDL_LOCAL_APPDATA() ), 'Temp' ); $testpath = File::Spec->catdir( $local_app, $xxpath ); if ( -e $local_app or mkdir( $local_app, 0700 ) ) { if (mkdir( $testpath, 0700) ) { $checked = 1; rmdir $testpath; return $alt_tmpdir = $local_app; } } # Can't find something writable croak << "HERE"; Couldn't find a writable temp directory in taint mode. Tried: $tmpdir $local_app Try setting and untainting the TMPDIR environment variable. HERE } } #pod =item B #pod #pod This is the recommended interface for creation of temporary #pod directories. By default the directory will not be removed on exit #pod (that is, it won't be temporary; this behaviour can not be changed #pod because of issues with backwards compatibility). To enable removal #pod either use the CLEANUP option which will trigger removal on program #pod exit, or consider using the "newdir" method in the object interface which #pod will allow the directory to be cleaned up when the object goes out of #pod scope. #pod #pod The behaviour of the function depends on the arguments: #pod #pod $tempdir = tempdir(); #pod #pod Create a directory in tmpdir() (see L). #pod #pod $tempdir = tempdir( $template ); #pod #pod Create a directory from the supplied template. This template is #pod similar to that described for tempfile(). `X' characters at the end #pod of the template are replaced with random letters to construct the #pod directory name. At least four `X' characters must be in the template. #pod #pod $tempdir = tempdir ( DIR => $dir ); #pod #pod Specifies the directory to use for the temporary directory. #pod The temporary directory name is derived from an internal template. #pod #pod $tempdir = tempdir ( $template, DIR => $dir ); #pod #pod Prepend the supplied directory name to the template. The template #pod should not include parent directory specifications itself. Any parent #pod directory specifications are removed from the template before #pod prepending the supplied directory. #pod #pod $tempdir = tempdir ( $template, TMPDIR => 1 ); #pod #pod Using the supplied template, create the temporary directory in #pod a standard location for temporary files. Equivalent to doing #pod #pod $tempdir = tempdir ( $template, DIR => File::Spec->tmpdir); #pod #pod but shorter. Parent directory specifications are stripped from the #pod template itself. The C option is ignored if C is set #pod explicitly. Additionally, C is implied if neither a template #pod nor a directory are supplied. #pod #pod $tempdir = tempdir( $template, CLEANUP => 1); #pod #pod Create a temporary directory using the supplied template, but #pod attempt to remove it (and all files inside it) when the program #pod exits. Note that an attempt will be made to remove all files from #pod the directory even if they were not created by this module (otherwise #pod why ask to clean it up?). The directory removal is made with #pod the rmtree() function from the L module. #pod Of course, if the template is not specified, the temporary directory #pod will be created in tmpdir() and will also be removed at program exit. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut # ' sub tempdir { if ( @_ && $_[0] eq 'File::Temp' ) { croak "'tempdir' can't be called as a method"; } # Can not check for argument count since we can have any # number of args # Default options my %options = ( "CLEANUP" => 0, # Remove directory on exit "DIR" => '', # Root directory "TMPDIR" => 0, # Use tempdir with template ); # Check to see whether we have an odd or even number of arguments my ($maybe_template, $args) = _parse_args(@_); my $template = @$maybe_template ? $maybe_template->[0] : undef; # Read the options and merge with defaults %options = (%options, %$args); # Modify or generate the template # Deal with the DIR and TMPDIR options if (defined $template) { # Need to strip directory path if using DIR or TMPDIR if ($options{'TMPDIR'} || $options{'DIR'}) { # Strip parent directory from the filename # # There is no filename at the end $template = VMS::Filespec::vmspath($template) if $^O eq 'VMS'; my ($volume, $directories, undef) = File::Spec->splitpath( $template, 1); # Last directory is then our template $template = (File::Spec->splitdir($directories))[-1]; # Prepend the supplied directory or temp dir if ($options{"DIR"}) { $template = File::Spec->catdir($options{"DIR"}, $template); } elsif ($options{TMPDIR}) { # Prepend tmpdir $template = File::Spec->catdir(_wrap_file_spec_tmpdir(), $template); } } } else { if ($options{"DIR"}) { $template = File::Spec->catdir($options{"DIR"}, TEMPXXX); } else { $template = File::Spec->catdir(_wrap_file_spec_tmpdir(), TEMPXXX); } } # Create the directory my $tempdir; my $suffixlen = 0; if ($^O eq 'VMS') { # dir names can end in delimiters $template =~ m/([\.\]:>]+)$/; $suffixlen = length($1); } if ( ($^O eq 'MacOS') && (substr($template, -1) eq ':') ) { # dir name has a trailing ':' ++$suffixlen; } my $errstr; croak "Error in tempdir() using $template: $errstr" unless ((undef, $tempdir) = _gettemp($template, "open" => 0, "mkdir"=> 1 , "suffixlen" => $suffixlen, "ErrStr" => \$errstr, ) ); # Install exit handler; must be dynamic to get lexical if ( $options{'CLEANUP'} && -d $tempdir) { _deferred_unlink(undef, $tempdir, 1); } # Return the dir name return $tempdir; } #pod =back #pod #pod =head1 MKTEMP FUNCTIONS #pod #pod The following functions are Perl implementations of the #pod mktemp() family of temp file generation system calls. #pod #pod =over 4 #pod #pod =item B #pod #pod Given a template, returns a filehandle to the temporary file and the name #pod of the file. #pod #pod ($fh, $name) = mkstemp( $template ); #pod #pod In scalar context, just the filehandle is returned. #pod #pod The template may be any filename with some number of X's appended #pod to it, for example F. The trailing X's are replaced #pod with unique alphanumeric combinations. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut sub mkstemp { croak "Usage: mkstemp(template)" if scalar(@_) != 1; my $template = shift; my ($fh, $path, $errstr); croak "Error in mkstemp using $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => 1, "mkdir"=> 0 , "suffixlen" => 0, "ErrStr" => \$errstr, ) ); if (wantarray()) { return ($fh, $path); } else { return $fh; } } #pod =item B #pod #pod Similar to mkstemp(), except that an extra argument can be supplied #pod with a suffix to be appended to the template. #pod #pod ($fh, $name) = mkstemps( $template, $suffix ); #pod #pod For example a template of C and suffix of C<.dat> #pod would generate a file similar to F. #pod #pod Returns just the filehandle alone when called in scalar context. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut sub mkstemps { croak "Usage: mkstemps(template, suffix)" if scalar(@_) != 2; my $template = shift; my $suffix = shift; $template .= $suffix; my ($fh, $path, $errstr); croak "Error in mkstemps using $template: $errstr" unless (($fh, $path) = _gettemp($template, "open" => 1, "mkdir"=> 0 , "suffixlen" => length($suffix), "ErrStr" => \$errstr, ) ); if (wantarray()) { return ($fh, $path); } else { return $fh; } } #pod =item B #pod #pod Create a directory from a template. The template must end in #pod X's that are replaced by the routine. #pod #pod $tmpdir_name = mkdtemp($template); #pod #pod Returns the name of the temporary directory created. #pod #pod Directory must be removed by the caller. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut #' # for emacs sub mkdtemp { croak "Usage: mkdtemp(template)" if scalar(@_) != 1; my $template = shift; my $suffixlen = 0; if ($^O eq 'VMS') { # dir names can end in delimiters $template =~ m/([\.\]:>]+)$/; $suffixlen = length($1); } if ( ($^O eq 'MacOS') && (substr($template, -1) eq ':') ) { # dir name has a trailing ':' ++$suffixlen; } my ($junk, $tmpdir, $errstr); croak "Error creating temp directory from template $template\: $errstr" unless (($junk, $tmpdir) = _gettemp($template, "open" => 0, "mkdir"=> 1 , "suffixlen" => $suffixlen, "ErrStr" => \$errstr, ) ); return $tmpdir; } #pod =item B #pod #pod Returns a valid temporary filename but does not guarantee #pod that the file will not be opened by someone else. #pod #pod $unopened_file = mktemp($template); #pod #pod Template is the same as that required by mkstemp(). #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut sub mktemp { croak "Usage: mktemp(template)" if scalar(@_) != 1; my $template = shift; my ($tmpname, $junk, $errstr); croak "Error getting name to temp file from template $template: $errstr" unless (($junk, $tmpname) = _gettemp($template, "open" => 0, "mkdir"=> 0 , "suffixlen" => 0, "ErrStr" => \$errstr, ) ); return $tmpname; } #pod =back #pod #pod =head1 POSIX FUNCTIONS #pod #pod This section describes the re-implementation of the tmpnam() #pod and tmpfile() functions described in L #pod using the mkstemp() from this module. #pod #pod Unlike the L implementations, the directory used #pod for the temporary file is not specified in a system include #pod file (C) but simply depends on the choice of tmpdir() #pod returned by L. On some implementations this #pod location can be set using the C environment variable, which #pod may not be secure. #pod If this is a problem, simply use mkstemp() and specify a template. #pod #pod =over 4 #pod #pod =item B #pod #pod When called in scalar context, returns the full name (including path) #pod of a temporary file (uses mktemp()). The only check is that the file does #pod not already exist, but there is no guarantee that that condition will #pod continue to apply. #pod #pod $file = tmpnam(); #pod #pod When called in list context, a filehandle to the open file and #pod a filename are returned. This is achieved by calling mkstemp() #pod after constructing a suitable template. #pod #pod ($fh, $file) = tmpnam(); #pod #pod If possible, this form should be used to prevent possible #pod race conditions. #pod #pod See L for information on the choice of temporary #pod directory for a particular operating system. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut sub tmpnam { # Retrieve the temporary directory name my $tmpdir = _wrap_file_spec_tmpdir(); # XXX I don't know under what circumstances this occurs, -- xdg 2016-04-02 croak "Error temporary directory is not writable" if $tmpdir eq ''; # Use a ten character template and append to tmpdir my $template = File::Spec->catfile($tmpdir, TEMPXXX); if (wantarray() ) { return mkstemp($template); } else { return mktemp($template); } } #pod =item B #pod #pod Returns the filehandle of a temporary file. #pod #pod $fh = tmpfile(); #pod #pod The file is removed when the filehandle is closed or when the program #pod exits. No access to the filename is provided. #pod #pod If the temporary file can not be created undef is returned. #pod Currently this command will probably not work when the temporary #pod directory is on an NFS file system. #pod #pod Will croak() if there is an error. #pod #pod Available since 0.05. #pod #pod Returning undef if unable to create file added in 0.12. #pod #pod =cut sub tmpfile { # Simply call tmpnam() in a list context my ($fh, $file) = tmpnam(); # Make sure file is removed when filehandle is closed # This will fail on NFS unlink0($fh, $file) or return undef; return $fh; } #pod =back #pod #pod =head1 ADDITIONAL FUNCTIONS #pod #pod These functions are provided for backwards compatibility #pod with common tempfile generation C library functions. #pod #pod They are not exported and must be addressed using the full package #pod name. #pod #pod =over 4 #pod #pod =item B #pod #pod Return the name of a temporary file in the specified directory #pod using a prefix. The file is guaranteed not to exist at the time #pod the function was called, but such guarantees are good for one #pod clock tick only. Always use the proper form of C #pod with C if you must open such a filename. #pod #pod $filename = File::Temp::tempnam( $dir, $prefix ); #pod #pod Equivalent to running mktemp() with $dir/$prefixXXXXXXXX #pod (using unix file convention as an example) #pod #pod Because this function uses mktemp(), it can suffer from race conditions. #pod #pod Will croak() if there is an error. #pod #pod Current API available since 0.05. #pod #pod =cut sub tempnam { croak 'Usage tempnam($dir, $prefix)' unless scalar(@_) == 2; my ($dir, $prefix) = @_; # Add a string to the prefix $prefix .= 'XXXXXXXX'; # Concatenate the directory to the file my $template = File::Spec->catfile($dir, $prefix); return mktemp($template); } #pod =back #pod #pod =head1 UTILITY FUNCTIONS #pod #pod Useful functions for dealing with the filehandle and filename. #pod #pod =over 4 #pod #pod =item B #pod #pod Given an open filehandle and the associated filename, make a safe #pod unlink. This is achieved by first checking that the filename and #pod filehandle initially point to the same file and that the number of #pod links to the file is 1 (all fields returned by stat() are compared). #pod Then the filename is unlinked and the filehandle checked once again to #pod verify that the number of links on that file is now 0. This is the #pod closest you can come to making sure that the filename unlinked was the #pod same as the file whose descriptor you hold. #pod #pod unlink0($fh, $path) #pod or die "Error unlinking file $path safely"; #pod #pod Returns false on error but croaks() if there is a security #pod anomaly. The filehandle is not closed since on some occasions this is #pod not required. #pod #pod On some platforms, for example Windows NT, it is not possible to #pod unlink an open file (the file must be closed first). On those #pod platforms, the actual unlinking is deferred until the program ends and #pod good status is returned. A check is still performed to make sure that #pod the filehandle and filename are pointing to the same thing (but not at #pod the time the end block is executed since the deferred removal may not #pod have access to the filehandle). #pod #pod Additionally, on Windows NT not all the fields returned by stat() can #pod be compared. For example, the C and C fields seem to be #pod different. Also, it seems that the size of the file returned by stat() #pod does not always agree, with C being more accurate than #pod C, presumably because of caching issues even when #pod using autoflush (this is usually overcome by waiting a while after #pod writing to the tempfile before attempting to C it). #pod #pod Finally, on NFS file systems the link count of the file handle does #pod not always go to zero immediately after unlinking. Currently, this #pod command is expected to fail on NFS disks. #pod #pod This function is disabled if the global variable $KEEP_ALL is true #pod and an unlink on open file is supported. If the unlink is to be deferred #pod to the END block, the file is still registered for removal. #pod #pod This function should not be called if you are using the object oriented #pod interface since the it will interfere with the object destructor deleting #pod the file. #pod #pod Available Since 0.05. #pod #pod If can not unlink open file, defer removal until later available since 0.06. #pod #pod =cut sub unlink0 { croak 'Usage: unlink0(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; cmpstat($fh, $path) or return 0; # attempt remove the file (does not work on some platforms) if (_can_unlink_opened_file()) { # return early (Without unlink) if we have been instructed to retain files. return 1 if $KEEP_ALL; # XXX: do *not* call this on a directory; possible race # resulting in recursive removal croak "unlink0: $path has become a directory!" if -d $path; unlink($path) or return 0; # Stat the filehandle my @fh = stat $fh; print "Link count = $fh[3] \n" if $DEBUG; # Make sure that the link count is zero # - Cygwin provides deferred unlinking, however, # on Win9x the link count remains 1 # On NFS the link count may still be 1 but we can't know that # we are on NFS. Since we can't be sure, we'll defer it return 1 if $fh[3] == 0 || $^O eq 'cygwin'; } # fall-through if we can't unlink now _deferred_unlink($fh, $path, 0); return 1; } #pod =item B #pod #pod Compare C of filehandle with C of provided filename. This #pod can be used to check that the filename and filehandle initially point #pod to the same file and that the number of links to the file is 1 (all #pod fields returned by stat() are compared). #pod #pod cmpstat($fh, $path) #pod or die "Error comparing handle with file"; #pod #pod Returns false if the stat information differs or if the link count is #pod greater than 1. Calls croak if there is a security anomaly. #pod #pod On certain platforms, for example Windows, not all the fields returned by stat() #pod can be compared. For example, the C and C fields seem to be #pod different in Windows. Also, it seems that the size of the file #pod returned by stat() does not always agree, with C being more #pod accurate than C, presumably because of caching issues #pod even when using autoflush (this is usually overcome by waiting a while #pod after writing to the tempfile before attempting to C it). #pod #pod Not exported by default. #pod #pod Current API available since 0.14. #pod #pod =cut sub cmpstat { croak 'Usage: cmpstat(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; warn "Comparing stat\n" if $DEBUG; # Stat the filehandle - which may be closed if someone has manually # closed the file. Can not turn off warnings without using $^W # unless we upgrade to 5.006 minimum requirement my @fh; { local ($^W) = 0; @fh = stat $fh; } return unless @fh; if ($fh[3] > 1 && $^W) { carp "unlink0: fstat found too many links; SB=@fh" if $^W; } # Stat the path my @path = stat $path; unless (@path) { carp "unlink0: $path is gone already" if $^W; return; } # this is no longer a file, but may be a directory, or worse unless (-f $path) { confess "panic: $path is no longer a file: SB=@fh"; } # Do comparison of each member of the array # On WinNT dev and rdev seem to be different # depending on whether it is a file or a handle. # Cannot simply compare all members of the stat return # Select the ones we can use my @okstat = (0..$#fh); # Use all by default if ($^O eq 'MSWin32') { @okstat = (1,2,3,4,5,7,8,9,10); } elsif ($^O eq 'os2') { @okstat = (0, 2..$#fh); } elsif ($^O eq 'VMS') { # device and file ID are sufficient @okstat = (0, 1); } elsif ($^O eq 'dos') { @okstat = (0,2..7,11..$#fh); } elsif ($^O eq 'mpeix') { @okstat = (0..4,8..10); } # Now compare each entry explicitly by number for (@okstat) { print "Comparing: $_ : $fh[$_] and $path[$_]\n" if $DEBUG; # Use eq rather than == since rdev, blksize, and blocks (6, 11, # and 12) will be '' on platforms that do not support them. This # is fine since we are only comparing integers. unless ($fh[$_] eq $path[$_]) { warn "Did not match $_ element of stat\n" if $DEBUG; return 0; } } return 1; } #pod =item B #pod #pod Similar to C except after file comparison using cmpstat, the #pod filehandle is closed prior to attempting to unlink the file. This #pod allows the file to be removed without using an END block, but does #pod mean that the post-unlink comparison of the filehandle state provided #pod by C is not available. #pod #pod unlink1($fh, $path) #pod or die "Error closing and unlinking file"; #pod #pod Usually called from the object destructor when using the OO interface. #pod #pod Not exported by default. #pod #pod This function is disabled if the global variable $KEEP_ALL is true. #pod #pod Can call croak() if there is a security anomaly during the stat() #pod comparison. #pod #pod Current API available since 0.14. #pod #pod =cut sub unlink1 { croak 'Usage: unlink1(filehandle, filename)' unless scalar(@_) == 2; # Read args my ($fh, $path) = @_; cmpstat($fh, $path) or return 0; # Close the file close( $fh ) or return 0; # Make sure the file is writable (for windows) _force_writable( $path ); # return early (without unlink) if we have been instructed to retain files. return 1 if $KEEP_ALL; # remove the file return unlink($path); } #pod =item B #pod #pod Calling this function will cause any temp files or temp directories #pod that are registered for removal to be removed. This happens automatically #pod when the process exits but can be triggered manually if the caller is sure #pod that none of the temp files are required. This method can be registered as #pod an Apache callback. #pod #pod Note that if a temp directory is your current directory, it cannot be #pod removed. C out of the directory first before calling #pod C. (For the cleanup at program exit when the CLEANUP flag #pod is set, this happens automatically.) #pod #pod On OSes where temp files are automatically removed when the temp file #pod is closed, calling this function will have no effect other than to remove #pod temporary directories (which may include temporary files). #pod #pod File::Temp::cleanup(); #pod #pod Not exported by default. #pod #pod Current API available since 0.15. #pod #pod =back #pod #pod =head1 PACKAGE VARIABLES #pod #pod These functions control the global state of the package. #pod #pod =over 4 #pod #pod =item B #pod #pod Controls the lengths to which the module will go to check the safety of the #pod temporary file or directory before proceeding. #pod Options are: #pod #pod =over 8 #pod #pod =item STANDARD #pod #pod Do the basic security measures to ensure the directory exists and is #pod writable, that temporary files are opened only if they do not already #pod exist, and that possible race conditions are avoided. Finally the #pod L function is used to remove files safely. #pod #pod =item MEDIUM #pod #pod In addition to the STANDARD security, the output directory is checked #pod to make sure that it is owned either by root or the user running the #pod program. If the directory is writable by group or by other, it is then #pod checked to make sure that the sticky bit is set. #pod #pod Will not work on platforms that do not support the C<-k> test #pod for sticky bit. #pod #pod =item HIGH #pod #pod In addition to the MEDIUM security checks, also check for the #pod possibility of ``chown() giveaway'' using the L #pod sysconf() function. If this is a possibility, each directory in the #pod path is checked in turn for safeness, recursively walking back to the #pod root directory. #pod #pod For platforms that do not support the L #pod C<_PC_CHOWN_RESTRICTED> symbol (for example, Windows NT) it is #pod assumed that ``chown() giveaway'' is possible and the recursive test #pod is performed. #pod #pod =back #pod #pod The level can be changed as follows: #pod #pod File::Temp->safe_level( File::Temp::HIGH ); #pod #pod The level constants are not exported by the module. #pod #pod Currently, you must be running at least perl v5.6.0 in order to #pod run with MEDIUM or HIGH security. This is simply because the #pod safety tests use functions from L that are not #pod available in older versions of perl. The problem is that the version #pod number for Fcntl is the same in perl 5.6.0 and in 5.005_03 even though #pod they are different versions. #pod #pod On systems that do not support the HIGH or MEDIUM safety levels #pod (for example Win NT or OS/2) any attempt to change the level will #pod be ignored. The decision to ignore rather than raise an exception #pod allows portable programs to be written with high security in mind #pod for the systems that can support this without those programs failing #pod on systems where the extra tests are irrelevant. #pod #pod If you really need to see whether the change has been accepted #pod simply examine the return value of C. #pod #pod $newlevel = File::Temp->safe_level( File::Temp::HIGH ); #pod die "Could not change to high security" #pod if $newlevel != File::Temp::HIGH; #pod #pod Available since 0.05. #pod #pod =cut { # protect from using the variable itself my $LEVEL = STANDARD; sub safe_level { my $self = shift; if (@_) { my $level = shift; if (($level != STANDARD) && ($level != MEDIUM) && ($level != HIGH)) { carp "safe_level: Specified level ($level) not STANDARD, MEDIUM or HIGH - ignoring\n" if $^W; } else { # Don't allow this on perl 5.005 or earlier if ($] < 5.006 && $level != STANDARD) { # Cant do MEDIUM or HIGH checks croak "Currently requires perl 5.006 or newer to do the safe checks"; } # Check that we are allowed to change level # Silently ignore if we can not. $LEVEL = $level if _can_do_level($level); } } return $LEVEL; } } #pod =item TopSystemUID #pod #pod This is the highest UID on the current system that refers to a root #pod UID. This is used to make sure that the temporary directory is #pod owned by a system UID (C, C, C etc) rather than #pod simply by root. #pod #pod This is required since on many unix systems C is not owned #pod by root. #pod #pod Default is to assume that any UID less than or equal to 10 is a root #pod UID. #pod #pod File::Temp->top_system_uid(10); #pod my $topid = File::Temp->top_system_uid; #pod #pod This value can be adjusted to reduce security checking if required. #pod The value is only relevant when C is set to MEDIUM or higher. #pod #pod Available since 0.05. #pod #pod =cut { my $TopSystemUID = 10; $TopSystemUID = 197108 if $^O eq 'interix'; # "Administrator" sub top_system_uid { my $self = shift; if (@_) { my $newuid = shift; croak "top_system_uid: UIDs should be numeric" unless $newuid =~ /^\d+$/s; $TopSystemUID = $newuid; } return $TopSystemUID; } } #pod =item B<$KEEP_ALL> #pod #pod Controls whether temporary files and directories should be retained #pod regardless of any instructions in the program to remove them #pod automatically. This is useful for debugging but should not be used in #pod production code. #pod #pod $File::Temp::KEEP_ALL = 1; #pod #pod Default is for files to be removed as requested by the caller. #pod #pod In some cases, files will only be retained if this variable is true #pod when the file is created. This means that you can not create a temporary #pod file, set this variable and expect the temp file to still be around #pod when the program exits. #pod #pod =item B<$DEBUG> #pod #pod Controls whether debugging messages should be enabled. #pod #pod $File::Temp::DEBUG = 1; #pod #pod Default is for debugging mode to be disabled. #pod #pod Available since 0.15. #pod #pod =back #pod #pod =head1 WARNING #pod #pod For maximum security, endeavour always to avoid ever looking at, #pod touching, or even imputing the existence of the filename. You do not #pod know that that filename is connected to the same file as the handle #pod you have, and attempts to check this can only trigger more race #pod conditions. It's far more secure to use the filehandle alone and #pod dispense with the filename altogether. #pod #pod If you need to pass the handle to something that expects a filename #pod then on a unix system you can use C<"/dev/fd/" . fileno($fh)> for #pod arbitrary programs. Perl code that uses the 2-argument version of #pod C<< open >> can be passed C<< "+<=&" . fileno($fh) >>. Otherwise you #pod will need to pass the filename. You will have to clear the #pod close-on-exec bit on that file descriptor before passing it to another #pod process. #pod #pod use Fcntl qw/F_SETFD F_GETFD/; #pod fcntl($tmpfh, F_SETFD, 0) #pod or die "Can't clear close-on-exec flag on temp fh: $!\n"; #pod #pod =head2 Temporary files and NFS #pod #pod Some problems are associated with using temporary files that reside #pod on NFS file systems and it is recommended that a local filesystem #pod is used whenever possible. Some of the security tests will most probably #pod fail when the temp file is not local. Additionally, be aware that #pod the performance of I/O operations over NFS will not be as good as for #pod a local disk. #pod #pod =head2 Forking #pod #pod In some cases files created by File::Temp are removed from within an #pod END block. Since END blocks are triggered when a child process exits #pod (unless C is used by the child) File::Temp takes care #pod to only remove those temp files created by a particular process ID. This #pod means that a child will not attempt to remove temp files created by the #pod parent process. #pod #pod If you are forking many processes in parallel that are all creating #pod temporary files, you may need to reset the random number seed using #pod srand(EXPR) in each child else all the children will attempt to walk #pod through the same set of random file names and may well cause #pod themselves to give up if they exceed the number of retry attempts. #pod #pod =head2 Directory removal #pod #pod Note that if you have chdir'ed into the temporary directory and it is #pod subsequently cleaned up (either in the END block or as part of object #pod destruction), then you will get a warning from File::Path::rmtree(). #pod #pod =head2 Taint mode #pod #pod If you need to run code under taint mode, updating to the latest #pod L is highly recommended. On Windows, if the directory #pod given by L isn't writable, File::Temp will attempt #pod to fallback to the user's local application data directory or croak #pod with an error. #pod #pod =head2 BINMODE #pod #pod The file returned by File::Temp will have been opened in binary mode #pod if such a mode is available. If that is not correct, use the C #pod function to change the mode of the filehandle. #pod #pod Note that you can modify the encoding of a file opened by File::Temp #pod also by using C. #pod #pod =head1 HISTORY #pod #pod Originally began life in May 1999 as an XS interface to the system #pod mkstemp() function. In March 2000, the OpenBSD mkstemp() code was #pod translated to Perl for total control of the code's #pod security checking, to ensure the presence of the function regardless of #pod operating system and to help with portability. The module was shipped #pod as a standard part of perl from v5.6.1. #pod #pod Thanks to Tom Christiansen for suggesting that this module #pod should be written and providing ideas for code improvements and #pod security enhancements. #pod #pod =head1 SEE ALSO #pod #pod L, L, L, L #pod #pod See L and L, L for #pod different implementations of temporary file handling. #pod #pod See L for an alternative object-oriented wrapper for #pod the C function. #pod #pod =cut package ## hide from PAUSE File::Temp::Dir; our $VERSION = '0.2311'; use File::Path qw/ rmtree /; use strict; use overload '""' => "STRINGIFY", '0+' => \&File::Temp::NUMIFY, fallback => 1; # private class specifically to support tempdir objects # created by File::Temp->newdir # ostensibly the same method interface as File::Temp but without # inheriting all the IO::Seekable methods and other cruft # Read-only - returns the name of the temp directory sub dirname { my $self = shift; return $self->{DIRNAME}; } sub STRINGIFY { my $self = shift; return $self->dirname; } sub unlink_on_destroy { my $self = shift; if (@_) { $self->{CLEANUP} = shift; } return $self->{CLEANUP}; } sub DESTROY { my $self = shift; local($., $@, $!, $^E, $?); if ($self->unlink_on_destroy && $$ == $self->{LAUNCHPID} && !$File::Temp::KEEP_ALL) { if (-d $self->{REALNAME}) { # Some versions of rmtree will abort if you attempt to remove # the directory you are sitting in. We protect that and turn it # into a warning. We do this because this occurs during object # destruction and so can not be caught by the user. eval { rmtree($self->{REALNAME}, $File::Temp::DEBUG, 0); }; warn $@ if ($@ && $^W); } } } 1; # vim: ts=2 sts=2 sw=2 et: __END__ =pod =encoding UTF-8 =head1 NAME File::Temp - return name and handle of a temporary file safely =head1 VERSION version 0.2311 =head1 SYNOPSIS use File::Temp qw/ tempfile tempdir /; $fh = tempfile(); ($fh, $filename) = tempfile(); ($fh, $filename) = tempfile( $template, DIR => $dir); ($fh, $filename) = tempfile( $template, SUFFIX => '.dat'); ($fh, $filename) = tempfile( $template, TMPDIR => 1 ); binmode( $fh, ":utf8" ); $dir = tempdir( CLEANUP => 1 ); ($fh, $filename) = tempfile( DIR => $dir ); Object interface: require File::Temp; use File::Temp (); use File::Temp qw/ :seekable /; $fh = File::Temp->new(); $fname = $fh->filename; $fh = File::Temp->new(TEMPLATE => $template); $fname = $fh->filename; $tmp = File::Temp->new( UNLINK => 0, SUFFIX => '.dat' ); print $tmp "Some data\n"; print "Filename is $tmp\n"; $tmp->seek( 0, SEEK_END ); $dir = File::Temp->newdir(); # CLEANUP => 1 by default The following interfaces are provided for compatibility with existing APIs. They should not be used in new code. MkTemp family: use File::Temp qw/ :mktemp /; ($fh, $file) = mkstemp( "tmpfileXXXXX" ); ($fh, $file) = mkstemps( "tmpfileXXXXXX", $suffix); $tmpdir = mkdtemp( $template ); $unopened_file = mktemp( $template ); POSIX functions: use File::Temp qw/ :POSIX /; $file = tmpnam(); $fh = tmpfile(); ($fh, $file) = tmpnam(); Compatibility functions: $unopened_file = File::Temp::tempnam( $dir, $pfx ); =head1 DESCRIPTION C can be used to create and open temporary files in a safe way. There is both a function interface and an object-oriented interface. The File::Temp constructor or the tempfile() function can be used to return the name and the open filehandle of a temporary file. The tempdir() function can be used to create a temporary directory. The security aspect of temporary file creation is emphasized such that a filehandle and filename are returned together. This helps guarantee that a race condition can not occur where the temporary file is created by another process between checking for the existence of the file and its opening. Additional security levels are provided to check, for example, that the sticky bit is set on world writable directories. See L<"safe_level"> for more information. For compatibility with popular C library functions, Perl implementations of the mkstemp() family of functions are provided. These are, mkstemp(), mkstemps(), mkdtemp() and mktemp(). Additionally, implementations of the standard L tmpnam() and tmpfile() functions are provided if required. Implementations of mktemp(), tmpnam(), and tempnam() are provided, but should be used with caution since they return only a filename that was valid when function was called, so cannot guarantee that the file will not exist by the time the caller opens the filename. Filehandles returned by these functions support the seekable methods. =begin :__INTERNALS =head1 PORTABILITY This section is at the top in order to provide easier access to porters. It is not expected to be rendered by a standard pod formatting tool. Please skip straight to the SYNOPSIS section if you are not trying to port this module to a new platform. This module is designed to be portable across operating systems and it currently supports Unix, VMS, DOS, OS/2, Windows and Mac OS (Classic). When porting to a new OS there are generally three main issues that have to be solved: =over 4 =item * Can the OS unlink an open file? If it can not then the C<_can_unlink_opened_file> method should be modified. =item * Are the return values from C reliable? By default all the return values from C are compared when unlinking a temporary file using the filename and the handle. Operating systems other than unix do not always have valid entries in all fields. If utility function C fails then the C comparison should be modified accordingly. =item * Security. Systems that can not support a test for the sticky bit on a directory can not use the MEDIUM and HIGH security tests. The C<_can_do_level> method should be modified accordingly. =back =end :__INTERNALS =head1 OBJECT-ORIENTED INTERFACE This is the primary interface for interacting with C. Using the OO interface a temporary file can be created when the object is constructed and the file can be removed when the object is no longer required. Note that there is no method to obtain the filehandle from the C object. The object itself acts as a filehandle. The object isa C and isa C so all those methods are available. Also, the object is configured such that it stringifies to the name of the temporary file and so can be compared to a filename directly. It numifies to the C the same as other handles and so can be compared to other handles with C<==>. $fh eq $filename # as a string $fh != \*STDOUT # as a number Available since 0.14. =over 4 =item B Create a temporary file object. my $tmp = File::Temp->new(); by default the object is constructed as if C was called without options, but with the additional behaviour that the temporary file is removed by the object destructor if UNLINK is set to true (the default). Supported arguments are the same as for C: UNLINK (defaulting to true), DIR, EXLOCK, PERMS and SUFFIX. Additionally, the filename template is specified using the TEMPLATE option. The OPEN option is not supported (the file is always opened). $tmp = File::Temp->new( TEMPLATE => 'tempXXXXX', DIR => 'mydir', SUFFIX => '.dat'); Arguments are case insensitive. Can call croak() if an error occurs. Available since 0.14. TEMPLATE available since 0.23 =item B Create a temporary directory using an object oriented interface. $dir = File::Temp->newdir(); By default the directory is deleted when the object goes out of scope. Supports the same options as the C function. Note that directories created with this method default to CLEANUP => 1. $dir = File::Temp->newdir( $template, %options ); A template may be specified either with a leading template or with a TEMPLATE argument. Available since 0.19. TEMPLATE available since 0.23. =item B Return the name of the temporary file associated with this object (if the object was created using the "new" constructor). $filename = $tmp->filename; This method is called automatically when the object is used as a string. Current API available since 0.14 =item B Return the name of the temporary directory associated with this object (if the object was created using the "newdir" constructor). $dirname = $tmpdir->dirname; This method is called automatically when the object is used in string context. =item B Control whether the file is unlinked when the object goes out of scope. The file is removed if this value is true and $KEEP_ALL is not. $fh->unlink_on_destroy( 1 ); Default is for the file to be removed. Current API available since 0.15 =item B When the object goes out of scope, the destructor is called. This destructor will attempt to unlink the file (using L) if the constructor was called with UNLINK set to 1 (the default state if UNLINK is not specified). No error is given if the unlink fails. If the object has been passed to a child process during a fork, the file will be deleted when the object goes out of scope in the parent. For a temporary directory object the directory will be removed unless the CLEANUP argument was used in the constructor (and set to false) or C was modified after creation. Note that if a temp directory is your current directory, it cannot be removed - a warning will be given in this case. C out of the directory before letting the object go out of scope. If the global variable $KEEP_ALL is true, the file or directory will not be removed. =back =head1 FUNCTIONS This section describes the recommended interface for generating temporary files and directories. =over 4 =item B This is the basic function to generate temporary files. The behaviour of the file can be changed using various options: $fh = tempfile(); ($fh, $filename) = tempfile(); Create a temporary file in the directory specified for temporary files, as specified by the tmpdir() function in L. ($fh, $filename) = tempfile($template); Create a temporary file in the current directory using the supplied template. Trailing `X' characters are replaced with random letters to generate the filename. At least four `X' characters must be present at the end of the template. ($fh, $filename) = tempfile($template, SUFFIX => $suffix) Same as previously, except that a suffix is added to the template after the `X' translation. Useful for ensuring that a temporary filename has a particular extension when needed by other applications. But see the WARNING at the end. ($fh, $filename) = tempfile($template, DIR => $dir); Translates the template as before except that a directory name is specified. ($fh, $filename) = tempfile($template, TMPDIR => 1); Equivalent to specifying a DIR of "File::Spec->tmpdir", writing the file into the same temporary directory as would be used if no template was specified at all. ($fh, $filename) = tempfile($template, UNLINK => 1); Return the filename and filehandle as before except that the file is automatically removed when the program exits (dependent on $KEEP_ALL). Default is for the file to be removed if a file handle is requested and to be kept if the filename is requested. In a scalar context (where no filename is returned) the file is always deleted either (depending on the operating system) on exit or when it is closed (unless $KEEP_ALL is true when the temp file is created). Use the object-oriented interface if fine-grained control of when a file is removed is required. If the template is not specified, a template is always automatically generated. This temporary file is placed in tmpdir() (L) unless a directory is specified explicitly with the DIR option. $fh = tempfile( DIR => $dir ); If called in scalar context, only the filehandle is returned and the file will automatically be deleted when closed on operating systems that support this (see the description of tmpfile() elsewhere in this document). This is the preferred mode of operation, as if you only have a filehandle, you can never create a race condition by fumbling with the filename. On systems that can not unlink an open file or can not mark a file as temporary when it is opened (for example, Windows NT uses the C flag) the file is marked for deletion when the program ends (equivalent to setting UNLINK to 1). The C flag is ignored if present. (undef, $filename) = tempfile($template, OPEN => 0); This will return the filename based on the template but will not open this file. Cannot be used in conjunction with UNLINK set to true. Default is to always open the file to protect from possible race conditions. A warning is issued if warnings are turned on. Consider using the tmpnam() and mktemp() functions described elsewhere in this document if opening the file is not required. To open the temporary filehandle with O_EXLOCK (open with exclusive file lock) use C<< EXLOCK=>1 >>. This is supported only by some operating systems (most notably BSD derived systems). By default EXLOCK will be false. Former C versions set EXLOCK to true, so to be sure to get an unlocked filehandle also with older versions, explicitly set C<< EXLOCK=>0 >>. ($fh, $filename) = tempfile($template, EXLOCK => 1); By default, the temp file is created with 0600 file permissions. Use C to change this: ($fh, $filename) = tempfile($template, PERMS => 0666); Options can be combined as required. Will croak() if there is an error. Available since 0.05. UNLINK flag available since 0.10. TMPDIR flag available since 0.19. EXLOCK flag available since 0.19. PERMS flag available since 0.2310. =item B This is the recommended interface for creation of temporary directories. By default the directory will not be removed on exit (that is, it won't be temporary; this behaviour can not be changed because of issues with backwards compatibility). To enable removal either use the CLEANUP option which will trigger removal on program exit, or consider using the "newdir" method in the object interface which will allow the directory to be cleaned up when the object goes out of scope. The behaviour of the function depends on the arguments: $tempdir = tempdir(); Create a directory in tmpdir() (see L). $tempdir = tempdir( $template ); Create a directory from the supplied template. This template is similar to that described for tempfile(). `X' characters at the end of the template are replaced with random letters to construct the directory name. At least four `X' characters must be in the template. $tempdir = tempdir ( DIR => $dir ); Specifies the directory to use for the temporary directory. The temporary directory name is derived from an internal template. $tempdir = tempdir ( $template, DIR => $dir ); Prepend the supplied directory name to the template. The template should not include parent directory specifications itself. Any parent directory specifications are removed from the template before prepending the supplied directory. $tempdir = tempdir ( $template, TMPDIR => 1 ); Using the supplied template, create the temporary directory in a standard location for temporary files. Equivalent to doing $tempdir = tempdir ( $template, DIR => File::Spec->tmpdir); but shorter. Parent directory specifications are stripped from the template itself. The C option is ignored if C is set explicitly. Additionally, C is implied if neither a template nor a directory are supplied. $tempdir = tempdir( $template, CLEANUP => 1); Create a temporary directory using the supplied template, but attempt to remove it (and all files inside it) when the program exits. Note that an attempt will be made to remove all files from the directory even if they were not created by this module (otherwise why ask to clean it up?). The directory removal is made with the rmtree() function from the L module. Of course, if the template is not specified, the temporary directory will be created in tmpdir() and will also be removed at program exit. Will croak() if there is an error. Current API available since 0.05. =back =head1 MKTEMP FUNCTIONS The following functions are Perl implementations of the mktemp() family of temp file generation system calls. =over 4 =item B Given a template, returns a filehandle to the temporary file and the name of the file. ($fh, $name) = mkstemp( $template ); In scalar context, just the filehandle is returned. The template may be any filename with some number of X's appended to it, for example F. The trailing X's are replaced with unique alphanumeric combinations. Will croak() if there is an error. Current API available since 0.05. =item B Similar to mkstemp(), except that an extra argument can be supplied with a suffix to be appended to the template. ($fh, $name) = mkstemps( $template, $suffix ); For example a template of C and suffix of C<.dat> would generate a file similar to F. Returns just the filehandle alone when called in scalar context. Will croak() if there is an error. Current API available since 0.05. =item B Create a directory from a template. The template must end in X's that are replaced by the routine. $tmpdir_name = mkdtemp($template); Returns the name of the temporary directory created. Directory must be removed by the caller. Will croak() if there is an error. Current API available since 0.05. =item B Returns a valid temporary filename but does not guarantee that the file will not be opened by someone else. $unopened_file = mktemp($template); Template is the same as that required by mkstemp(). Will croak() if there is an error. Current API available since 0.05. =back =head1 POSIX FUNCTIONS This section describes the re-implementation of the tmpnam() and tmpfile() functions described in L using the mkstemp() from this module. Unlike the L implementations, the directory used for the temporary file is not specified in a system include file (C) but simply depends on the choice of tmpdir() returned by L. On some implementations this location can be set using the C environment variable, which may not be secure. If this is a problem, simply use mkstemp() and specify a template. =over 4 =item B When called in scalar context, returns the full name (including path) of a temporary file (uses mktemp()). The only check is that the file does not already exist, but there is no guarantee that that condition will continue to apply. $file = tmpnam(); When called in list context, a filehandle to the open file and a filename are returned. This is achieved by calling mkstemp() after constructing a suitable template. ($fh, $file) = tmpnam(); If possible, this form should be used to prevent possible race conditions. See L for information on the choice of temporary directory for a particular operating system. Will croak() if there is an error. Current API available since 0.05. =item B Returns the filehandle of a temporary file. $fh = tmpfile(); The file is removed when the filehandle is closed or when the program exits. No access to the filename is provided. If the temporary file can not be created undef is returned. Currently this command will probably not work when the temporary directory is on an NFS file system. Will croak() if there is an error. Available since 0.05. Returning undef if unable to create file added in 0.12. =back =head1 ADDITIONAL FUNCTIONS These functions are provided for backwards compatibility with common tempfile generation C library functions. They are not exported and must be addressed using the full package name. =over 4 =item B Return the name of a temporary file in the specified directory using a prefix. The file is guaranteed not to exist at the time the function was called, but such guarantees are good for one clock tick only. Always use the proper form of C with C if you must open such a filename. $filename = File::Temp::tempnam( $dir, $prefix ); Equivalent to running mktemp() with $dir/$prefixXXXXXXXX (using unix file convention as an example) Because this function uses mktemp(), it can suffer from race conditions. Will croak() if there is an error. Current API available since 0.05. =back =head1 UTILITY FUNCTIONS Useful functions for dealing with the filehandle and filename. =over 4 =item B Given an open filehandle and the associated filename, make a safe unlink. This is achieved by first checking that the filename and filehandle initially point to the same file and that the number of links to the file is 1 (all fields returned by stat() are compared). Then the filename is unlinked and the filehandle checked once again to verify that the number of links on that file is now 0. This is the closest you can come to making sure that the filename unlinked was the same as the file whose descriptor you hold. unlink0($fh, $path) or die "Error unlinking file $path safely"; Returns false on error but croaks() if there is a security anomaly. The filehandle is not closed since on some occasions this is not required. On some platforms, for example Windows NT, it is not possible to unlink an open file (the file must be closed first). On those platforms, the actual unlinking is deferred until the program ends and good status is returned. A check is still performed to make sure that the filehandle and filename are pointing to the same thing (but not at the time the end block is executed since the deferred removal may not have access to the filehandle). Additionally, on Windows NT not all the fields returned by stat() can be compared. For example, the C and C fields seem to be different. Also, it seems that the size of the file returned by stat() does not always agree, with C being more accurate than C, presumably because of caching issues even when using autoflush (this is usually overcome by waiting a while after writing to the tempfile before attempting to C it). Finally, on NFS file systems the link count of the file handle does not always go to zero immediately after unlinking. Currently, this command is expected to fail on NFS disks. This function is disabled if the global variable $KEEP_ALL is true and an unlink on open file is supported. If the unlink is to be deferred to the END block, the file is still registered for removal. This function should not be called if you are using the object oriented interface since the it will interfere with the object destructor deleting the file. Available Since 0.05. If can not unlink open file, defer removal until later available since 0.06. =item B Compare C of filehandle with C of provided filename. This can be used to check that the filename and filehandle initially point to the same file and that the number of links to the file is 1 (all fields returned by stat() are compared). cmpstat($fh, $path) or die "Error comparing handle with file"; Returns false if the stat information differs or if the link count is greater than 1. Calls croak if there is a security anomaly. On certain platforms, for example Windows, not all the fields returned by stat() can be compared. For example, the C and C fields seem to be different in Windows. Also, it seems that the size of the file returned by stat() does not always agree, with C being more accurate than C, presumably because of caching issues even when using autoflush (this is usually overcome by waiting a while after writing to the tempfile before attempting to C it). Not exported by default. Current API available since 0.14. =item B Similar to C except after file comparison using cmpstat, the filehandle is closed prior to attempting to unlink the file. This allows the file to be removed without using an END block, but does mean that the post-unlink comparison of the filehandle state provided by C is not available. unlink1($fh, $path) or die "Error closing and unlinking file"; Usually called from the object destructor when using the OO interface. Not exported by default. This function is disabled if the global variable $KEEP_ALL is true. Can call croak() if there is a security anomaly during the stat() comparison. Current API available since 0.14. =item B Calling this function will cause any temp files or temp directories that are registered for removal to be removed. This happens automatically when the process exits but can be triggered manually if the caller is sure that none of the temp files are required. This method can be registered as an Apache callback. Note that if a temp directory is your current directory, it cannot be removed. C out of the directory first before calling C. (For the cleanup at program exit when the CLEANUP flag is set, this happens automatically.) On OSes where temp files are automatically removed when the temp file is closed, calling this function will have no effect other than to remove temporary directories (which may include temporary files). File::Temp::cleanup(); Not exported by default. Current API available since 0.15. =back =head1 PACKAGE VARIABLES These functions control the global state of the package. =over 4 =item B Controls the lengths to which the module will go to check the safety of the temporary file or directory before proceeding. Options are: =over 8 =item STANDARD Do the basic security measures to ensure the directory exists and is writable, that temporary files are opened only if they do not already exist, and that possible race conditions are avoided. Finally the L function is used to remove files safely. =item MEDIUM In addition to the STANDARD security, the output directory is checked to make sure that it is owned either by root or the user running the program. If the directory is writable by group or by other, it is then checked to make sure that the sticky bit is set. Will not work on platforms that do not support the C<-k> test for sticky bit. =item HIGH In addition to the MEDIUM security checks, also check for the possibility of ``chown() giveaway'' using the L sysconf() function. If this is a possibility, each directory in the path is checked in turn for safeness, recursively walking back to the root directory. For platforms that do not support the L C<_PC_CHOWN_RESTRICTED> symbol (for example, Windows NT) it is assumed that ``chown() giveaway'' is possible and the recursive test is performed. =back The level can be changed as follows: File::Temp->safe_level( File::Temp::HIGH ); The level constants are not exported by the module. Currently, you must be running at least perl v5.6.0 in order to run with MEDIUM or HIGH security. This is simply because the safety tests use functions from L that are not available in older versions of perl. The problem is that the version number for Fcntl is the same in perl 5.6.0 and in 5.005_03 even though they are different versions. On systems that do not support the HIGH or MEDIUM safety levels (for example Win NT or OS/2) any attempt to change the level will be ignored. The decision to ignore rather than raise an exception allows portable programs to be written with high security in mind for the systems that can support this without those programs failing on systems where the extra tests are irrelevant. If you really need to see whether the change has been accepted simply examine the return value of C. $newlevel = File::Temp->safe_level( File::Temp::HIGH ); die "Could not change to high security" if $newlevel != File::Temp::HIGH; Available since 0.05. =item TopSystemUID This is the highest UID on the current system that refers to a root UID. This is used to make sure that the temporary directory is owned by a system UID (C, C, C etc) rather than simply by root. This is required since on many unix systems C is not owned by root. Default is to assume that any UID less than or equal to 10 is a root UID. File::Temp->top_system_uid(10); my $topid = File::Temp->top_system_uid; This value can be adjusted to reduce security checking if required. The value is only relevant when C is set to MEDIUM or higher. Available since 0.05. =item B<$KEEP_ALL> Controls whether temporary files and directories should be retained regardless of any instructions in the program to remove them automatically. This is useful for debugging but should not be used in production code. $File::Temp::KEEP_ALL = 1; Default is for files to be removed as requested by the caller. In some cases, files will only be retained if this variable is true when the file is created. This means that you can not create a temporary file, set this variable and expect the temp file to still be around when the program exits. =item B<$DEBUG> Controls whether debugging messages should be enabled. $File::Temp::DEBUG = 1; Default is for debugging mode to be disabled. Available since 0.15. =back =head1 WARNING For maximum security, endeavour always to avoid ever looking at, touching, or even imputing the existence of the filename. You do not know that that filename is connected to the same file as the handle you have, and attempts to check this can only trigger more race conditions. It's far more secure to use the filehandle alone and dispense with the filename altogether. If you need to pass the handle to something that expects a filename then on a unix system you can use C<"/dev/fd/" . fileno($fh)> for arbitrary programs. Perl code that uses the 2-argument version of C<< open >> can be passed C<< "+<=&" . fileno($fh) >>. Otherwise you will need to pass the filename. You will have to clear the close-on-exec bit on that file descriptor before passing it to another process. use Fcntl qw/F_SETFD F_GETFD/; fcntl($tmpfh, F_SETFD, 0) or die "Can't clear close-on-exec flag on temp fh: $!\n"; =head2 Temporary files and NFS Some problems are associated with using temporary files that reside on NFS file systems and it is recommended that a local filesystem is used whenever possible. Some of the security tests will most probably fail when the temp file is not local. Additionally, be aware that the performance of I/O operations over NFS will not be as good as for a local disk. =head2 Forking In some cases files created by File::Temp are removed from within an END block. Since END blocks are triggered when a child process exits (unless C is used by the child) File::Temp takes care to only remove those temp files created by a particular process ID. This means that a child will not attempt to remove temp files created by the parent process. If you are forking many processes in parallel that are all creating temporary files, you may need to reset the random number seed using srand(EXPR) in each child else all the children will attempt to walk through the same set of random file names and may well cause themselves to give up if they exceed the number of retry attempts. =head2 Directory removal Note that if you have chdir'ed into the temporary directory and it is subsequently cleaned up (either in the END block or as part of object destruction), then you will get a warning from File::Path::rmtree(). =head2 Taint mode If you need to run code under taint mode, updating to the latest L is highly recommended. On Windows, if the directory given by L isn't writable, File::Temp will attempt to fallback to the user's local application data directory or croak with an error. =head2 BINMODE The file returned by File::Temp will have been opened in binary mode if such a mode is available. If that is not correct, use the C function to change the mode of the filehandle. Note that you can modify the encoding of a file opened by File::Temp also by using C. =head1 HISTORY Originally began life in May 1999 as an XS interface to the system mkstemp() function. In March 2000, the OpenBSD mkstemp() code was translated to Perl for total control of the code's security checking, to ensure the presence of the function regardless of operating system and to help with portability. The module was shipped as a standard part of perl from v5.6.1. Thanks to Tom Christiansen for suggesting that this module should be written and providing ideas for code improvements and security enhancements. =head1 SEE ALSO L, L, L, L See L and L, L for different implementations of temporary file handling. See L for an alternative object-oriented wrapper for the C function. =for Pod::Coverage STRINGIFY NUMIFY top_system_uid =head1 SUPPORT Bugs may be submitted through L (or L). There is also a mailing list available for users of this distribution, at L. There is also an irc channel available for users of this distribution, at L on C|irc://irc.perl.org/#toolchain>. =head1 AUTHOR Tim Jenness =head1 CONTRIBUTORS =for stopwords Tim Jenness Karen Etheridge David Golden Slaven Rezic mohawk2 Roy Ivy III Peter Rabbitson Olivier Mengué John Acklam Gim Yee Nicolas R Brian Mowrey Dagfinn Ilmari Mannsåker Steinbrunner Ed Avis Guillem Jover James E. Keenan Kevin Ryde Ben Tilly =over 4 =item * Tim Jenness =item * Karen Etheridge =item * David Golden =item * Slaven Rezic =item * mohawk2 =item * Roy Ivy III =item * Peter Rabbitson =item * Olivier Mengué =item * Peter John Acklam =item * Tim Gim Yee =item * Nicolas R =item * Brian Mowrey =item * Dagfinn Ilmari Mannsåker =item * David Steinbrunner =item * Ed Avis =item * Guillem Jover =item * James E. Keenan =item * Kevin Ryde =item * Ben Tilly =back =head1 COPYRIGHT AND LICENSE This software is copyright (c) 2020 by Tim Jenness and the UK Particle Physics and Astronomy Research Council. This is free software; you can redistribute it and/or modify it under the same terms as the Perl 5 programming language system itself. =cut FILE6c0dc0cf/FileHandle.pmpackage FileHandle; use 5.006; use strict; our($VERSION, @ISA, @EXPORT, @EXPORT_OK); $VERSION = "2.05"; require IO::File; @ISA = qw(IO::File); @EXPORT = qw(_IOFBF _IOLBF _IONBF); @EXPORT_OK = qw( pipe autoflush output_field_separator output_record_separator input_record_separator input_line_number format_page_number format_lines_per_page format_lines_left format_name format_top_name format_line_break_characters format_formfeed print printf getline getlines ); # # Everything we're willing to export, we must first import. # IO::Handle->import( grep { !defined(&$_) } @EXPORT, @EXPORT_OK ); # # Some people call "FileHandle::function", so all the functions # that were in the old FileHandle class must be imported, too. # { no strict 'refs'; my %import = ( 'IO::Handle' => [qw(DESTROY new_from_fd fdopen close fileno getc ungetc gets eof flush error clearerr setbuf setvbuf _open_mode_string)], 'IO::Seekable' => [qw(seek tell getpos setpos)], 'IO::File' => [qw(new new_tmpfile open)] ); for my $pkg (keys %import) { for my $func (@{$import{$pkg}}) { my $c = *{"${pkg}::$func"}{CODE} or die "${pkg}::$func missing"; *$func = $c; } } } # # Specialized importer for Fcntl magic. # sub import { my $pkg = shift; my $callpkg = caller; require Exporter; Exporter::export($pkg, $callpkg, @_); # # If the Fcntl extension is available, # export its constants. # eval { require Fcntl; Exporter::export('Fcntl', $callpkg); }; } ################################################ # This is the only exported function we define; # the rest come from other classes. # sub pipe { my $r = IO::Handle->new; my $w = IO::Handle->new; CORE::pipe($r, $w) or return undef; ($r, $w); } # Rebless standard file handles bless *STDIN{IO}, "FileHandle" if ref *STDIN{IO} eq "IO::Handle"; bless *STDOUT{IO}, "FileHandle" if ref *STDOUT{IO} eq "IO::Handle"; bless *STDERR{IO}, "FileHandle" if ref *STDERR{IO} eq "IO::Handle"; 1; __END__ =head1 NAME FileHandle - supply object methods for filehandles =head1 SYNOPSIS use FileHandle; my $fh = FileHandle->new; if ($fh->open("< file")) { print <$fh>; $fh->close; } my $fh = FileHandle->new("> FOO"); if (defined $fh) { print $fh "bar\n"; $fh->close; } my $fh = FileHandle->new("file", "r"); if (defined $fh) { print <$fh>; undef $fh; # automatically closes the file } my $fh = FileHandle->new("file", O_WRONLY|O_APPEND); if (defined $fh) { print $fh "corge\n"; undef $fh; # automatically closes the file } my $pos = $fh->getpos; $fh->setpos($pos); $fh->setvbuf(my $buffer_var, _IOLBF, 1024); my ($readfh, $writefh) = FileHandle::pipe; autoflush STDOUT 1; =head1 DESCRIPTION NOTE: This class is now a front-end to the IO::* classes. C creates a C, which is a reference to a newly created symbol (see the L package). If it receives any parameters, they are passed to C; if the open fails, the C object is destroyed. Otherwise, it is returned to the caller. C creates a C like C does. It requires two parameters, which are passed to C; if the fdopen fails, the C object is destroyed. Otherwise, it is returned to the caller. C accepts one parameter or two. With one parameter, it is just a front end for the built-in C function. With two parameters, the first parameter is a filename that may include whitespace or other special characters, and the second parameter is the open mode, optionally followed by a file permission value. If C receives a Perl mode string (">", "+<", etc.) or a POSIX fopen() mode string ("w", "r+", etc.), it uses the basic Perl C operator. If C is given a numeric mode, it passes that mode and the optional permissions value to the Perl C operator. For convenience, C tries to import the O_XXX constants from the Fcntl module. If dynamic loading is not available, this may fail, but the rest of FileHandle will still work. C is like C except that its first parameter is not a filename but rather a file handle name, a FileHandle object, or a file descriptor number. If the C functions fgetpos() and fsetpos() are available, then C returns an opaque value that represents the current position of the FileHandle, and C uses that value to return to a previously visited position. If the C function setvbuf() is available, then C sets the buffering policy for the FileHandle. The calling sequence for the Perl function is the same as its C counterpart, including the macros C<_IOFBF>, C<_IOLBF>, and C<_IONBF>, except that the buffer parameter specifies a scalar variable to use as a buffer. WARNING: A variable used as a buffer by C must not be modified in any way until the FileHandle is closed or until C is called again, or memory corruption may result! See L for complete descriptions of each of the following supported C methods, which are just front ends for the corresponding built-in functions: close fileno getc gets eof clearerr seek tell See L for complete descriptions of each of the following supported C methods: autoflush output_field_separator output_record_separator input_record_separator input_line_number format_page_number format_lines_per_page format_lines_left format_name format_top_name format_line_break_characters format_formfeed Furthermore, for doing normal I/O you might need these: =over 4 =item $fh->print See L. =item $fh->printf See L. =item $fh->getline This works like <$fh> described in L except that it's more readable and can be safely called in a list context but still returns just one line. =item $fh->getlines This works like <$fh> when called in a list context to read all the remaining lines in a file, except that it's more readable. It will also croak() if accidentally called in a scalar context. =back There are many other functions available since FileHandle is descended from IO::File, IO::Seekable, and IO::Handle. Please see those respective pages for documentation on more functions. =head1 SEE ALSO The B extension, L, L. =cut FILE'17dda43c/IO/Compress/Adapter/Deflate.pmpackage IO::Compress::Adapter::Deflate ; use strict; use warnings; use bytes; use IO::Compress::Base::Common 2.213 qw(:Status); use Compress::Raw::Zlib 2.213 qw( !crc32 !adler32 ) ; require Exporter; our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS, @EXPORT, %DEFLATE_CONSTANTS); $VERSION = '2.213'; @ISA = qw(Exporter); @EXPORT_OK = @Compress::Raw::Zlib::DEFLATE_CONSTANTS; %EXPORT_TAGS = %Compress::Raw::Zlib::DEFLATE_CONSTANTS; @EXPORT = @EXPORT_OK; %DEFLATE_CONSTANTS = %EXPORT_TAGS ; sub mkCompObject { my $crc32 = shift ; my $adler32 = shift ; my $level = shift ; my $strategy = shift ; my ($def, $status) = Compress::Raw::Zlib::Deflate->new( -AppendOutput => 1, -CRC32 => $crc32, -ADLER32 => $adler32, -Level => $level, -Strategy => $strategy, -WindowBits => - MAX_WBITS); return (undef, "Cannot create Deflate object: $status", $status) if $status != Z_OK; return bless {'Def' => $def, 'Error' => '', } ; } sub mkCompObject1 { my $crc32 = shift ; my $adler32 = shift ; my $level = shift ; my $strategy = shift ; my ($def, $status) = Compress::Raw::Zlib::Deflate->new( -AppendOutput => 1, -CRC32 => $crc32, -ADLER32 => $adler32, -Level => $level, -Strategy => $strategy, -WindowBits => MAX_WBITS); return (undef, "Cannot create Deflate object: $status", $status) if $status != Z_OK; return bless {'Def' => $def, 'Error' => '', } ; } sub compr { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflate($_[0], $_[1]) ; $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub flush { my $self = shift ; my $def = $self->{Def}; my $opt = $_[1] || Z_FINISH; my $status = $def->flush($_[0], $opt); $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub close { my $self = shift ; my $def = $self->{Def}; $def->flush($_[0], Z_FINISH) if defined $def ; } sub reset { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflateReset() ; $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "Deflate Error: $status"; return STATUS_ERROR; } return STATUS_OK; } sub deflateParams { my $self = shift ; my $def = $self->{Def}; my $status = $def->deflateParams(@_); $self->{ErrorNo} = $status; if ($status != Z_OK) { $self->{Error} = "deflateParams Error: $status"; return STATUS_ERROR; } return STATUS_OK; } #sub total_out #{ # my $self = shift ; # $self->{Def}->total_out(); #} # #sub total_in #{ # my $self = shift ; # $self->{Def}->total_in(); #} sub compressedBytes { my $self = shift ; $self->{Def}->compressedBytes(); } sub uncompressedBytes { my $self = shift ; $self->{Def}->uncompressedBytes(); } sub crc32 { my $self = shift ; $self->{Def}->crc32(); } sub adler32 { my $self = shift ; $self->{Def}->adler32(); } 1; __END__ FILEa804e732/IO/Compress/Base.pm] package IO::Compress::Base ; require 5.006 ; use strict ; use warnings; use IO::Compress::Base::Common 2.213 ; use IO::File (); ; use Scalar::Util (); #use File::Glob; #require Exporter ; use Carp() ; use Symbol(); #use bytes; our (@ISA, $VERSION); @ISA = qw(IO::File Exporter); $VERSION = '2.213'; #Can't locate object method "SWASHNEW" via package "utf8" (perhaps you forgot to load "utf8"?) at .../ext/Compress-Zlib/Gzip/blib/lib/Compress/Zlib/Common.pm line 16. sub saveStatus { my $self = shift ; ${ *$self->{ErrorNo} } = shift() + 0 ; ${ *$self->{Error} } = '' ; return ${ *$self->{ErrorNo} } ; } sub saveErrorString { my $self = shift ; my $retval = shift ; ${ *$self->{Error} } = shift ; ${ *$self->{ErrorNo} } = shift() + 0 if @_ ; return $retval; } sub croakError { my $self = shift ; $self->saveErrorString(0, $_[0]); Carp::croak $_[0]; } sub closeError { my $self = shift ; my $retval = shift ; my $errno = *$self->{ErrorNo}; my $error = ${ *$self->{Error} }; $self->close(); *$self->{ErrorNo} = $errno ; ${ *$self->{Error} } = $error ; return $retval; } sub error { my $self = shift ; return ${ *$self->{Error} } ; } sub errorNo { my $self = shift ; return ${ *$self->{ErrorNo} } ; } sub writeAt { my $self = shift ; my $offset = shift; my $data = shift; if (defined *$self->{FH}) { my $here = tell(*$self->{FH}); return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) if $here < 0 ; seek(*$self->{FH}, $offset, IO::Handle::SEEK_SET) or return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; defined *$self->{FH}->write($data, length $data) or return $self->saveErrorString(undef, $!, $!) ; seek(*$self->{FH}, $here, IO::Handle::SEEK_SET) or return $self->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; } else { substr(${ *$self->{Buffer} }, $offset, length($data)) = $data ; } return 1; } sub outputPayload { my $self = shift ; return $self->output(@_); } sub output { my $self = shift ; my $data = shift ; my $last = shift ; return 1 if length $data == 0 && ! $last ; if ( *$self->{FilterContainer} ) { *_ = \$data; &{ *$self->{FilterContainer} }(); } if (length $data) { if ( defined *$self->{FH} ) { defined *$self->{FH}->write( $data, length $data ) or return $self->saveErrorString(0, $!, $!); } else { ${ *$self->{Buffer} } .= $data ; } } return 1; } sub getOneShotParams { return ( 'multistream' => [IO::Compress::Base::Common::Parse_boolean, 1], ); } our %PARAMS = ( # Generic Parameters 'autoclose' => [IO::Compress::Base::Common::Parse_boolean, 0], 'encode' => [IO::Compress::Base::Common::Parse_any, undef], 'strict' => [IO::Compress::Base::Common::Parse_boolean, 1], 'append' => [IO::Compress::Base::Common::Parse_boolean, 0], 'binmodein' => [IO::Compress::Base::Common::Parse_boolean, 0], 'filtercontainer' => [IO::Compress::Base::Common::Parse_code, undef], ); sub checkParams { my $self = shift ; my $class = shift ; my $got = shift || IO::Compress::Base::Parameters::new(); $got->parse( { %PARAMS, $self->getExtraParams(), *$self->{OneShot} ? $self->getOneShotParams() : (), }, @_) or $self->croakError("${class}: " . $got->getError()) ; return $got ; } sub _create { my $obj = shift; my $got = shift; *$obj->{Closed} = 1 ; my $class = ref $obj; $obj->croakError("$class: Missing Output parameter") if ! @_ && ! $got ; my $outValue = shift ; my $oneShot = 1 ; if (! $got) { $oneShot = 0 ; $got = $obj->checkParams($class, undef, @_) or return undef ; } my $lax = ! $got->getValue('strict') ; my $outType = IO::Compress::Base::Common::whatIsOutput($outValue); $obj->ckOutputParam($class, $outValue) or return undef ; if ($outType eq 'buffer') { *$obj->{Buffer} = $outValue; } else { my $buff = "" ; *$obj->{Buffer} = \$buff ; } # Merge implies Append my $merge = $got->getValue('merge') ; my $appendOutput = $got->getValue('append') || $merge ; *$obj->{Append} = $appendOutput; *$obj->{FilterContainer} = $got->getValue('filtercontainer') ; if ($merge) { # Switch off Merge mode if output file/buffer is empty/doesn't exist if (($outType eq 'buffer' && length $$outValue == 0 ) || ($outType ne 'buffer' && (! -e $outValue || (-w _ && -z _))) ) { $merge = 0 } } # If output is a file, check that it is writable #no warnings; #if ($outType eq 'filename' && -e $outValue && ! -w _) # { return $obj->saveErrorString(undef, "Output file '$outValue' is not writable" ) } $obj->ckParams($got) or $obj->croakError("${class}: " . $obj->error()); if ($got->getValue('encode')) { my $want_encoding = $got->getValue('encode'); *$obj->{Encoding} = IO::Compress::Base::Common::getEncoding($obj, $class, $want_encoding); my $x = *$obj->{Encoding}; } else { *$obj->{Encoding} = undef; } $obj->saveStatus(STATUS_OK) ; my $status ; if (! $merge) { *$obj->{Compress} = $obj->mkComp($got) or return undef; *$obj->{UnCompSize} = U64->new; *$obj->{CompSize} = U64->new; if ( $outType eq 'buffer') { ${ *$obj->{Buffer} } = '' unless $appendOutput ; } else { if ($outType eq 'handle') { *$obj->{FH} = $outValue ; setBinModeOutput(*$obj->{FH}) ; #$outValue->flush() ; *$obj->{Handle} = 1 ; if ($appendOutput) { seek(*$obj->{FH}, 0, IO::Handle::SEEK_END) or return $obj->saveErrorString(undef, "Cannot seek to end of output filehandle: $!", $!) ; } } elsif ($outType eq 'filename') { no warnings; my $mode = '>' ; $mode = '>>' if $appendOutput; *$obj->{FH} = IO::File->new( "$mode $outValue" ) or return $obj->saveErrorString(undef, "cannot open file '$outValue': $!", $!) ; *$obj->{StdIO} = ($outValue eq '-'); setBinModeOutput(*$obj->{FH}) ; } } *$obj->{Header} = $obj->mkHeader($got) ; $obj->output( *$obj->{Header} ) or return undef; $obj->beforePayload(); } else { *$obj->{Compress} = $obj->createMerge($outValue, $outType) or return undef; } *$obj->{Closed} = 0 ; *$obj->{AutoClose} = $got->getValue('autoclose') ; *$obj->{Output} = $outValue; *$obj->{ClassName} = $class; *$obj->{Got} = $got; *$obj->{OneShot} = 0 ; return $obj ; } sub ckOutputParam { my $self = shift ; my $from = shift ; my $outType = IO::Compress::Base::Common::whatIsOutput($_[0]); $self->croakError("$from: output parameter not a filename, filehandle or scalar ref") if ! $outType ; #$self->croakError("$from: output filename is undef or null string") #if $outType eq 'filename' && (! defined $_[0] || $_[0] eq '') ; $self->croakError("$from: output buffer is read-only") if $outType eq 'buffer' && Scalar::Util::readonly(${ $_[0] }); return 1; } sub _def { my $obj = shift ; my $class= (caller)[0] ; my $name = (caller(1))[3] ; $obj->croakError("$name: expected at least 1 parameters\n") unless @_ >= 1 ; my $input = shift ; my $haveOut = @_ ; my $output = shift ; my $x = IO::Compress::Base::Validator->new($class, *$obj->{Error}, $name, $input, $output) or return undef ; push @_, $output if $haveOut && $x->{Hash}; *$obj->{OneShot} = 1 ; my $got = $obj->checkParams($name, undef, @_) or return undef ; $x->{Got} = $got ; # if ($x->{Hash}) # { # while (my($k, $v) = each %$input) # { # $v = \$input->{$k} # unless defined $v ; # # $obj->_singleTarget($x, 1, $k, $v, @_) # or return undef ; # } # # return keys %$input ; # } if ($x->{GlobMap}) { $x->{oneInput} = 1 ; foreach my $pair (@{ $x->{Pairs} }) { my ($from, $to) = @$pair ; $obj->_singleTarget($x, 1, $from, $to, @_) or return undef ; } return scalar @{ $x->{Pairs} } ; } if (! $x->{oneOutput} ) { my $inFile = ($x->{inType} eq 'filenames' || $x->{inType} eq 'filename'); $x->{inType} = $inFile ? 'filename' : 'buffer'; foreach my $in ($x->{oneInput} ? $input : @$input) { my $out ; $x->{oneInput} = 1 ; $obj->_singleTarget($x, $inFile, $in, \$out, @_) or return undef ; push @$output, \$out ; #if ($x->{outType} eq 'array') # { push @$output, \$out } #else # { $output->{$in} = \$out } } return 1 ; } # finally the 1 to 1 and n to 1 return $obj->_singleTarget($x, 1, $input, $output, @_); Carp::croak "should not be here" ; } sub _singleTarget { my $obj = shift ; my $x = shift ; my $inputIsFilename = shift; my $input = shift; if ($x->{oneInput}) { $obj->getFileInfo($x->{Got}, $input) if isaScalar($input) || (isaFilename($input) and $inputIsFilename) ; my $z = $obj->_create($x->{Got}, @_) or return undef ; defined $z->_wr2($input, $inputIsFilename) or return $z->closeError(undef) ; return $z->close() ; } else { my $afterFirst = 0 ; my $inputIsFilename = ($x->{inType} ne 'array'); my $keep = $x->{Got}->clone(); #for my $element ( ($x->{inType} eq 'hash') ? keys %$input : @$input) for my $element ( @$input) { my $isFilename = isaFilename($element); if ( $afterFirst ++ ) { defined addInterStream($obj, $element, $isFilename) or return $obj->closeError(undef) ; } else { $obj->getFileInfo($x->{Got}, $element) if isaScalar($element) || $isFilename; $obj->_create($x->{Got}, @_) or return undef ; } defined $obj->_wr2($element, $isFilename) or return $obj->closeError(undef) ; *$obj->{Got} = $keep->clone(); } return $obj->close() ; } } sub _wr2 { my $self = shift ; my $source = shift ; my $inputIsFilename = shift; my $input = $source ; if (! $inputIsFilename) { $input = \$source if ! ref $source; } if ( ref $input && ref $input eq 'SCALAR' ) { return $self->syswrite($input, @_) ; } if ( ! ref $input || isaFilehandle($input)) { my $isFilehandle = isaFilehandle($input) ; my $fh = $input ; if ( ! $isFilehandle ) { $fh = IO::File->new( "<$input" ) or return $self->saveErrorString(undef, "cannot open file '$input': $!", $!) ; } binmode $fh ; my $status ; my $buff ; my $count = 0 ; while ($status = read($fh, $buff, 16 * 1024)) { $count += length $buff; defined $self->syswrite($buff, @_) or return undef ; } return $self->saveErrorString(undef, $!, $!) if ! defined $status ; if ( (!$isFilehandle || *$self->{AutoClose}) && $input ne '-') { $fh->close() or return undef ; } return $count ; } Carp::croak "Should not be here"; return undef; } sub addInterStream { my $self = shift ; my $input = shift ; my $inputIsFilename = shift ; if (*$self->{Got}->getValue('multistream')) { $self->getFileInfo(*$self->{Got}, $input) #if isaFilename($input) and $inputIsFilename ; if isaScalar($input) || isaFilename($input) ; # TODO -- newStream needs to allow gzip/zip header to be modified return $self->newStream(); } elsif (*$self->{Got}->getValue('autoflush')) { #return $self->flush(Z_FULL_FLUSH); } return 1 ; } sub getFileInfo { } sub TIEHANDLE { return $_[0] if ref($_[0]); die "OOPS\n" ; } sub UNTIE { my $self = shift ; } sub DESTROY { my $self = shift ; local ($., $@, $!, $^E, $?); $self->close() ; # TODO - memory leak with 5.8.0 - this isn't called until # global destruction # %{ *$self } = () ; undef $self ; } sub filterUncompressed { } sub syswrite { my $self = shift ; my $buffer ; if (ref $_[0] ) { $self->croakError( *$self->{ClassName} . "::write: not a scalar reference" ) unless ref $_[0] eq 'SCALAR' ; $buffer = $_[0] ; } else { $buffer = \$_[0] ; } if (@_ > 1) { my $slen = defined $$buffer ? length($$buffer) : 0; my $len = $slen; my $offset = 0; $len = $_[1] if $_[1] < $len; if (@_ > 2) { $offset = $_[2] || 0; $self->croakError(*$self->{ClassName} . "::write: offset outside string") if $offset > $slen; if ($offset < 0) { $offset += $slen; $self->croakError( *$self->{ClassName} . "::write: offset outside string") if $offset < 0; } my $rem = $slen - $offset; $len = $rem if $rem < $len; } $buffer = \substr($$buffer, $offset, $len) ; } return 0 if (! defined $$buffer || length $$buffer == 0) && ! *$self->{FlushPending}; # *$self->{Pending} .= $$buffer ; # # return length $$buffer # if (length *$self->{Pending} < 1024 * 16 && ! *$self->{FlushPending}) ; # # $$buffer = *$self->{Pending} ; # *$self->{Pending} = ''; if (*$self->{Encoding}) { $$buffer = *$self->{Encoding}->encode($$buffer); } else { $] >= 5.008 and ( utf8::downgrade($$buffer, 1) or Carp::croak "Wide character in " . *$self->{ClassName} . "::write:"); } $self->filterUncompressed($buffer); my $buffer_length = defined $$buffer ? length($$buffer) : 0 ; *$self->{UnCompSize}->add($buffer_length) ; my $outBuffer=''; my $status = *$self->{Compress}->compr($buffer, $outBuffer) ; return $self->saveErrorString(undef, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; *$self->{CompSize}->add(length $outBuffer) ; $self->outputPayload($outBuffer) or return undef; return $buffer_length; } sub print { my $self = shift; #if (ref $self) { # $self = *$self{GLOB} ; #} if (defined $\) { if (defined $,) { defined $self->syswrite(join($,, @_) . $\); } else { defined $self->syswrite(join("", @_) . $\); } } else { if (defined $,) { defined $self->syswrite(join($,, @_)); } else { defined $self->syswrite(join("", @_)); } } } sub printf { my $self = shift; my $fmt = shift; defined $self->syswrite(sprintf($fmt, @_)); } sub _flushCompressed { my $self = shift ; my $outBuffer=''; my $status = *$self->{Compress}->flush($outBuffer, @_) ; return $self->saveErrorString(0, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; if ( defined *$self->{FH} ) { *$self->{FH}->clearerr(); } *$self->{CompSize}->add(length $outBuffer) ; $self->outputPayload($outBuffer) or return 0; return 1; } sub flush { my $self = shift ; $self->_flushCompressed(@_) or return 0; if ( defined *$self->{FH} ) { defined *$self->{FH}->flush() or return $self->saveErrorString(0, $!, $!); } return 1; } sub beforePayload { } sub _newStream { my $self = shift ; my $got = shift; my $class = ref $self; $self->_writeTrailer() or return 0 ; $self->ckParams($got) or $self->croakError("newStream: $self->{Error}"); if ($got->getValue('encode')) { my $want_encoding = $got->getValue('encode'); *$self->{Encoding} = IO::Compress::Base::Common::getEncoding($self, $class, $want_encoding); } else { *$self->{Encoding} = undef; } *$self->{Compress} = $self->mkComp($got) or return 0; *$self->{Header} = $self->mkHeader($got) ; $self->output(*$self->{Header} ) or return 0; *$self->{UnCompSize}->reset(); *$self->{CompSize}->reset(); $self->beforePayload(); return 1 ; } sub newStream { my $self = shift ; my $got = $self->checkParams('newStream', *$self->{Got}, @_) or return 0 ; $self->_newStream($got); # *$self->{Compress} = $self->mkComp($got) # or return 0; # # *$self->{Header} = $self->mkHeader($got) ; # $self->output(*$self->{Header} ) # or return 0; # # *$self->{UnCompSize}->reset(); # *$self->{CompSize}->reset(); # # $self->beforePayload(); # # return 1 ; } sub reset { my $self = shift ; return *$self->{Compress}->reset() ; } sub _writeTrailer { my $self = shift ; my $trailer = ''; my $status = *$self->{Compress}->close($trailer) ; return $self->saveErrorString(0, *$self->{Compress}{Error}, *$self->{Compress}{ErrorNo}) if $status == STATUS_ERROR; *$self->{CompSize}->add(length $trailer) ; $trailer .= $self->mkTrailer(); defined $trailer or return 0; return $self->output($trailer); } sub _writeFinalTrailer { my $self = shift ; return $self->output($self->mkFinalTrailer()); } sub close { my $self = shift ; return 1 if *$self->{Closed} || ! *$self->{Compress} ; *$self->{Closed} = 1 ; untie *$self if $] >= 5.008 ; *$self->{FlushPending} = 1 ; $self->_writeTrailer() or return 0 ; $self->_writeFinalTrailer() or return 0 ; $self->output( "", 1 ) or return 0; if (defined *$self->{FH}) { if ((! *$self->{Handle} || *$self->{AutoClose}) && ! *$self->{StdIO}) { $! = 0 ; *$self->{FH}->close() or return $self->saveErrorString(0, $!, $!); } delete *$self->{FH} ; # This delete can set $! in older Perls, so reset the errno $! = 0 ; } return 1; } #sub total_in #sub total_out #sub msg # #sub crc #{ # my $self = shift ; # return *$self->{Compress}->crc32() ; #} # #sub msg #{ # my $self = shift ; # return *$self->{Compress}->msg() ; #} # #sub dict_adler #{ # my $self = shift ; # return *$self->{Compress}->dict_adler() ; #} # #sub get_Level #{ # my $self = shift ; # return *$self->{Compress}->get_Level() ; #} # #sub get_Strategy #{ # my $self = shift ; # return *$self->{Compress}->get_Strategy() ; #} sub tell { my $self = shift ; return *$self->{UnCompSize}->get32bit() ; } sub eof { my $self = shift ; return *$self->{Closed} ; } sub seek { my $self = shift ; my $position = shift; my $whence = shift ; my $here = $self->tell() ; my $target = 0 ; #use IO::Handle qw(SEEK_SET SEEK_CUR SEEK_END); use IO::Handle ; if ($whence == IO::Handle::SEEK_SET) { $target = $position ; } elsif ($whence == IO::Handle::SEEK_CUR || $whence == IO::Handle::SEEK_END) { $target = $here + $position ; } else { $self->croakError(*$self->{ClassName} . "::seek: unknown value, $whence, for whence parameter"); } # short circuit if seeking to current offset return 1 if $target == $here ; # Outlaw any attempt to seek backwards $self->croakError(*$self->{ClassName} . "::seek: cannot seek backwards") if $target < $here ; # Walk the file to the new offset my $offset = $target - $here ; my $buffer ; defined $self->syswrite("\x00" x $offset) or return 0; return 1 ; } sub binmode { 1; # my $self = shift ; # return defined *$self->{FH} # ? binmode *$self->{FH} # : 1 ; } sub fileno { my $self = shift ; return defined *$self->{FH} ? *$self->{FH}->fileno() : undef ; } sub opened { my $self = shift ; return ! *$self->{Closed} ; } sub autoflush { my $self = shift ; return defined *$self->{FH} ? *$self->{FH}->autoflush(@_) : undef ; } sub input_line_number { return undef ; } sub _notAvailable { my $name = shift ; return sub { Carp::croak "$name Not Available: File opened only for output" ; } ; } { no warnings 'once'; *read = _notAvailable('read'); *READ = _notAvailable('read'); *readline = _notAvailable('readline'); *READLINE = _notAvailable('readline'); *getc = _notAvailable('getc'); *GETC = _notAvailable('getc'); *FILENO = \&fileno; *PRINT = \&print; *PRINTF = \&printf; *WRITE = \&syswrite; *write = \&syswrite; *SEEK = \&seek; *TELL = \&tell; *EOF = \&eof; *CLOSE = \&close; *BINMODE = \&binmode; } #*sysread = \&_notAvailable; #*syswrite = \&_write; 1; __END__ =head1 NAME IO::Compress::Base - Base Class for IO::Compress modules =head1 SYNOPSIS use IO::Compress::Base ; =head1 DESCRIPTION This module is not intended for direct use in application code. Its sole purpose is to be sub-classed by IO::Compress modules. =head1 SUPPORT General feedback/questions/bug reports should be sent to L (preferred) or L. =head1 SEE ALSO L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L, L L L, L, L, L =head1 AUTHOR This module was written by Paul Marquess, C. =head1 MODIFICATION HISTORY See the Changes file. =head1 COPYRIGHT AND LICENSE Copyright (c) 2005-2024 Paul Marquess. All rights reserved. This program is free software; you can redistribute it and/or modify it under the same terms as Perl itself. FILE#8c7adf5e/IO/Compress/Base/Common.pmXpackage IO::Compress::Base::Common; use strict ; use warnings; use bytes; use Carp; use Scalar::Util qw(blessed readonly); use File::GlobMapper; require Exporter; our ($VERSION, @ISA, @EXPORT, %EXPORT_TAGS, $HAS_ENCODE); @ISA = qw(Exporter); $VERSION = '2.213'; @EXPORT = qw( isaFilehandle isaFilename isaScalar whatIsInput whatIsOutput isaFileGlobString cleanFileGlobString oneTarget setBinModeInput setBinModeOutput ckInOutParams createSelfTiedObject isGeMax32 MAX32 WANT_CODE WANT_EXT WANT_UNDEF WANT_HASH STATUS_OK STATUS_ENDSTREAM STATUS_EOF STATUS_ERROR ); %EXPORT_TAGS = ( Status => [qw( STATUS_OK STATUS_ENDSTREAM STATUS_EOF STATUS_ERROR )]); use constant STATUS_OK => 0; use constant STATUS_ENDSTREAM => 1; use constant STATUS_EOF => 2; use constant STATUS_ERROR => -1; use constant MAX16 => 0xFFFF ; use constant MAX32 => 0xFFFFFFFF ; use constant MAX32cmp => 0xFFFFFFFF + 1 - 1; # for 5.6.x on 32-bit need to force an non-IV value sub isGeMax32 { return $_[0] >= MAX32cmp ; } sub hasEncode() { if (! defined $HAS_ENCODE) { eval { require Encode; Encode->import(); }; $HAS_ENCODE = $@ ? 0 : 1 ; } return $HAS_ENCODE; } sub getEncoding($$$) { my $obj = shift; my $class = shift ; my $want_encoding = shift ; $obj->croakError("$class: Encode module needed to use -Encode") if ! hasEncode(); my $encoding = Encode::find_encoding($want_encoding); $obj->croakError("$class: Encoding '$want_encoding' is not available") if ! $encoding; return $encoding; } our ($needBinmode); $needBinmode = ($^O eq 'MSWin32' || ($] >= 5.006 && eval ' ${^UNICODE} || ${^UTF8LOCALE} ')) ? 1 : 1 ; sub setBinModeInput($) { my $handle = shift ; binmode $handle if $needBinmode; } sub setBinModeOutput($) { my $handle = shift ; binmode $handle if $needBinmode; } sub isaFilehandle($) { use utf8; # Pragma needed to keep Perl 5.6.0 happy return (defined $_[0] and (UNIVERSAL::isa($_[0],'GLOB') or UNIVERSAL::isa($_[0],'IO::Handle') or UNIVERSAL::isa(\$_[0],'GLOB')) ) } sub isaScalar { return ( defined($_[0]) and ref($_[0]) eq 'SCALAR' and defined ${ $_[0] } ) ; } sub isaFilename($) { return (defined $_[0] and ! ref $_[0] and UNIVERSAL::isa(\$_[0], 'SCALAR')); } sub isaFileGlobString { return defined $_[0] && $_[0] =~ /^<.*>$/; } sub cleanFileGlobString { my $string = shift ; $string =~ s/^\s*<\s*(.*)\s*>\s*$/$1/; return $string; } use constant WANT_CODE => 1 ; use constant WANT_EXT => 2 ; use constant WANT_UNDEF => 4 ; #use constant WANT_HASH => 8 ; use constant WANT_HASH => 0 ; sub whatIsInput($;$) { my $got = whatIs(@_); if (defined $got && $got eq 'filename' && defined $_[0] && $_[0] eq '-') { #use IO::File; $got = 'handle'; $_[0] = *STDIN; #$_[0] = IO::File->new("<-"); } return $got; } sub whatIsOutput($;$) { my $got = whatIs(@_); if (defined $got && $got eq 'filename' && defined $_[0] && $_[0] eq '-') { $got = 'handle'; $_[0] = *STDOUT; #$_[0] = IO::File->new(">-"); } return $got; } sub whatIs ($;$) { return 'handle' if isaFilehandle($_[0]); my $wantCode = defined $_[1] && $_[1] & WANT_CODE ; my $extended = defined $_[1] && $_[1] & WANT_EXT ; my $undef = defined $_[1] && $_[1] & WANT_UNDEF ; my $hash = defined $_[1] && $_[1] & WANT_HASH ; return 'undef' if ! defined $_[0] && $undef ; if (ref $_[0]) { return '' if blessed($_[0]); # is an object #return '' if UNIVERSAL::isa($_[0], 'UNIVERSAL'); # is an object return 'buffer' if UNIVERSAL::isa($_[0], 'SCALAR'); return 'array' if UNIVERSAL::isa($_[0], 'ARRAY') && $extended ; return 'hash' if UNIVERSAL::isa($_[0], 'HASH') && $hash ; return 'code' if UNIVERSAL::isa($_[0], 'CODE') && $wantCode ; return ''; } return 'fileglob' if $extended && isaFileGlobString($_[0]); return 'filename'; } sub oneTarget { return $_[0] =~ /^(code|handle|buffer|filename)$/; } sub IO::Compress::Base::Validator::new { my $class = shift ; my $Class = shift ; my $error_ref = shift ; my $reportClass = shift ; my %data = (Class => $Class, Error => $error_ref, reportClass => $reportClass, ) ; my $obj = bless \%data, $class ; local $Carp::CarpLevel = 1; my $inType = $data{inType} = whatIsInput($_[0], WANT_EXT|WANT_HASH); my $outType = $data{outType} = whatIsOutput($_[1], WANT_EXT|WANT_HASH); my $oneInput = $data{oneInput} = oneTarget($inType); my $oneOutput = $data{oneOutput} = oneTarget($outType); if (! $inType) { $obj->croakError("$reportClass: illegal input parameter") ; #return undef ; } # if ($inType eq 'hash') # { # $obj->{Hash} = 1 ; # $obj->{oneInput} = 1 ; # return $obj->validateHash($_[0]); # } if (! $outType) { $obj->croakError("$reportClass: illegal output parameter") ; #return undef ; } if ($inType ne 'fileglob' && $outType eq 'fileglob') { $obj->croakError("Need input fileglob for outout fileglob"); } # if ($inType ne 'fileglob' && $outType eq 'hash' && $inType ne 'filename' ) # { # $obj->croakError("input must ne filename or fileglob when output is a hash"); # } if ($inType eq 'fileglob' && $outType eq 'fileglob') { $data{GlobMap} = 1 ; $data{inType} = $data{outType} = 'filename'; my $mapper = File::GlobMapper->new($_[0], $_[1]); if ( ! $mapper ) { return $obj->saveErrorString($File::GlobMapper::Error) ; } $data{Pairs} = $mapper->getFileMap(); return $obj; } $obj->croakError("$reportClass: input and output $inType are identical") if $inType eq $outType && $_[0] eq $_[1] && $_[0] ne '-' ; if ($inType eq 'fileglob') # && $outType ne 'fileglob' { my $glob = cleanFileGlobString($_[0]); my @inputs = glob($glob); if (@inputs == 0) { # TODO -- legal or die? die "globmap matched zero file -- legal or die???" ; } elsif (@inputs == 1) { $obj->validateInputFilenames($inputs[0]) or return undef; $_[0] = $inputs[0] ; $data{inType} = 'filename' ; $data{oneInput} = 1; } else { $obj->validateInputFilenames(@inputs) or return undef; $_[0] = [ @inputs ] ; $data{inType} = 'filenames' ; } } elsif ($inType eq 'filename') { $obj->validateInputFilenames($_[0]) or return undef; } elsif ($inType eq 'array') { $data{inType} = 'filenames' ; $obj->validateInputArray($_[0]) or return undef ; } return $obj->saveErrorString("$reportClass: output buffer is read-only") if $outType eq 'buffer' && readonly(${ $_[1] }); if ($outType eq 'filename' ) { $obj->croakError("$reportClass: output filename is undef or null string") if ! defined $_[1] || $_[1] eq '' ; if (-e $_[1]) { if (-d _ ) { return $obj->saveErrorString("output file '$_[1]' is a directory"); } } } return $obj ; } sub IO::Compress::Base::Validator::saveErrorString { my $self = shift ; ${ $self->{Error} } = shift ; return undef; } sub IO::Compress::Base::Validator::croakError { my $self = shift ; $self->saveErrorString($_[0]); croak $_[0]; } sub IO::Compress::Base::Validator::validateInputFilenames { my $self = shift ; foreach my $filename (@_) { $self->croakError("$self->{reportClass}: input filename is undef or null string") if ! defined $filename || $filename eq '' ; next if $filename eq '-'; if (! -e $filename ) { return $self->saveErrorString("input file '$filename' does not exist"); } if (-d _ ) { return $self->saveErrorString("input file '$filename' is a directory"); } # if (! -r _ ) # { # return $self->saveErrorString("cannot open file '$filename': $!"); # } } return 1 ; } sub IO::Compress::Base::Validator::validateInputArray { my $self = shift ; if ( @{ $_[0] } == 0 ) { return $self->saveErrorString("empty array reference") ; } foreach my $element ( @{ $_[0] } ) { my $inType = whatIsInput($element); if (! $inType) { $self->croakError("unknown input parameter") ; } elsif($inType eq 'filename') { $self->validateInputFilenames($element) or return undef ; } else { $self->croakError("not a filename") ; } } return 1 ; } #sub IO::Compress::Base::Validator::validateHash #{ # my $self = shift ; # my $href = shift ; # # while (my($k, $v) = each %$href) # { # my $ktype = whatIsInput($k); # my $vtype = whatIsOutput($v, WANT_EXT|WANT_UNDEF) ; # # if ($ktype ne 'filename') # { # return $self->saveErrorString("hash key not filename") ; # } # # my %valid = map { $_ => 1 } qw(filename buffer array undef handle) ; # if (! $valid{$vtype}) # { # return $self->saveErrorString("hash value not ok") ; # } # } # # return $self ; #} sub createSelfTiedObject { my $class = shift || (caller)[0] ; my $error_ref = shift ; my $obj = bless Symbol::gensym(), ref($class) || $class; tie *$obj, $obj if $] >= 5.005; *$obj->{Closed} = 1 ; $$error_ref = ''; *$obj->{Error} = $error_ref ; my $errno = 0 ; *$obj->{ErrorNo} = \$errno ; return $obj; } #package Parse::Parameters ; # # #require Exporter; #our ($VERSION, @ISA, @EXPORT); #$VERSION = '2.000_08'; #@ISA = qw(Exporter); $EXPORT_TAGS{Parse} = [qw( ParseParameters Parse_any Parse_unsigned Parse_signed Parse_boolean Parse_string Parse_code Parse_writable_scalar ) ]; push @EXPORT, @{ $EXPORT_TAGS{Parse} } ; use constant Parse_any => 0x01; use constant Parse_unsigned => 0x02; use constant Parse_signed => 0x04; use constant Parse_boolean => 0x08; use constant Parse_string => 0x10; use constant Parse_code => 0x20; #use constant Parse_store_ref => 0x100 ; #use constant Parse_multiple => 0x100 ; use constant Parse_writable => 0x200 ; use constant Parse_writable_scalar => 0x400 | Parse_writable ; use constant OFF_PARSED => 0 ; use constant OFF_TYPE => 1 ; use constant OFF_DEFAULT => 2 ; use constant OFF_FIXED => 3 ; #use constant OFF_FIRST_ONLY => 4 ; #use constant OFF_STICKY => 5 ; use constant IxError => 0; use constant IxGot => 1 ; sub ParseParameters { my $level = shift || 0 ; my $sub = (caller($level + 1))[3] ; local $Carp::CarpLevel = 1 ; return $_[1] if @_ == 2 && defined $_[1] && UNIVERSAL::isa($_[1], "IO::Compress::Base::Parameters"); my $p = IO::Compress::Base::Parameters->new(); $p->parse(@_) or croak "$sub: $p->[IxError]" ; return $p; } use strict; use warnings; use Carp; sub Init { my $default = shift ; my %got ; my $obj = IO::Compress::Base::Parameters::new(); while (my ($key, $v) = each %$default) { croak "need 2 params [@$v]" if @$v != 2 ; my ($type, $value) = @$v ; # my ($first_only, $sticky, $type, $value) = @$v ; my $sticky = 0; my $x ; $obj->_checkType($key, \$value, $type, 0, \$x) or return undef ; $key = lc $key; # if (! $sticky) { # $x = [] # if $type & Parse_multiple; # $got{$key} = [0, $type, $value, $x, $first_only, $sticky] ; $got{$key} = [0, $type, $value, $x] ; # } # # $got{$key}[OFF_PARSED] = 0 ; } return bless \%got, "IO::Compress::Base::Parameters::Defaults" ; } sub IO::Compress::Base::Parameters::new { #my $class = shift ; my $obj; $obj->[IxError] = ''; $obj->[IxGot] = {} ; return bless $obj, 'IO::Compress::Base::Parameters' ; } sub IO::Compress::Base::Parameters::setError { my $self = shift ; my $error = shift ; my $retval = @_ ? shift : undef ; $self->[IxError] = $error ; return $retval; } sub IO::Compress::Base::Parameters::getError { my $self = shift ; return $self->[IxError] ; } sub IO::Compress::Base::Parameters::parse { my $self = shift ; my $default = shift ; my $got = $self->[IxGot] ; my $firstTime = keys %{ $got } == 0 ; my (@Bad) ; my @entered = () ; # Allow the options to be passed as a hash reference or # as the complete hash. if (@_ == 0) { @entered = () ; } elsif (@_ == 1) { my $href = $_[0] ; return $self->setError("Expected even number of parameters, got 1") if ! defined $href or ! ref $href or ref $href ne "HASH" ; foreach my $key (keys %$href) { push @entered, $key ; push @entered, \$href->{$key} ; } } else { my $count = @_; return $self->setError("Expected even number of parameters, got $count") if $count % 2 != 0 ; for my $i (0.. $count / 2 - 1) { push @entered, $_[2 * $i] ; push @entered, \$_[2 * $i + 1] ; } } foreach my $key (keys %$default) { my ($type, $value) = @{ $default->{$key} } ; if ($firstTime) { $got->{$key} = [0, $type, $value, $value] ; } else { $got->{$key}[OFF_PARSED] = 0 ; } } my %parsed = (); for my $i (0.. @entered / 2 - 1) { my $key = $entered[2* $i] ; my $value = $entered[2* $i+1] ; #print "Key [$key] Value [$value]" ; #print defined $$value ? "[$$value]\n" : "[undef]\n"; $key =~ s/^-// ; my $canonkey = lc $key; if ($got->{$canonkey}) { my $type = $got->{$canonkey}[OFF_TYPE] ; my $parsed = $parsed{$canonkey}; ++ $parsed{$canonkey}; return $self->setError("Muliple instances of '$key' found") if $parsed ; my $s ; $self->_checkType($key, $value, $type, 1, \$s) or return undef ; $value = $$value ; $got->{$canonkey} = [1, $type, $value, $s] ; } else { push (@Bad, $key) } } if (@Bad) { my ($bad) = join(", ", @Bad) ; return $self->setError("unknown key value(s) $bad") ; } return 1; } sub IO::Compress::Base::Parameters::_checkType { my $self = shift ; my $key = shift ; my $value = shift ; my $type = shift ; my $validate = shift ; my $output = shift; #local $Carp::CarpLevel = $level ; #print "PARSE $type $key $value $validate $sub\n" ; if ($type & Parse_writable_scalar) { return $self->setError("Parameter '$key' not writable") if readonly $$value ; if (ref $$value) { return $self->setError("Parameter '$key' not a scalar reference") if ref $$value ne 'SCALAR' ; $$output = $$value ; } else { return $self->setError("Parameter '$key' not a scalar") if ref $value ne 'SCALAR' ; $$output = $value ; } return 1; } $value = $$value ; if ($type & Parse_any) { $$output = $value ; return 1; } elsif ($type & Parse_unsigned) { return $self->setError("Parameter '$key' must be an unsigned int, got 'undef'") if ! defined $value ; return $self->setError("Parameter '$key' must be an unsigned int, got '$value'") if $value !~ /^\d+$/; $$output = defined $value ? $value : 0 ; return 1; } elsif ($type & Parse_signed) { return $self->setError("Parameter '$key' must be a signed int, got 'undef'") if ! defined $value ; return $self->setError("Parameter '$key' must be a signed int, got '$value'") if $value !~ /^-?\d+$/; $$output = defined $value ? $value : 0 ; return 1 ; } elsif ($type & Parse_boolean) { return $self->setError("Parameter '$key' must be an int, got '$value'") if defined $value && $value !~ /^\d*$/; $$output = defined $value && $value != 0 ? 1 : 0 ; return 1; } elsif ($type & Parse_string) { $$output = defined $value ? $value : "" ; return 1; } elsif ($type & Parse_code) { return $self->setError("Parameter '$key' must be a code reference, got '$value'") if (! defined $value || ref $value ne 'CODE') ; $$output = defined $value ? $value : "" ; return 1; } $$output = $value ; return 1; } sub IO::Compress::Base::Parameters::parsed { return $_[0]->[IxGot]{$_[1]}[OFF_PARSED] ; } sub IO::Compress::Base::Parameters::getValue { return $_[0]->[IxGot]{$_[1]}[OFF_FIXED] ; } sub IO::Compress::Base::Parameters::setValue { $_[0]->[IxGot]{$_[1]}[OFF_PARSED] = 1; $_[0]->[IxGot]{$_[1]}[OFF_DEFAULT] = $_[2] ; $_[0]->[IxGot]{$_[1]}[OFF_FIXED] = $_[2] ; } sub IO::Compress::Base::Parameters::valueRef { return $_[0]->[IxGot]{$_[1]}[OFF_FIXED] ; } sub IO::Compress::Base::Parameters::valueOrDefault { my $self = shift ; my $name = shift ; my $default = shift ; my $value = $self->[IxGot]{$name}[OFF_DEFAULT] ; return $value if defined $value ; return $default ; } sub IO::Compress::Base::Parameters::wantValue { return defined $_[0]->[IxGot]{$_[1]}[OFF_DEFAULT] ; } sub IO::Compress::Base::Parameters::clone { my $self = shift ; my $obj = [] ; my %got ; my $hash = $self->[IxGot] ; for my $k (keys %{ $hash }) { $got{$k} = [ @{ $hash->{$k} } ]; } $obj->[IxError] = $self->[IxError]; $obj->[IxGot] = \%got ; return bless $obj, 'IO::Compress::Base::Parameters' ; } package U64; use constant MAX32 => 0xFFFFFFFF ; use constant HI_1 => MAX32 + 1 ; use constant LOW => 0 ; use constant HIGH => 1; sub new { return bless [ 0, 0 ], $_[0] if @_ == 1 ; return bless [ $_[1], 0 ], $_[0] if @_ == 2 ; return bless [ $_[2], $_[1] ], $_[0] if @_ == 3 ; } sub newUnpack_V64 { my ($low, $hi) = unpack "V V", $_[0] ; bless [ $low, $hi ], "U64"; } sub newUnpack_V32 { my $string = shift; my $low = unpack "V", $string ; bless [ $low, 0 ], "U64"; } sub reset { $_[0]->[HIGH] = $_[0]->[LOW] = 0; } sub clone { bless [ @{$_[0]} ], ref $_[0] ; } sub getHigh { return $_[0]->[HIGH]; } sub getLow { return $_[0]->[LOW]; } sub get32bit { return $_[0]->[LOW]; } sub get64bit { # Not using << here because the result will still be # a 32-bit value on systems where int size is 32-bits return $_[0]->[HIGH] * HI_1 + $_[0]->[LOW]; } sub add { # my $self = shift; my $value = $_[1]; if (ref $value eq 'U64') { $_[0]->[HIGH] += $value->[HIGH] ; $value = $value->[LOW]; } elsif ($value > MAX32) { $_[0]->[HIGH] += int($value / HI_1) ; $value = $value % HI_1; } my $available = MAX32 - $_[0]->[LOW] ; if ($value > $available) { ++ $_[0]->[HIGH] ; $_[0]->[LOW] = $value - $available - 1; } else { $_[0]->[LOW] += $value ; } } sub add32 { # my $self = shift; my $value = $_[1]; if ($value > MAX32) { $_[0]->[HIGH] += int($value / HI_1) ; $value = $value % HI_1; } my $available = MAX32 - $_[0]->[LOW] ; if ($value > $available) { ++ $_[0]->[HIGH] ; $_[0]->[LOW] = $value - $available - 1; } else { $_[0]->[LOW] += $value ; } } sub subtract { my $self = shift; my $value = shift; if (ref $value eq 'U64') { if ($value->[HIGH]) { die "bad" if $self->[HIGH] == 0 || $value->[HIGH] > $self->[HIGH] ; $self->[HIGH] -= $value->[HIGH] ; } $value = $value->[LOW] ; } if ($value > $self->[LOW]) { -- $self->[HIGH] ; $self->[LOW] = MAX32 - $value + $self->[LOW] + 1 ; } else { $self->[LOW] -= $value; } } sub equal { my $self = shift; my $other = shift; return $self->[LOW] == $other->[LOW] && $self->[HIGH] == $other->[HIGH] ; } sub isZero { my $self = shift; return $self->[LOW] == 0 && $self->[HIGH] == 0 ; } sub gt { my $self = shift; my $other = shift; return $self->cmp($other) > 0 ; } sub cmp { my $self = shift; my $other = shift ; if ($self->[LOW] == $other->[LOW]) { return $self->[HIGH] - $other->[HIGH] ; } else { return $self->[LOW] - $other->[LOW] ; } } sub is64bit { return $_[0]->[HIGH] > 0 ; } sub isAlmost64bit { return $_[0]->[HIGH] > 0 || $_[0]->[LOW] == MAX32 ; } sub getPacked_V64 { return pack "V V", @{ $_[0] } ; } sub getPacked_V32 { return pack "V", $_[0]->[LOW] ; } sub pack_V64 { return pack "V V", $_[0], 0; } sub full32 { return $_[0] == MAX32 ; } sub Value_VV64 { my $buffer = shift; my ($lo, $hi) = unpack ("V V" , $buffer); no warnings 'uninitialized'; return $hi * HI_1 + $lo; } package IO::Compress::Base::Common; 1; FILE93589457/IO/Compress/Gzip.pmpackage IO::Compress::Gzip ; require 5.006 ; use strict ; use warnings; use bytes; require Exporter ; use IO::Compress::RawDeflate 2.213 () ; use IO::Compress::Adapter::Deflate 2.213 ; use IO::Compress::Base::Common 2.213 qw(:Status ); use IO::Compress::Gzip::Constants 2.213 ; use IO::Compress::Zlib::Extra 2.213 ; BEGIN { if (defined &utf8::downgrade ) { *noUTF8 = \&utf8::downgrade } else { *noUTF8 = sub {} } } our ($VERSION, @ISA, @EXPORT_OK, %EXPORT_TAGS, %DEFLATE_CONSTANTS, $GzipError); $VERSION = '2.213'; $GzipError = '' ; @ISA = qw(IO::Compress::RawDeflate Exporter); @EXPORT_OK = qw( $GzipError gzip ) ; %EXPORT_TAGS = %IO::Compress::RawDeflate::DEFLATE_CONSTANTS ; push @{ $EXPORT_TAGS{all} }, @EXPORT_OK ; Exporter::export_ok_tags('all'); sub new { my $class = shift ; my $obj = IO::Compress::Base::Common::createSelfTiedObject($class, \$GzipError); $obj->_create(undef, @_); } sub gzip { my $obj = IO::Compress::Base::Common::createSelfTiedObject(undef, \$GzipError); return $obj->_def(@_); } #sub newHeader #{ # my $self = shift ; # #return GZIP_MINIMUM_HEADER ; # return $self->mkHeader(*$self->{Got}); #} sub getExtraParams { my $self = shift ; return ( # zlib behaviour $self->getZlibParams(), # Gzip header fields 'minimal' => [IO::Compress::Base::Common::Parse_boolean, 0], 'comment' => [IO::Compress::Base::Common::Parse_any, undef], 'name' => [IO::Compress::Base::Common::Parse_any, undef], 'time' => [IO::Compress::Base::Common::Parse_any, undef], 'textflag' => [IO::Compress::Base::Common::Parse_boolean, 0], 'headercrc' => [IO::Compress::Base::Common::Parse_boolean, 0], 'os_code' => [IO::Compress::Base::Common::Parse_unsigned, $Compress::Raw::Zlib::gzip_os_code], 'extrafield'=> [IO::Compress::Base::Common::Parse_any, undef], 'extraflags'=> [IO::Compress::Base::Common::Parse_any, undef], ); } sub ckParams { my $self = shift ; my $got = shift ; # gzip always needs crc32 $got->setValue('crc32' => 1); return 1 if $got->getValue('merge') ; my $strict = $got->getValue('strict') ; { if (! $got->parsed('time') ) { # Modification time defaults to now. $got->setValue(time => time) ; } # Check that the Name & Comment don't have embedded NULLs # Also check that they only contain ISO 8859-1 chars. if ($got->parsed('name') && defined $got->getValue('name')) { my $name = $got->getValue('name'); return $self->saveErrorString(undef, "Null Character found in Name", Z_DATA_ERROR) if $strict && $name =~ /\x00/ ; return $self->saveErrorString(undef, "Non ISO 8859-1 Character found in Name", Z_DATA_ERROR) if $strict && $name =~ /$GZIP_FNAME_INVALID_CHAR_RE/o ; } if ($got->parsed('comment') && defined $got->getValue('comment')) { my $comment = $got->getValue('comment'); return $self->saveErrorString(undef, "Null Character found in Comment", Z_DATA_ERROR) if $strict && $comment =~ /\x00/ ; return $self->saveErrorString(undef, "Non ISO 8859-1 Character found in Comment", Z_DATA_ERROR) if $strict && $comment =~ /$GZIP_FCOMMENT_INVALID_CHAR_RE/o; } if ($got->parsed('os_code') ) { my $value = $got->getValue('os_code'); return $self->saveErrorString(undef, "OS_Code must be between 0 and 255, got '$value'") if $value < 0 || $value > 255 ; } # gzip only supports Deflate at present $got->setValue('method' => Z_DEFLATED) ; if ( ! $got->parsed('extraflags')) { $got->setValue('extraflags' => 2) if $got->getValue('level') == Z_BEST_COMPRESSION ; $got->setValue('extraflags' => 4) if $got->getValue('level') == Z_BEST_SPEED ; } my $data = $got->getValue('extrafield') ; if (defined $data) { my $bad = IO::Compress::Zlib::Extra::parseExtraField($data, $strict, 1) ; return $self->saveErrorString(undef, "Error with ExtraField Parameter: $bad", Z_DATA_ERROR) if $bad ; $got->setValue('extrafield' => $data) ; } } return 1; } sub mkTrailer { my $self = shift ; return pack("V V", *$self->{Compress}->crc32(), *$self->{UnCompSize}->get32bit()); } sub getInverseClass { no warnings 'once'; return ('IO::Uncompress::Gunzip', \$IO::Uncompress::Gunzip::GunzipError); } sub getFileInfo { my $self = shift ; my $params = shift; my $filename = shift ; return if IO::Compress::Base::Common::isaScalar($filename); my $defaultTime = (stat($filename))[9] ; $params->setValue('name' => $filename) if ! $params->parsed('name') ; $params->setValue('time' => $defaultTime) if ! $params->parsed('time') ; } sub mkHeader { my $self = shift ; my $param = shift ; # short-circuit if a minimal header is requested. return GZIP_MINIMUM_HEADER if $param->getValue('minimal') ; # METHOD my $method = $param->valueOrDefault('method', GZIP_CM_DEFLATED) ; # FLAGS my $flags = GZIP_FLG_DEFAULT ; $flags |= GZIP_FLG_FTEXT if $param->getValue('textflag') ; $flags |= GZIP_FLG_FHCRC if $param->getValue('headercrc') ; $flags |= GZIP_FLG_FEXTRA if $param->wantValue('extrafield') ; $flags |= GZIP_FLG_FNAME if $param->wantValue('name') ; $flags |= GZIP_FLG_FCOMMENT if $param->wantValue('comment') ; # MTIME my $time = $param->valueOrDefault('time', GZIP_MTIME_DEFAULT) ; # EXTRA FLAGS my $extra_flags = $param->valueOrDefault('extraflags', GZIP_XFL_DEFAULT); # OS CODE my $os_code = $param->valueOrDefault('os_code', GZIP_OS_DEFAULT) ; my $out = pack("C4 V C C", GZIP_ID1, # ID1 GZIP_ID2, # ID2 $method, # Compression Method $flags, # Flags $time, # Modification Time $extra_flags, # Extra Flags $os_code, # Operating System Code ) ; # EXTRA if ($flags & GZIP_FLG_FEXTRA) { my $extra = $param->getValue('extrafield') ; $out .= pack("v", length $extra) . $extra ; } # NAME if ($flags & GZIP_FLG_FNAME) { my $name .= $param->getValue('name') ; $name =~ s/\x00.*$//; $out .= $name ; # Terminate the filename with NULL unless it already is $out .= GZIP_NULL_BYTE if !length $name or substr($name, 1, -1) ne GZIP_NULL_BYTE ; } # COMMENT if ($flags & GZIP_FLG_FCOMMENT) { my $comment .= $param->getValue('comment') ; $comment =~ s/\x00.*$//; $out .= $comment ; # Terminate the comment with NULL unless it already is $out .= GZIP_NULL_BYTE if ! length $comment or substr($comment, 1, -1) ne GZIP_NULL_BYTE; } # HEADER CRC $out .= pack("v", Compress::Raw::Zlib::crc32($out) & 0x00FF ) if $param->getValue('headercrc') ; noUTF8($out); return $out ; } sub mkFinalTrailer { return ''; } 1; __END__ =head1 NAME IO::Compress::Gzip - Write RFC 1952 files/buffers =head1 SYNOPSIS use IO::Compress::Gzip qw(gzip $GzipError) ; my $status = gzip $input => $output [,OPTS] or die "gzip failed: $GzipError\n"; my $z = IO::Compress::Gzip->new( $output [,OPTS] ) or die "gzip failed: $GzipError\n"; $z->print($string); $z->printf($format, $string); $z->write($string); $z->syswrite($string [, $length, $offset]); $z->flush(); $z->tell(); $z->eof(); $z->seek($position, $whence); $z->binmode(); $z->fileno(); $z->opened(); $z->autoflush(); $z->input_line_number(); $z->newStream( [OPTS] ); $z->deflateParams(); $z->close() ; $GzipError ; # IO::File mode print $z $string; printf $z $format, $string; tell $z eof $z seek $z, $position, $whence binmode $z fileno $z close $z ; =head1 DESCRIPTION This module provides a Perl interface that allows writing compressed data to files or buffer as defined in RFC 1952. All the gzip headers defined in RFC 1952 can be created using this module. For reading RFC 1952 files/buffers, see the companion module L. =head1 Functional Interface A top-level function, C, is provided to carry out "one-shot" compression between buffers and/or files. For finer control over the compression process, see the L section. use IO::Compress::Gzip qw(gzip $GzipError) ; gzip $input_filename_or_reference => $output_filename_or_reference [,OPTS] or die "gzip failed: $GzipError\n"; The functional interface needs Perl5.005 or better. =head2 gzip $input_filename_or_reference => $output_filename_or_reference [, OPTS] C expects at least two parameters, C<$input_filename_or_reference> and C<$output_filename_or_reference> and zero or more optional parameters (see L) =head3 The C<$input_filename_or_reference> parameter The parameter, C<$input_filename_or_reference>, is used to define the source of the uncompressed data. It can take one of the following forms: =over 5 =item A filename If the C<$input_filename_or_reference> parameter is a simple scalar, it is assumed to be a filename. This file will be opened for reading and the input data will be read from it. =item A filehandle If the C<$input_filename_or_reference> parameter is a filehandle, the input data will be read from it. The string '-' can be used as an alias for standard input. =item A scalar reference If C<$input_filename_or_reference> is a scalar reference, the input data will be read from C<$$input_filename_or_reference>. =item An array reference If C<$input_filename_or_reference> is an array reference, each element in the array must be a filename. The input data will be read from each file in turn. The complete array will be walked to ensure that it only contains valid filenames before any data is compressed. =item An Input FileGlob string If C<$input_filename_or_reference> is a string that is delimited by the characters "<" and ">" C will assume that it is an I. The input is the list of files that match the fileglob. See L for more details. =back If the C<$input_filename_or_reference> parameter is any other type, C will be returned. In addition, if C<$input_filename_or_reference> is a simple filename, the default values for the C and C
argument: my @layer_and_args_and_flags = PerlIO::get_layers($fh, details => 1); The result will be up to be three times the number of layers: the first element will be a name, the second element the arguments (unspecified arguments will be C), the third element the flags, the fourth element a name again, and so forth. B =head1 AUTHOR Nick Ing-Simmons Enick@ing-simmons.netE =head1 SEE ALSO L, L, L, L, L =cut FILEaab145f8/PerlIO/scalar.pmpackage PerlIO::scalar; our $VERSION = '0.32'; 1; __END__ =head1 NAME PerlIO::scalar - in-memory IO, scalar IO =head1 SYNOPSIS my $scalar = ''; ... open my $fh, "<", \$scalar or die; open my $fh, ">", \$scalar or die; open my $fh, ">>", \$scalar or die; or my $scalar = ''; ... open my $fh, "<:scalar", \$scalar or die; open my $fh, ">:scalar", \$scalar or die; open my $fh, ">>:scalar", \$scalar or die; =head1 DESCRIPTION A filehandle is opened but the file operations are performed "in-memory" on a scalar variable. All the normal file operations can be performed on the handle. The scalar is considered a stream of bytes. Currently fileno($fh) returns -1. Attempting to open a read-only scalar for writing will fail, and if warnings are enabled, produce a warning. =head1 IMPLEMENTATION NOTE C only exists as a stub. One does not need to explicitly C. =cut FILE4a50329b/SelectSaver.pm4package SelectSaver; our $VERSION = '1.02'; =head1 NAME SelectSaver - save and restore selected file handle =head1 SYNOPSIS use SelectSaver; { my $saver = SelectSaver->new(FILEHANDLE); # FILEHANDLE is selected } # previous handle is selected { my $saver = SelectSaver->new; # new handle may be selected, or not } # previous handle is selected =head1 DESCRIPTION A C object contains a reference to the file handle that was selected when it was created. If its C method gets an extra parameter, then that parameter is selected; otherwise, the selected file handle remains unchanged. When a C is destroyed, it re-selects the file handle that was selected when it was created. =cut require 5.000; use Carp; use Symbol; sub new { @_ >= 1 && @_ <= 2 or croak 'usage: SelectSaver->new( [FILEHANDLE] )'; my $fh = select; my $self = bless \$fh, $_[0]; select qualify($_[1], caller) if @_ > 1; $self; } sub DESTROY { my $self = $_[0]; select $$self; } 1; FILE477ebe95/Symbol.pm)package Symbol; use strict; use warnings; =head1 NAME Symbol - manipulate Perl symbols and their names =head1 SYNOPSIS use Symbol; $sym = gensym; open($sym, '<', "filename"); $_ = <$sym>; # etc. ungensym $sym; # no effect # replace *FOO{IO} handle but not $FOO, %FOO, etc. *FOO = geniosym; print qualify("x"), "\n"; # "main::x" print qualify("x", "FOO"), "\n"; # "FOO::x" print qualify("BAR::x"), "\n"; # "BAR::x" print qualify("BAR::x", "FOO"), "\n"; # "BAR::x" print qualify("STDOUT", "FOO"), "\n"; # "main::STDOUT" (global) print qualify(\*x), "\n"; # returns \*x print qualify(\*x, "FOO"), "\n"; # returns \*x use strict refs; print { qualify_to_ref $fh } "foo!\n"; $ref = qualify_to_ref $name, $pkg; use Symbol qw(delete_package); delete_package('Foo::Bar'); print "deleted\n" unless exists $Foo::{'Bar::'}; =head1 DESCRIPTION C creates an anonymous glob and returns a reference to it. Such a glob reference can be used as a file or directory handle. For backward compatibility with older implementations that didn't support anonymous globs, C is also provided. But it doesn't do anything. C creates an anonymous IO handle. This can be assigned into an existing glob without affecting the non-IO portions of the glob. C turns unqualified symbol names into qualified variable names (e.g. "myvar" -E "MyPackage::myvar"). If it is given a second parameter, C uses it as the default package; otherwise, it uses the package of its caller. Regardless, global variable names (e.g. "STDOUT", "ENV", "SIG") are always qualified with "main::". Qualification applies only to symbol names (strings). References are left unchanged under the assumption that they are glob references, which are qualified by their nature. C is just like C except that it returns a glob ref rather than a symbol name, so you can use the result even if C is in effect. C wipes out a whole package namespace. Note this routine is not exported by default--you may want to import it explicitly. =head1 BUGS C is a bit too powerful. It undefines every symbol that lives in the specified package. Since perl, for performance reasons, does not perform a symbol table lookup each time a function is called or a global variable is accessed, some code that has already been loaded and that makes use of symbols in package C may stop working after you delete C, even if you reload the C module afterwards. =cut require Exporter; our @ISA = qw(Exporter); our @EXPORT = qw(gensym ungensym qualify qualify_to_ref); our @EXPORT_OK = qw(delete_package geniosym); our $VERSION = '1.09'; my $genpkg = "Symbol::"; my $genseq = 0; my %global = map {$_ => 1} qw(ARGV ARGVOUT ENV INC SIG STDERR STDIN STDOUT); # # Note that we never _copy_ the glob; we just make a ref to it. # If we did copy it, then SVf_FAKE would be set on the copy, and # glob-specific behaviors (e.g. C<*$ref = \&func>) wouldn't work. # sub gensym () { my $name = "GEN" . $genseq++; no strict 'refs'; my $ref = \*{$genpkg . $name}; delete $$genpkg{$name}; $ref; } sub geniosym () { my $sym = gensym(); # force the IO slot to be filled select(select $sym); *$sym{IO}; } sub ungensym ($) {} sub qualify ($;$) { my ($name) = @_; if (!ref($name) && index($name, '::') == -1 && index($name, "'") == -1) { my $pkg; # Global names: special character, "^xyz", or other. if ($name =~ /^(([^a-z])|(\^[a-z_]+))\z/i || $global{$name}) { # RGS 2001-11-05 : translate leading ^X to control-char $name =~ s/^\^([a-z_])/'qq(\c'.$1.')'/eei; $pkg = "main"; } else { $pkg = (@_ > 1) ? $_[1] : caller; } $name = $pkg . "::" . $name; } $name; } sub qualify_to_ref ($;$) { no strict 'refs'; return \*{ qualify $_[0], @_ > 1 ? $_[1] : caller }; } # # of Safe.pm lineage # sub delete_package ($) { my $pkg = shift; # expand to full symbol table name if needed unless ($pkg =~ /^main::.*::$/) { $pkg = "main$pkg" if $pkg =~ /^::/; $pkg = "main::$pkg" unless $pkg =~ /^main::/; $pkg .= '::' unless $pkg =~ /::$/; } my($stem, $leaf) = $pkg =~ m/(.*::)(\w+::)$/; no strict 'refs'; my $stem_symtab = *{$stem}{HASH}; return unless defined $stem_symtab and exists $stem_symtab->{$leaf}; # free all the symbols in the package my $leaf_symtab = *{$stem_symtab->{$leaf}}{HASH}; foreach my $name (keys %$leaf_symtab) { undef *{$pkg . $name}; } use strict 'refs'; # delete the symbol table %$leaf_symtab = (); delete $stem_symtab->{$leaf}; } 1; FILE!a90b71ff/Tie/Hash/NamedCapture.pm.use strict; package Tie::Hash::NamedCapture; our $VERSION = "0.13"; __END__ =head1 NAME Tie::Hash::NamedCapture - Named regexp capture buffers =head1 SYNOPSIS tie my %hash, "Tie::Hash::NamedCapture"; # %hash now behaves like %+ tie my %hash, "Tie::Hash::NamedCapture", all => 1; # %hash now access buffers from regexp in $qr like %- =head1 DESCRIPTION This module is used to implement the special hashes C<%+> and C<%->, but it can be used to tie other variables as you choose. When the C parameter is provided, then the tied hash elements will be array refs listing the contents of each capture buffer whose name is the same as the associated hash key. If none of these buffers were involved in the match, the contents of that array ref will be as many C values as there are capture buffers with that name. In other words, the tied hash will behave as C<%->. When the C parameter is omitted or false, then the tied hash elements will be the contents of the leftmost defined buffer with the name of the associated hash key. In other words, the tied hash will behave as C<%+>. The keys of C<%->-like hashes correspond to all buffer names found in the regular expression; the keys of C<%+>-like hashes list only the names of buffers that have captured (and that are thus associated to defined values). This implementation has been moved into the core executable, but you can still load this module for backward compatibility. =head1 SEE ALSO L, L, L, L, L. =cut FILE47a0bad1/Time/Local.pmCxpackage Time::Local; use strict; use Carp (); use Exporter; our $VERSION = '1.35'; use parent 'Exporter'; our @EXPORT = qw( timegm timelocal ); our @EXPORT_OK = qw( timegm_modern timelocal_modern timegm_nocheck timelocal_nocheck timegm_posix timelocal_posix ); my @MonthDays = ( 31, 28, 31, 30, 31, 30, 31, 31, 30, 31, 30, 31 ); # Determine breakpoint for rolling century my $ThisYear = ( localtime() )[5]; my $Breakpoint = ( $ThisYear + 50 ) % 100; my $NextCentury = $ThisYear - $ThisYear % 100; $NextCentury += 100 if $Breakpoint < 50; my $Century = $NextCentury - 100; my $SecOff = 0; my ( %Options, %Cheat ); use constant SECS_PER_MINUTE => 60; use constant SECS_PER_HOUR => 3600; use constant SECS_PER_DAY => 86400; my $MaxDay; if ( $] < 5.012000 ) { require Config; ## no critic (Variables::ProhibitPackageVars) my $MaxInt; if ( $^O eq 'MacOS' ) { # time_t is unsigned... $MaxInt = ( 1 << ( 8 * $Config::Config{ivsize} ) ) - 1; ## no critic qw(ProhibitPackageVars) } else { $MaxInt = ( ( 1 << ( 8 * $Config::Config{ivsize} - 2 ) ) - 1 ) * 2 + 1; ## no critic qw(ProhibitPackageVars) } $MaxDay = int( ( $MaxInt - ( SECS_PER_DAY / 2 ) ) / SECS_PER_DAY ) - 1; } else { # recent localtime()'s limit is the year 2**31 $MaxDay = 365 * ( 2**31 ); # On (some?) 32-bit platforms this overflows and we end up with a negative # $MaxDay, which totally breaks this module. This is the old calculation # we used from the days before Perl always had 64-bit time_t. if ( $MaxDay < 0 ) { require Config; ## no critic (Variables::ProhibitPackageVars) my $max_int = ( ( 1 << ( 8 * $Config::Config{intsize} - 2 ) ) - 1 ) * 2 + 1; $MaxDay = int( ( $max_int - ( SECS_PER_DAY / 2 ) ) / SECS_PER_DAY ) - 1; } } # Determine the EPOC day for this machine my $Epoc = 0; if ( $^O eq 'vos' ) { # work around posix-977 -- VOS doesn't handle dates in the range # 1970-1980. $Epoc = _daygm( 0, 0, 0, 1, 0, 70, 4, 0 ); } elsif ( $^O eq 'MacOS' ) { $MaxDay *= 2; # time_t unsigned ... quick hack? # MacOS time() is seconds since 1 Jan 1904, localtime # so we need to calculate an offset to apply later $Epoc = 693901; $SecOff = timelocal( localtime(0) ) - timelocal( gmtime(0) ); $Epoc += _daygm( gmtime(0) ); } else { $Epoc = _daygm( gmtime(0) ); } %Cheat = (); # clear the cache as epoc has changed sub _daygm { # This is written in such a byzantine way in order to avoid # lexical variables and sub calls, for speed return $_[3] + ( $Cheat{ pack( 'ss', @_[ 4, 5 ] ) } ||= do { my $month = ( $_[4] + 10 ) % 12; my $year = $_[5] + 1900 - int( $month / 10 ); ( ( 365 * $year ) + int( $year / 4 ) - int( $year / 100 ) + int( $year / 400 ) + int( ( ( $month * 306 ) + 5 ) / 10 ) ) - $Epoc; } ); } sub _timegm { my $sec = $SecOff + $_[0] + ( SECS_PER_MINUTE * $_[1] ) + ( SECS_PER_HOUR * $_[2] ); return $sec + ( SECS_PER_DAY * &_daygm ); } sub timegm { my ( $sec, $min, $hour, $mday, $month, $year ) = @_; my $subsec = $sec - int($sec); $sec = int($sec); if ( $Options{no_year_munging} ) { $year -= 1900; } elsif ( !$Options{posix_year} ) { if ( $year >= 1000 ) { $year -= 1900; } elsif ( $year < 100 and $year >= 0 ) { $year += ( $year > $Breakpoint ) ? $Century : $NextCentury; } } unless ( $Options{no_range_check} ) { Carp::croak("Month '$month' out of range 0..11") if $month > 11 or $month < 0; my $md = $MonthDays[$month]; ++$md if $month == 1 && _is_leap_year( $year + 1900 ); Carp::croak("Day '$mday' out of range 1..$md") if $mday > $md or $mday < 1; Carp::croak("Hour '$hour' out of range 0..23") if $hour > 23 or $hour < 0; Carp::croak("Minute '$min' out of range 0..59") if $min > 59 or $min < 0; Carp::croak("Second '$sec' out of range 0..59") if $sec >= 60 or $sec < 0; } my $days = _daygm( undef, undef, undef, $mday, $month, $year ); if ( abs($days) > $MaxDay && !$Options{no_range_check} ) { my $msg = "Day too big - abs($days) > $MaxDay\n"; $year += 1900; $msg .= "Cannot handle date ($sec, $min, $hour, $mday, $month, $year)"; Carp::croak($msg); } # Adding in the $subsec value last seems to prevent floating point errors # from creeping in. return ( ( $sec + $SecOff + ( SECS_PER_MINUTE * $min ) + ( SECS_PER_HOUR * $hour ) + ( SECS_PER_DAY * $days ) ) + $subsec ); } sub _is_leap_year { return 0 if $_[0] % 4; return 1 if $_[0] % 100; return 0 if $_[0] % 400; return 1; } sub timegm_nocheck { local $Options{no_range_check} = 1; return &timegm; } sub timegm_modern { local $Options{no_year_munging} = 1; return &timegm; } sub timegm_posix { local $Options{posix_year} = 1; return &timegm; } sub timelocal { my $sec = shift; my $subsec = $sec - int($sec); $sec = int($sec); unshift @_, $sec; my $ref_t = &timegm; my $loc_for_ref_t = _timegm( localtime($ref_t) ); my $zone_off = $loc_for_ref_t - $ref_t or return $loc_for_ref_t + $subsec; # Adjust for timezone my $loc_t = $ref_t - $zone_off; # Are we close to a DST change or are we done my $dst_off = $ref_t - _timegm( localtime($loc_t) ); # If this evaluates to true, it means that the value in $loc_t is # the _second_ hour after a DST change where the local time moves # backward. if ( !$dst_off && ( ( $ref_t - SECS_PER_HOUR ) - _timegm( localtime( $loc_t - SECS_PER_HOUR ) ) < 0 ) ) { return ( $loc_t - SECS_PER_HOUR ) + $subsec; } # Adjust for DST change $loc_t += $dst_off; return $loc_t + $subsec if $dst_off > 0; # If the original date was a non-existent gap in a forward DST jump, we # should now have the wrong answer - undo the DST adjustment my ( $s, $m, $h ) = localtime($loc_t); $loc_t -= $dst_off if $s != $_[0] || $m != $_[1] || $h != $_[2]; return $loc_t + $subsec; } sub timelocal_nocheck { local $Options{no_range_check} = 1; return &timelocal; } sub timelocal_modern { local $Options{no_year_munging} = 1; return &timelocal; } sub timelocal_posix { local $Options{posix_year} = 1; return &timelocal; } 1; # ABSTRACT: Efficiently compute time from local and GMT time __END__ =pod =encoding UTF-8 =head1 NAME Time::Local - Efficiently compute time from local and GMT time =head1 VERSION version 1.35 =head1 SYNOPSIS use Time::Local qw( timelocal_posix timegm_posix ); my $time = timelocal_posix( $sec, $min, $hour, $mday, $mon, $year ); my $time = timegm_posix( $sec, $min, $hour, $mday, $mon, $year ); =head1 DESCRIPTION This module provides functions that are the inverse of built-in perl functions C and C. They accept a date as a six-element array, and return the corresponding C value in seconds since the system epoch (Midnight, January 1, 1970 GMT on Unix, for example). This value can be positive or negative, though POSIX only requires support for positive values, so dates before the system's epoch may not work on all operating systems. It is worth drawing particular attention to the expected ranges for the values provided. The value for the day of the month is the actual day (i.e. 1..31), while the month is the number of months since January (0..11). This is consistent with the values returned from C and C. =head1 FUNCTIONS =head2 C and C I These functions are the exact inverse of Perl's built-in C and C functions. That means that calling C<< timelocal_posix( localtime($value) ) >> will always give you the same C<$value> you started with. The same applies to C<< timegm_posix( gmtime($value) ) >>. The one exception is when the value returned from C represents an ambiguous local time because of a DST change. See the documentation below for more details. These functions expect the year value to be the number of years since 1900, which is what the C and C built-ins returns. They perform range checking by default on the input C<$sec>, C<$min>, C<$hour>, C<$mday>, and C<$mon> values and will croak (using C) if given a value outside the allowed ranges. While it would be nice to make this the default behavior, that would almost certainly break a lot of code, so you must explicitly import these functions and use them instead of the default C and C. You are B encouraged to use these functions in any new code which uses this module. It will almost certainly make your code's behavior less surprising. =head2 C and C I When C was first written, it was a common practice to represent years as a two-digit value like C<99> for C<1999> or C<1> for C<2001>. This caused all sorts of problems (google "Y2K problem" if you're very young) and developers eventually realized that this was a terrible idea. The default exports of C and C do a complicated calculation when given a year value less than 1000. This leads to surprising results in many cases. See L for details. The C functions do not do this year munging and simply take the year value as provided. They perform range checking by default on the input C<$sec>, C<$min>, C<$hour>, C<$mday>, and C<$mon> values and will croak (using C) if given a value outside the allowed ranges. =head2 C and C This module exports two functions by default, C and C. They perform range checking by default on the input C<$sec>, C<$min>, C<$hour>, C<$mday>, and C<$mon> values and will croak (using C) if given a value outside the allowed ranges. B or C<*_modern> functions if possible.> =head2 C and C If you are working with data you know to be valid, you can use the "nocheck" variants, C and C. These variants must be explicitly imported. If you supply data which is not valid (month 27, second 1,000) the results will be unpredictable (so don't do that). Note that my benchmarks show that this is just a 3% speed increase over the checked versions, so unless calling C is the hottest spot in your application, using these nocheck variants is unlikely to have much impact on your application. =head2 Year Value Interpretation B or C<*_modern> functions. Use those exports if you want to ensure consistent behavior as your code ages.> Strictly speaking, the year should be specified in a form consistent with C, i.e. the offset from 1900. In order to make the interpretation of the year easier for humans, however, who are more accustomed to seeing years as two-digit or four-digit values, the following conventions are followed: =over 4 =item * Years greater than 999 are interpreted as being the actual year, rather than the offset from 1900. Thus, 1964 would indicate the year Martin Luther King won the Nobel prize, not the year 3864. =item * Years in the range 100..999 are interpreted as offset from 1900, so that 112 indicates 2012. This rule also applies to years less than zero (but see note below regarding date range). =item * Years in the range 0..99 are interpreted as shorthand for years in the rolling "current century," defined as 50 years on either side of the current year. Thus, today, in 1999, 0 would refer to 2000, and 45 to 2045, but 55 would refer to 1955. Twenty years from now, 55 would instead refer to 2055. This is messy, but matches the way people currently think about two digit dates. Whenever possible, use an absolute four digit year instead. =back The scheme above allows interpretation of a wide range of dates, particularly if 4-digit years are used. But it also means that the behavior of your code changes as time passes, because the rolling "current century" changes each year. =head2 Limits of time_t On perl versions older than 5.12.0, the range of dates that can be actually be handled depends on the size of C (usually a signed integer) on the given platform. Currently, this is 32 bits for most systems, yielding an approximate range from Dec 1901 to Jan 2038. Both C and C croak if given dates outside the supported range. As of version 5.12.0, perl has stopped using the time implementation of the operating system it's running on. Instead, it has its own implementation of those routines with a safe range of at least +/- 2**52 (about 142 million years) =head2 Ambiguous Local Times (DST) Because of DST changes, there are many time zones where the same local time occurs for two different GMT times on the same day. For example, in the "Europe/Paris" time zone, the local time of 2001-10-28 02:30:00 can represent either 2001-10-28 00:30:00 GMT, B 2001-10-28 01:30:00 GMT. When given an ambiguous local time, the timelocal() function will always return the epoch for the I of the two possible GMT times. =head2 Non-Existent Local Times (DST) When a DST change causes a locale clock to skip one hour forward, there will be an hour's worth of local times that don't exist. Again, for the "Europe/Paris" time zone, the local clock jumped from 2001-03-25 01:59:59 to 2001-03-25 03:00:00. If the C function is given a non-existent local time, it will simply return an epoch value for the time one hour later. =head2 Negative Epoch Values On perl version 5.12.0 and newer, negative epoch values are fully supported. On older versions of perl, negative epoch (C) values, which are not officially supported by the POSIX standards, are known not to work on some systems. These include MacOS (pre-OSX) and Win32. On systems which do support negative epoch values, this module should be able to cope with dates before the start of the epoch, down the minimum value of time_t for the system. =head1 IMPLEMENTATION These routines are quite efficient and yet are always guaranteed to agree with C and C. We manage this by caching the start times of any months we've seen before. If we know the start time of the month, we can always calculate any time within the month. The start times are calculated using a mathematical formula. Unlike other algorithms that do multiple calls to C. The C function is implemented using the same cache. We just assume that we're translating a GMT time, and then fudge it when we're done for the timezone and daylight savings arguments. Note that the timezone is evaluated for each date because countries occasionally change their official timezones. Assuming that C corrects for these changes, this routine will also be correct. =head1 AUTHORS EMERITUS This module is based on a Perl 4 library, timelocal.pl, that was included with Perl 4.036, and was most likely written by Tom Christiansen. The current version was written by Graham Barr. =head1 BUGS The whole scheme for interpreting two-digit years can be considered a bug. Bugs may be submitted at L. There is a mailing list available for users of this distribution, L. =head1 SOURCE The source code repository for Time-Local can be found at L. =head1 AUTHOR Dave Rolsky =head1 CONTRIBUTORS =for stopwords Florian Ragwitz Gregory Oschwald J. Nick Koston Tom Wyant Unknown =over 4 =item * Florian Ragwitz =item * Gregory Oschwald =item * J. Nick Koston =item * Tom Wyant =item * Unknown =back =head1 COPYRIGHT AND LICENSE This software is copyright (c) 1997 - 2023 by Graham Barr & Dave Rolsky. This is free software; you can redistribute it and/or modify it under the same terms as the Perl 5 programming language system itself. The full text of the license can be found in the F file included with this distribution. =cut FILE092d256d/XSLoader.pm,^# Generated from XSLoader_pm.PL (resolved %Config::Config value) # This file is unique for every OS use strict; no strict 'refs'; package XSLoader; our $VERSION = "0.32"; # remember to update version in POD! package DynaLoader; # No prizes for guessing why we don't say 'bootstrap DynaLoader;' here. # NOTE: All dl_*.xs (including dl_none.xs) define a dl_error() XSUB boot_DynaLoader('DynaLoader') if defined(&boot_DynaLoader) && !defined(&dl_error); package XSLoader; sub load { package DynaLoader; my ($caller, $modlibname) = caller(); my $module = $caller; if (@_) { $module = $_[0]; } else { $_[0] = $module; } # work with static linking too my $boots = "$module\::bootstrap"; goto &$boots if defined &$boots; goto \&XSLoader::bootstrap_inherit; my @modparts = split(/::/,$module); my $modfname = $modparts[-1]; my $modfname_orig = $modfname; # For .bs file search my $modpname = join('/',@modparts); my $c = () = split(/::/,$caller,-1); $modlibname =~ s,[\\/][^\\/]+$,, while $c--; # Q&D basename # Does this look like a relative path? if ($modlibname !~ m{^/}) { # Someone may have a #line directive that changes the file name, or # may be calling XSLoader::load from inside a string eval. We cer- # tainly do not want to go loading some code that is not in @INC, # as it could be untrusted. # # We could just fall back to DynaLoader here, but then the rest of # this function would go untested in the perl core, since all @INC # paths are relative during testing. That would be a time bomb # waiting to happen, since bugs could be introduced into the code. # # So look through @INC to see if $modlibname is in it. A rela- # tive $modlibname is not a common occurrence, so this block is # not hot code. FOUND: { for (@INC) { if ($_ eq $modlibname) { last FOUND; } } # Not found. Fall back to DynaLoader. goto \&XSLoader::bootstrap_inherit; } } my $file = "$modlibname/auto/$modpname/$modfname.so"; # print STDERR "XSLoader::load for $module ($file)\n" if $dl_debug; # N.B. The .bs file does not following the naming convention used # by mod2fname, so use the unedited version of the name. my $bs = "$modlibname/auto/$modpname/$modfname_orig.bs"; # This calls DynaLoader::bootstrap, which will load the .bs file if present goto \&XSLoader::bootstrap_inherit if not -f $file or -s $bs; my $bootname = "boot_$module"; $bootname =~ s/\W/_/g; @DynaLoader::dl_require_symbols = ($bootname); my $boot_symbol_ref; # Many dynamic extension loading problems will appear to come from # this section of code: XYZ failed at line 123 of DynaLoader.pm. # Often these errors are actually occurring in the initialisation # C code of the extension XS file. Perl reports the error as being # in this perl code simply because this was the last perl code # it executed. my $libref = dl_load_file($file, 0) or do { require Carp; Carp::croak("Can't load '$file' for module $module: " . dl_error()); }; push(@DynaLoader::dl_librefs,$libref); # record loaded object $boot_symbol_ref = dl_find_symbol($libref, $bootname) or do { require Carp; Carp::croak("Can't find '$bootname' symbol in $file\n"); }; push(@DynaLoader::dl_modules, $module); # record loaded module boot: my $xs = dl_install_xsub($boots, $boot_symbol_ref, $file); # See comment block above push(@DynaLoader::dl_shared_objects, $file); # record files loaded return &$xs(@_); } # Can't test with DynaLoader->can('bootstrap_inherit') when building in the # core, as XSLoader gets built before DynaLoader. sub bootstrap_inherit { require DynaLoader; goto \&DynaLoader::bootstrap_inherit; } 1; __END__ =head1 NAME XSLoader - Dynamically load C libraries into Perl code =head1 VERSION Version 0.32 =head1 SYNOPSIS package YourPackage; require XSLoader; XSLoader::load(__PACKAGE__, $VERSION); =head1 DESCRIPTION This module defines a standard I interface to the dynamic linking mechanisms available on many platforms. Its primary purpose is to implement cheap automatic dynamic loading of Perl modules. For a more complicated interface, see L. Many (most) features of C are not implemented in C, like for example the C, not honored by C. =head2 Migration from C A typical module using L starts like this: package YourPackage; require DynaLoader; our @ISA = qw( OnePackage OtherPackage DynaLoader ); our $VERSION = '0.01'; __PACKAGE__->bootstrap($VERSION); Change this to package YourPackage; use XSLoader; our @ISA = qw( OnePackage OtherPackage ); our $VERSION = '0.01'; XSLoader::load(__PACKAGE__, $VERSION); In other words: replace C by C, remove C from C<@ISA>, change C by C. Do not forget to quote the name of your package on the C line, and add comma (C<,>) before the arguments (C<$VERSION> above). Of course, if C<@ISA> contained only C, there is no need to have the C<@ISA> assignment at all; moreover, if instead of C one uses the more backward-compatible use vars qw($VERSION @ISA); one can remove this reference to C<@ISA> together with the C<@ISA> assignment. If no C<$VERSION> was specified on the C line, the last line becomes XSLoader::load(__PACKAGE__); in which case it can be further simplified to XSLoader::load(); as C will use C to determine the package. =head2 Backward compatible boilerplate If you want to have your cake and eat it too, you need a more complicated boilerplate. package YourPackage; our @ISA = qw( OnePackage OtherPackage ); our $VERSION = '0.01'; eval { require XSLoader; XSLoader::load(__PACKAGE__, $VERSION); 1; } or do { require DynaLoader; push @ISA, 'DynaLoader'; __PACKAGE__->bootstrap($VERSION); }; The parentheses about C arguments are needed since we replaced C by C, so the compiler does not know that a function C is present. This boilerplate uses the low-overhead C if present; if used with an antique Perl which has no C, it falls back to using C. =head1 Order of initialization: early load() I section in your XS file (see L). What is described here is equally applicable to the L interface.> A sufficiently complicated module using XS would have both Perl code (defined in F) and XS code (defined in F). If this Perl code makes calls into this XS code, and/or this XS code makes calls to the Perl code, one should be careful with the order of initialization. The call to C (or C) calls the module's bootstrap code. For modules build by F (nearly all modules) this has three side effects: =over =item * A sanity check is done to ensure that the versions of the F<.pm> and the (compiled) F<.xs> parts are compatible. If C<$VERSION> was specified, this is used for the check. If not specified, it defaults to C<$XS_VERSION // $VERSION> (in the module's namespace) =item * the XSUBs are made accessible from Perl =item * if a C section was present in the F<.xs> file, the code there is called. =back Consequently, if the code in the F<.pm> file makes calls to these XSUBs, it is convenient to have XSUBs installed before the Perl code is defined; for example, this makes prototypes for XSUBs visible to this Perl code. Alternatively, if the C section makes calls to Perl functions (or uses Perl variables) defined in the F<.pm> file, they must be defined prior to the call to C (or C). The first situation being much more frequent, it makes sense to rewrite the boilerplate as package YourPackage; use XSLoader; our ($VERSION, @ISA); BEGIN { @ISA = qw( OnePackage OtherPackage ); $VERSION = '0.01'; # Put Perl code used in the BOOT: section here XSLoader::load(__PACKAGE__, $VERSION); } # Put Perl code making calls into XSUBs here =head2 The most hairy case If the interdependence of your C section and Perl code is more complicated than this (e.g., the C section makes calls to Perl functions which make calls to XSUBs with prototypes), get rid of the C section altogether. Replace it with a function C, and call it like this: package YourPackage; use XSLoader; our ($VERSION, @ISA); BEGIN { @ISA = qw( OnePackage OtherPackage ); $VERSION = '0.01'; XSLoader::load(__PACKAGE__, $VERSION); } # Put Perl code used in onBOOT() function here; calls to XSUBs are # prototype-checked. onBOOT; # Put Perl initialization code assuming that XS is initialized here =head1 DIAGNOSTICS =over =item C B<(F)> The bootstrap symbol could not be found in the extension module. =item C B<(F)> The loading or initialisation of the extension module failed. The detailed error follows. =item C B<(W)> As the message says, some symbols stay undefined although the extension module was correctly loaded and initialised. The list of undefined symbols follows. =back =head1 LIMITATIONS To reduce the overhead as much as possible, only one possible location is checked to find the extension DLL (this location is where C would put the DLL). If not found, the search for the DLL is transparently delegated to C, which looks for the DLL along the C<@INC> list. In particular, this is applicable to the structure of C<@INC> used for testing not-yet-installed extensions. This means that running uninstalled extensions may have much more overhead than running the same extensions after C. =head1 KNOWN BUGS The new simpler way to call C with no arguments at all does not work on Perl 5.8.4 and 5.8.5. =head1 BUGS Please report any bugs or feature requests via the perlbug(1) utility. =head1 SEE ALSO L =head1 AUTHORS Ilya Zakharevich originally extracted C from C. CPAN version is currently maintained by SEbastien Aperghis-Tramoni Esebastien@aperghis.netE. Previous maintainer was Michael G Schwern . =head1 COPYRIGHT & LICENSE Copyright (C) 1990-2011 by Larry Wall and others. This program is free software; you can redistribute it and/or modify it under the same terms as Perl itself. =cut FILE65b9a8f7/base.pm*use 5.008; package base; use strict 'vars'; our $VERSION = '2.27'; $VERSION =~ tr/_//d; # simplest way to avoid indexing of the package: no package statement sub base::__inc::unhook { @INC = grep !(ref eq 'CODE' && $_ == $_[0]), @INC } # instance is blessed array of coderefs to be removed from @INC at scope exit sub base::__inc::scope_guard::DESTROY { base::__inc::unhook $_ for @{$_[0]} } # constant.pm is slow sub SUCCESS () { 1 } sub PUBLIC () { 2**0 } sub PRIVATE () { 2**1 } sub INHERITED () { 2**2 } sub PROTECTED () { 2**3 } my $Fattr = \%fields::attr; sub has_fields { my($base) = shift; my $fglob = ${"$base\::"}{FIELDS}; return( ($fglob && 'GLOB' eq ref($fglob) && *$fglob{HASH}) ? 1 : 0 ); } sub has_attr { my($proto) = shift; my($class) = ref $proto || $proto; return exists $Fattr->{$class}; } sub get_attr { $Fattr->{$_[0]} = [1] unless $Fattr->{$_[0]}; return $Fattr->{$_[0]}; } if ($] < 5.009) { *get_fields = sub { # Shut up a possible typo warning. () = \%{$_[0].'::FIELDS'}; my $f = \%{$_[0].'::FIELDS'}; # should be centralized in fields? perhaps # fields::mk_FIELDS_be_OK. Peh. As long as %{ $package . '::FIELDS' } # is used here anyway, it doesn't matter. bless $f, 'pseudohash' if (ref($f) ne 'pseudohash'); return $f; } } else { *get_fields = sub { # Shut up a possible typo warning. () = \%{$_[0].'::FIELDS'}; return \%{$_[0].'::FIELDS'}; } } if ($] < 5.008) { *_module_to_filename = sub { (my $fn = $_[0]) =~ s!::!/!g; $fn .= '.pm'; return $fn; } } else { *_module_to_filename = sub { (my $fn = $_[0]) =~ s!::!/!g; $fn .= '.pm'; utf8::encode($fn); return $fn; } } sub import { my $class = shift; return SUCCESS unless @_; # List of base classes from which we will inherit %FIELDS. my $fields_base; my $inheritor = caller(0); my @bases; foreach my $base (@_) { if ( $inheritor eq $base ) { warn "Class '$inheritor' tried to inherit from itself\n"; } next if grep $_->isa($base), ($inheritor, @bases); # Following blocks help isolate $SIG{__DIE__} and @INC changes { my $sigdie; { local $SIG{__DIE__}; my $fn = _module_to_filename($base); my $dot_hidden; eval { my $guard; if ($INC[-1] eq '.' && %{"$base\::"}) { # So: the package already exists => this an optional load # And: there is a dot at the end of @INC => we want to hide it # However: we only want to hide it during our *own* require() # (i.e. without affecting nested require()s). # So we add a hook to @INC whose job is to hide the dot, but which # first checks checks the callstack depth, because within nested # require()s the callstack is deeper. # Since CORE::GLOBAL::require makes it unknowable in advance what # the exact relevant callstack depth will be, we have to record it # inside a hook. So we put another hook just for that at the front # of @INC, where it's guaranteed to run -- immediately. # The dot-hiding hook does its job by sitting directly in front of # the dot and removing itself from @INC when reached. This causes # the dot to move up one index in @INC, causing the loop inside # pp_require() to skip it. # Loaded coded may disturb this precise arrangement, but that's OK # because the hook is inert by that time. It is only active during # the top-level require(), when @INC is in our control. The only # possible gotcha is if other hooks already in @INC modify @INC in # some way during that initial require(). # Note that this jiggery hookery works just fine recursively: if # a module loaded via base.pm uses base.pm itself, there will be # one pair of hooks in @INC per base::import call frame, but the # pairs from different nestings do not interfere with each other. my $lvl; unshift @INC, sub { return if defined $lvl; 1 while defined caller ++$lvl; () }; splice @INC, -1, 0, sub { return if defined caller $lvl; ++$dot_hidden, &base::__inc::unhook; () }; $guard = bless [ @INC[0,-2] ], 'base::__inc::scope_guard'; } require $fn }; if ($dot_hidden && (my @fn = grep -e && !( -d _ || -b _ ), $fn.'c', $fn)) { require Carp; Carp::croak(<]*> (?:line|chunk) [0-9]+)?\.\n\z/s || $@ =~ /Compilation failed in require at .* line [0-9]+(?:, <[^>]*> (?:line|chunk) [0-9]+)?\.\n\z/; unless (%{"$base\::"}) { require Carp; local $" = " "; Carp::croak(<[0] = @$battr; if( keys %$dfields ) { warn <<"END"; $derived is inheriting from $base but already has its own fields! This will cause problems. Be sure you use base BEFORE declaring fields. END } # Iterate through the base's fields adding all the non-private # ones to the derived class. Hang on to the original attribute # (Public, Private, etc...) and add Inherited. # This is all too complicated to do efficiently with add_fields(). while (my($k,$v) = each %$bfields) { my $fno; if ($fno = $dfields->{$k} and $fno != $v) { require Carp; Carp::croak ("Inherited fields can't override existing fields"); } if( $battr->[$v] & PRIVATE ) { $dattr->[$v] = PRIVATE | INHERITED; } else { $dattr->[$v] = INHERITED | $battr->[$v]; $dfields->{$k} = $v; } } foreach my $idx (1..$#{$battr}) { next if defined $dattr->[$idx]; $dattr->[$idx] = $battr->[$idx] & INHERITED; } } 1; __END__ =head1 NAME base - Establish an ISA relationship with base classes at compile time =head1 SYNOPSIS package Baz; use base qw(Foo Bar); =head1 DESCRIPTION Unless you are using the C pragma, consider this module discouraged in favor of the lighter-weight C. Allows you to both load one or more modules, while setting up inheritance from those modules at the same time. Roughly similar in effect to package Baz; BEGIN { require Foo; require Bar; push @ISA, qw(Foo Bar); } When C tries to C a module, it will not die if it cannot find the module's file, but will die on any other error. After all this, should your base class be empty, containing no symbols, C will die. This is useful for inheriting from classes in the same file as yourself but where the filename does not match the base module name, like so: # in Bar.pm package Foo; sub exclaim { "I can have such a thing?!" } package Bar; use base "Foo"; There is no F, but because C defines a symbol (the C subroutine), C will not die when the C fails to load F. C will also initialize the fields if one of the base classes has it. Multiple inheritance of fields is B supported, if two or more base classes each have inheritable fields the 'base' pragma will croak. See L for a description of this feature. The base class' C method is B called. =head1 DIAGNOSTICS =over 4 =item Base class package "%s" is empty. base.pm was unable to require the base package, because it was not found in your path. =item Class 'Foo' tried to inherit from itself Attempting to inherit from yourself generates a warning. package Foo; use base 'Foo'; =back =head1 HISTORY This module was introduced with Perl 5.004_04. =head1 CAVEATS Due to the limitations of the implementation, you must use base I you declare any of your own fields. =head1 SEE ALSO L =cut FILE4b3cab84/builtin.pm>package builtin 0.019; use v5.40; # All code, including &import, is implemented by always-present # functions in the perl interpreter itself. # See also `builtin.c` in perl source __END__ =head1 NAME builtin - Perl pragma to import built-in utility functions =head1 SYNOPSIS use builtin qw( true false is_bool inf nan weaken unweaken is_weak blessed refaddr reftype created_as_string created_as_number stringify ceil floor indexed trim is_tainted export_lexically load_module ); use builtin ':5.40'; # most of the above =head1 DESCRIPTION Perl provides several utility functions in the C package. These are plain functions, and look and behave just like regular user-defined functions do. They do not provide new syntax or require special parsing. These functions are always present in the interpreter and can be called at any time by their fully-qualified names. By default they are not available as short names, but can be requested for convenience. Individual named functions can be imported by listing them as import parameters on the C statement for this pragma. The L module from CPAN provides versions of many of these functions that can be used on Perl versions where C or specific functions are not yet available. B: At present, many of the functions in the C namespace are experimental. Calling them will trigger warnings of the C category. =head2 Lexical Import This pragma module creates I aliases in the currently-compiling scope to these builtin functions. This is similar to the lexical effect of other pragmas such as L and L. sub classify { my $val = shift; use builtin 'is_bool'; return is_bool($val) ? "boolean" : "not a boolean"; } # the is_bool() function is no longer visible here # but may still be called by builtin::is_bool() Because these functions are imported lexically, rather than by package symbols, the user does not need to take any special measures to ensure they don't accidentally appear as object methods from a class. package An::Object::Class { use builtin 'true', 'false'; ... } # does not appear as a method An::Object::Class->true; # Can't locate object method "true" via package "An::Object::Class" # at ... Once imported, a lexical function is much like any other lexical symbol (such as a variable) in that it cannot be removed again. If you wish to limit the visiblity of an imported C function, put it inside its own scope: { use builtin 'refaddr'; ... } =head2 Version Bundles The entire set of builtin functions that were considered non-experimental by a version of perl can be imported all at once, by requesting a version bundle. This is done by giving the perl release version (without its subversion suffix) after a colon character: use builtin ':5.40'; The following bundles currently exist: Version Includes ------- -------- :5.40 true false weaken unweaken is_weak blessed refaddr reftype ceil floor is_tainted trim indexed =head2 Function Optimisations There are a number of optimisations that apply to functions in the L package. If you replace or override these functions (such as by assignment into glob references) the optimisations may not take effect. Do so with caution. =head1 FUNCTIONS =head2 true $val = true; Returns the boolean truth value. While any scalar value can be tested for truth and most defined, non-empty and non-zero values are considered "true" by perl, this one is special in that L considers it to be a distinguished boolean value. This gives an equivalent value to expressions like C or C. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 false $val = false; Returns the boolean false value. While any non-true scalar value is considered "false" by perl, this one is special in that L considers it to be a distinguished boolean value. This gives an equivalent value to expressions like C or C. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 is_bool $bool = is_bool($val); This function is currently B. Returns true when given a distinguished boolean value, or false if not. A distinguished boolean value is the result of any boolean-returning builtin function (such as C or C itself), boolean-returning operator (such as the C or C<==> comparison tests or the C negation operator), or any variable containing one of these results. This function used to be named C. A compatibility alias is provided currently but will be removed in a later version. Available starting with Perl 5.36. =head2 inf $num = inf; This function is currently B. Returns the floating-point infinity value. If the underlying numeric C type does not support such a value, it throws a runtime error instead. Available starting with Perl 5.40. =head2 nan $num = nan; This function is currently B. Returns the floating-point "Not-a-Number" value. If the underlying numeric C type does not support such a value, it throws a runtime error instead. Available starting with Perl 5.40. =head2 weaken weaken($ref); Weakens a reference. A weakened reference does not contribute to the reference count of its referent. If only weakened references to a referent remain, it will be disposed of, and all remaining weak references to it will have their value set to C. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 unweaken unweaken($ref); Strengthens a reference, undoing the effects of a previous call to L. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 is_weak $bool = is_weak($ref); Returns true when given a weakened reference, or false if not a reference or not weak. This function used to be named C. A compatibility alias is provided currently but will be removed in a later version. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 blessed $str = blessed($ref); Returns the package name for an object reference, or C for a non-reference or reference that is not an object. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 refaddr $num = refaddr($ref); Returns the memory address for a reference, or C for a non-reference. This value is not likely to be very useful for pure Perl code, but is handy as a means to test for referential identity or uniqueness. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 reftype $str = reftype($ref); Returns the basic container type of the referent of a reference, or C for a non-reference. This is returned as a string in all-capitals, such as C for array references, or C for hash references. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 created_as_string $bool = created_as_string($val); This function is currently B. Returns a boolean representing if the argument value was originally created as a string. It will return true for any scalar expression whose most recent assignment or modification was of a string-like nature - such as assignment from a string literal, or the result of a string operation such as concatenation or regexp. It will return false for references (including any object), numbers, booleans and undef. It is unlikely that you will want to use this for regular data validation within Perl, as it will not return true for regular numbers that are still perfectly usable as strings, nor for any object reference - especially objects that overload the stringification operator in an attempt to behave more like strings. For example my $val = URI->new( "https://metacpan.org/" ); if( created_as_string $val ) { ... } # this will not execute Available starting with Perl 5.36. =head2 created_as_number $bool = created_as_number($val); This function is currently B. Returns a boolean representing if the argument value was originally created as a number. It will return true for any scalar expression whose most recent assignment or modification was of a numerical nature - such as assignment from a number literal, or the result of a numerical operation such as addition. It will return false for references (including any object), strings, booleans and undef. It is unlikely that you will want to use this for regular data validation within Perl, as it will not return true for regular strings of decimal digits that are still perfectly usable as numbers, nor for any object reference - especially objects that overload the numification operator in an attempt to behave more like numbers. For example my $val = Math::BigInt->new( 123 ); if( created_as_number $val ) { ... } # this will not execute While most Perl code should operate on scalar values without needing to know their creation history, these two functions are intended to be used by data serialisation modules such as JSON encoders or similar situations, where language interoperability concerns require making a distinction between values that are fundamentally stringlike versus numberlike in nature. Available starting with Perl 5.36. =head2 stringify $str = stringify($val); This function is currently B. Returns a new plain perl string that represents the given argument. When given a value that is already a string, a copy of this value is returned unchanged. False booleans are treated like the empty string. Numbers are turned into a decimal representation. True booleans are treated like the number 1. References to objects in classes that have L and define the C<""> overload entry will use the delegated method to provide a value here. Non-object references, or references to objects in classes without a C<""> overload will return a string that names the underlying container type of the reference, its memory address, and possibly its class name if it is an object. Available starting with Perl 5.40. =head2 ceil $num = ceil($num); Returns the smallest integer value greater than or equal to the given numerical argument. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 floor $num = floor($num); Returns the largest integer value less than or equal to the given numerical argument. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 indexed @ivpairs = indexed(@items) Returns an even-sized list of number/value pairs, where each pair is formed of a number giving an index in the original list followed by the value at that position in it. I.e. returns a list twice the size of the original, being equal to (0, $items[0], 1, $items[1], 2, $items[2], ...) Note that unlike the core C function, this function returns copies of its original arguments, not aliases to them. Any modifications of these copies are I reflected in modifications to the original. my @x = ...; $_++ for indexed @x; # The @x array remains unaffected This function is primarily intended to be useful combined with multi-variable C loop syntax; as foreach my ($index, $value) (indexed LIST) { ... } In scalar context this function returns the size of the list that it would otherwise have returned, and provokes a warning in the C category. Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 trim $stripped = trim($string); Returns the input string with whitespace stripped from the beginning and end. trim() will remove these characters: " ", an ordinary space. "\t", a tab. "\n", a new line (line feed). "\r", a carriage return. and all other Unicode characters that are flagged as whitespace. A complete list is in L. $var = " Hello world "; # "Hello world" $var = "\t\t\tHello world"; # "Hello world" $var = "Hello world\n"; # "Hello world" $var = "\x{2028}Hello world\x{3000}"; # "Hello world" C is equivalent to: my $trimmed = $str =~ s/\A\s+//ur =~ s/\s+\z//ur; Available starting with Perl 5.36. Since Perl 5.40, it is no longer experimental and it is included in the 5.40 and higher builtin version bundles. =head2 is_tainted $bool = is_tainted($var); Returns true when given a tainted variable. Available starting with Perl 5.38. =head2 export_lexically export_lexically($name1, $ref1, $name2, $ref2, ...) This function is currently B. Exports new lexical names into the scope currently being compiled. Names given by the first of each pair of values will refer to the corresponding item whose reference is given by the second. Types of item that are permitted are subroutines, and scalar, array, and hash variables. If the item is a subroutine, the name may optionally be prefixed with the C<&> sigil, but for convenience it doesn't have to. For items that are variables the sigil is required, and must match the type of the variable. export_lexically func => \&func, '&func' => \&func; # same as above export_lexically '$scalar' => \my $var; Z<> # The following are not permitted export_lexically '$var' => \@arr; # sigil does not match export_lexically name => \$scalar; # implied '&' sigil does not match export_lexically '*name' => \*globref; # globrefs are not supported This must be called at compile time; which typically means during a C block. Usually this would be used as part of an C method of a module, when invoked as part of a C statement. Available starting with Perl 5.38. =head2 load_module load_module($module_name); This function is currently B. Loads a named module from the inclusion paths (C<@INC>). C<$module_name> must be a string that provides a module name. It cannot be omitted, and providing an invalid module name will result in an exception. Not providing any argument results in a compilation error. Returns the loaded module's name on success. The effect of C-ing a module is mostly the same as C-ing, down to the same error conditions when the module does not exist, does not compile, or does not evaluate to a true value. See also L feature|feature/"The 'module_true' feature">. C can't be used to require a particular version of Perl, nor can it be given a bareword module name as an argument. Available starting with Perl 5.40. =head1 SEE ALSO L, L, L, L FILE9d46b03d/bytes.pmpackage bytes 1.09; use v5.38; BEGIN { $bytes::hint_bits = 0x0000_0008 } sub import { $^H |= $bytes::hint_bits } sub unimport { $^H &= ~$bytes::hint_bits } sub chr :prototype(_) { BEGIN { import() } &CORE::chr } sub index :prototype($$;$) { BEGIN { import() } &CORE::index } sub length :prototype(_) { BEGIN { import() } &CORE::length } sub ord :prototype(_) { BEGIN { import() } &CORE::ord } sub rindex :prototype($$;$) { BEGIN { import() } &CORE::rindex } sub substr :prototype($$;$$) { BEGIN { import() } &CORE::substr } __END__ =head1 NAME bytes - Perl pragma to expose the individual bytes of characters =head1 NOTICE Because the bytes pragma breaks encapsulation (i.e. it exposes the innards of how the perl executable currently happens to store a string), the byte values that result are in an unspecified encoding. B If you feel that the functions here within might be useful for your application, this possibly indicates a mismatch between your mental model of Perl Unicode and the current reality. In that case, you may wish to read some of the perl Unicode documentation: L, L, L and L. =head1 SYNOPSIS use bytes; ... chr(...); # or bytes::chr ... index(...); # or bytes::index ... length(...); # or bytes::length ... ord(...); # or bytes::ord ... rindex(...); # or bytes::rindex ... substr(...); # or bytes::substr no bytes; =head1 DESCRIPTION Perl's characters are stored internally as sequences of one or more bytes. This pragma allows for the examination of the individual bytes that together comprise a character. Originally the pragma was designed for the loftier goal of helping incorporate Unicode into Perl, but the approach that used it was found to be defective, and the one remaining legitimate use is for debugging when you need to non-destructively examine characters' individual bytes. Just insert this pragma temporarily, and remove it after the debugging is finished. The original usage can be accomplished by explicit (rather than this pragma's implicit) encoding using the L module: use Encode qw/encode/; my $utf8_byte_string = encode "UTF8", $string; my $latin1_byte_string = encode "Latin1", $string; Or, if performance is needed and you are only interested in the UTF-8 representation: utf8::encode(my $utf8_byte_string = $string); C can be used to reverse the effect of C within the current lexical scope. As an example, when Perl sees C<$x = chr(400)>, it encodes the character in UTF-8 and stores it in C<$x>. Then it is marked as character data, so, for instance, C returns C<1>. However, in the scope of the C pragma, C<$x> is treated as a series of bytes - the bytes that make up the UTF8 encoding - and C returns C<2>: $x = chr(400); print "Length is ", length $x, "\n"; # "Length is 1" printf "Contents are %vd\n", $x; # "Contents are 400" { use bytes; # or "require bytes; bytes::length()" print "Length is ", length $x, "\n"; # "Length is 2" printf "Contents are %vd\n", $x; # "Contents are 198.144 (on # ASCII platforms)" } C, C, C, C and C behave similarly. For more on the implications, see L and L. C is admittedly handy if you need to know the B of a Perl scalar. But a more modern way is: use Encode 'encode'; length(encode('UTF-8', $scalar)) =head1 LIMITATIONS C does not work as an I. =head1 SEE ALSO L, L, L, L FILEcd5536a3/constant.pm9package constant; use 5.008; use strict; use warnings::register; our $VERSION = '1.33'; our %declared; #======================================================================= # Some names are evil choices. my %keywords = map +($_, 1), qw{ BEGIN INIT CHECK END DESTROY AUTOLOAD }; $keywords{UNITCHECK}++ if $] > 5.009; my %forced_into_main = map +($_, 1), qw{ STDIN STDOUT STDERR ARGV ARGVOUT ENV INC SIG }; my %forbidden = (%keywords, %forced_into_main); my $normal_constant_name = qr/^_?[^\W_0-9]\w*\z/; my $tolerable = qr/^[A-Za-z_]\w*\z/; my $boolean = qr/^[01]?\z/; BEGIN { # We'd like to do use constant _CAN_PCS => $] > 5.009002 # but that's a bit tricky before we load the constant module :-) # By doing this, we save several run time checks for *every* call # to import. my $const = $] > 5.009002; my $downgrade = $] < 5.015004; # && $] >= 5.008 my $constarray = exists &_make_const; if ($const) { Internals::SvREADONLY($const, 1); Internals::SvREADONLY($downgrade, 1); $constant::{_CAN_PCS} = \$const; $constant::{_DOWNGRADE} = \$downgrade; $constant::{_CAN_PCS_FOR_ARRAY} = \$constarray; } else { no strict 'refs'; *{"_CAN_PCS"} = sub () {$const}; *{"_DOWNGRADE"} = sub () { $downgrade }; *{"_CAN_PCS_FOR_ARRAY"} = sub () { $constarray }; } } #======================================================================= # import() - import symbols into user's namespace # # What we actually do is define a function in the caller's namespace # which returns the value. The function we create will normally # be inlined as a constant, thereby avoiding further sub calling # overhead. #======================================================================= sub import { my $class = shift; return unless @_; # Ignore 'use constant;' my $constants; my $multiple = ref $_[0]; my $caller = caller; my $flush_mro; my $symtab; if (_CAN_PCS) { no strict 'refs'; $symtab = \%{$caller . '::'}; }; if ( $multiple ) { if (ref $_[0] ne 'HASH') { require Carp; Carp::croak("Invalid reference type '".ref(shift)."' not 'HASH'"); } $constants = shift; } else { unless (defined $_[0]) { require Carp; Carp::croak("Can't use undef as constant name"); } $constants->{+shift} = undef; } foreach my $name ( keys %$constants ) { my $pkg; my $symtab = $symtab; my $orig_name = $name; if ($name =~ s/(.*)(?:::|')(?=.)//s) { $pkg = $1; if (_CAN_PCS && $pkg ne $caller) { no strict 'refs'; $symtab = \%{$pkg . '::'}; } } else { $pkg = $caller; } # Normal constant name if ($name =~ $normal_constant_name and !$forbidden{$name}) { # Everything is okay # Name forced into main, but we're not in main. Fatal. } elsif ($forced_into_main{$name} and $pkg ne 'main') { require Carp; Carp::croak("Constant name '$name' is forced into main::"); # Starts with double underscore. Fatal. } elsif ($name =~ /^__/) { require Carp; Carp::croak("Constant name '$name' begins with '__'"); # Maybe the name is tolerable } elsif ($name =~ $tolerable) { # Then we'll warn only if you've asked for warnings if (warnings::enabled()) { if ($keywords{$name}) { warnings::warn("Constant name '$name' is a Perl keyword"); } elsif ($forced_into_main{$name}) { warnings::warn("Constant name '$name' is " . "forced into package main::"); } } # Looks like a boolean # use constant FRED == fred; } elsif ($name =~ $boolean) { require Carp; if (@_) { Carp::croak("Constant name '$name' is invalid"); } else { Carp::croak("Constant name looks like boolean value"); } } else { # Must have bad characters require Carp; Carp::croak("Constant name '$name' has invalid characters"); } { no strict 'refs'; my $full_name = "${pkg}::$name"; $declared{$full_name}++; if ($multiple || @_ == 1) { my $scalar = $multiple ? $constants->{$orig_name} : $_[0]; if (_DOWNGRADE) { # for 5.8 to 5.14 # Work around perl bug #31991: Sub names (actually glob # names in general) ignore the UTF8 flag. So we have to # turn it off to get the "right" symbol table entry. utf8::is_utf8 $name and utf8::encode $name; } # The constant serves to optimise this entire block out on # 5.8 and earlier. if (_CAN_PCS) { # Use a reference as a proxy for a constant subroutine. # If this is not a glob yet, it saves space. If it is # a glob, we must still create it this way to get the # right internal flags set, as constants are distinct # from subroutines created with sub(){...}. # The check in Perl_ck_rvconst knows that inlinable # constants from cv_const_sv are read only. So we have to: Internals::SvREADONLY($scalar, 1); if (!exists $symtab->{$name}) { $symtab->{$name} = \$scalar; ++$flush_mro->{$pkg}; } else { local $constant::{_dummy} = \$scalar; *$full_name = \&{"_dummy"}; } } else { *$full_name = sub () { $scalar }; } } elsif (@_) { my @list = @_; if (_CAN_PCS_FOR_ARRAY) { _make_const($list[$_]) for 0..$#list; _make_const(@list); if (!exists $symtab->{$name}) { $symtab->{$name} = \@list; $flush_mro->{$pkg}++; } else { local $constant::{_dummy} = \@list; *$full_name = \&{"_dummy"}; } } else { *$full_name = sub () { @list }; } } else { *$full_name = sub () { }; } } } # Flush the cache exactly once if we make any direct symbol table changes. if (_CAN_PCS && $flush_mro) { mro::method_changed_in($_) for keys %$flush_mro; } } 1; __END__ =head1 NAME constant - Perl pragma to declare constants =head1 SYNOPSIS use constant PI => 4 * atan2(1, 1); use constant DEBUG => 0; print "Pi equals ", PI, "...\n" if DEBUG; use constant { SEC => 0, MIN => 1, HOUR => 2, MDAY => 3, MON => 4, YEAR => 5, WDAY => 6, YDAY => 7, ISDST => 8, }; use constant WEEKDAYS => qw( Sunday Monday Tuesday Wednesday Thursday Friday Saturday ); print "Today is ", (WEEKDAYS)[ (localtime)[WDAY] ], ".\n"; =head1 DESCRIPTION This pragma allows you to declare constants at compile-time. When you declare a constant such as C using the method shown above, each machine your script runs upon can have as many digits of accuracy as it can use. Also, your program will be easier to read, more likely to be maintained (and maintained correctly), and far less likely to send a space probe to the wrong planet because nobody noticed the one equation in which you wrote C<3.14195>. When a constant is used in an expression, Perl replaces it with its value at compile time, and may then optimize the expression further. In particular, any code in an C block will be optimized away if the constant is false. =head1 NOTES As with all C directives, defining a constant happens at compile time. Thus, it's probably not correct to put a constant declaration inside of a conditional statement (like C). Constants defined using this module cannot be interpolated into strings like variables. However, concatenation works just fine: print "Pi equals PI...\n"; # WRONG: does not expand "PI" print "Pi equals ".PI."...\n"; # right Even though a reference may be declared as a constant, the reference may point to data which may be changed, as this code shows. use constant ARRAY => [ 1,2,3,4 ]; print ARRAY->[1]; ARRAY->[1] = " be changed"; print ARRAY->[1]; Constants belong to the package they are defined in. To refer to a constant defined in another package, specify the full package name, as in C. Constants may be exported by modules, and may also be called as either class or instance methods, that is, as C<< Some::Package->CONSTANT >> or as C<< $obj->CONSTANT >> where C<$obj> is an instance of C. Subclasses may define their own constants to override those in their base class. As of version 1.32 of this module, constants can be defined in packages other than the caller, by including the package name in the name of the constant: use constant "OtherPackage::FWIBBLE" => 7865; constant->import("Other::FWOBBLE",$value); # dynamically at run time The use of all caps for constant names is merely a convention, although it is recommended in order to make constants stand out and to help avoid collisions with other barewords, keywords, and subroutine names. Constant names must begin with a letter or underscore. Names beginning with a double underscore are reserved. Some poor choices for names will generate warnings, if warnings are enabled at compile time. =head2 List constants Constants may be lists of more (or less) than one value. A constant with no values evaluates to C in scalar context. Note that constants with more than one value do I return their last value in scalar context as one might expect. They currently return the number of values, but B. Do not use constants with multiple values in scalar context. B This implies that the expression defining the value of a constant is evaluated in list context. This may produce surprises: use constant TIMESTAMP => localtime; # WRONG! use constant TIMESTAMP => scalar localtime; # right The first line above defines C as a 9-element list, as returned by C in list context. To set it to the string returned by C in scalar context, an explicit C keyword is required. List constants are lists, not arrays. To index or slice them, they must be placed in parentheses. my @workdays = WEEKDAYS[1 .. 5]; # WRONG! my @workdays = (WEEKDAYS)[1 .. 5]; # right =head2 Defining multiple constants at once Instead of writing multiple C statements, you may define multiple constants in a single statement by giving, instead of the constant name, a reference to a hash where the keys are the names of the constants to be defined. Obviously, all constants defined using this method must have a single value. use constant { FOO => "A single value", BAR => "This", "won't", "work!", # Error! }; This is a fundamental limitation of the way hashes are constructed in Perl. The error messages produced when this happens will often be quite cryptic -- in the worst case there may be none at all, and you'll only later find that something is broken. When defining multiple constants, you cannot use the values of other constants defined in the same declaration. This is because the calling package doesn't know about any constant within that group until I the C statement is finished. use constant { BITMASK => 0xAFBAEBA8, NEGMASK => ~BITMASK, # Error! }; =head2 Magic constants Magical values and references can be made into constants at compile time, allowing for way cool stuff like this. (These error numbers aren't totally portable, alas.) use constant E2BIG => ($! = 7); print E2BIG, "\n"; # something like "Arg list too long" print 0+E2BIG, "\n"; # "7" You can't produce a tied constant by giving a tied scalar as the value. References to tied variables, however, can be used as constants without any problems. =head1 TECHNICAL NOTES In the current implementation, scalar constants are actually inlinable subroutines. As of version 5.004 of Perl, the appropriate scalar constant is inserted directly in place of some subroutine calls, thereby saving the overhead of a subroutine call. See L for details about how and when this happens. In the rare case in which you need to discover at run time whether a particular constant has been declared via this module, you may use this function to examine the hash C<%constant::declared>. If the given constant name does not include a package name, the current package is used. sub declared ($) { use constant 1.01; # don't omit this! my $name = shift; $name =~ s/^::/main::/; my $pkg = caller; my $full_name = $name =~ /::/ ? $name : "${pkg}::$name"; $constant::declared{$full_name}; } =head1 CAVEATS List constants are not inlined unless you are using Perl v5.20 or higher. In v5.20 or higher, they are still not read-only, but that may change in future versions. It is not possible to have a subroutine or a keyword with the same name as a constant in the same package. This is probably a Good Thing. A constant with a name in the list C is not allowed anywhere but in package C, for technical reasons. Unlike constants in some languages, these cannot be overridden on the command line or via environment variables. You can get into trouble if you use constants in a context which automatically quotes barewords (as is true for any subroutine call). For example, you can't say C<$hash{CONSTANT}> because C will be interpreted as a string. Use C<$hash{CONSTANT()}> or C<$hash{+CONSTANT}> to prevent the bareword quoting mechanism from kicking in. Similarly, since the C<< => >> operator quotes a bareword immediately to its left, you have to say C<< CONSTANT() => 'value' >> (or simply use a comma in place of the big arrow) instead of C<< CONSTANT => 'value' >>. =head1 SEE ALSO L - Facility for creating read-only scalars, arrays, hashes. L - Make read-only variables via attribute L - Perl extension to the C scalar flag L - A selection of general-utility hash subroutines (mostly to lock/unlock keys and values) =head1 BUGS Please report any bugs or feature requests via the perlbug(1) utility. =head1 AUTHORS Tom Phoenix, EFE, with help from many other folks. Multiple constant declarations at once added by Casey West, EFE. Documentation mostly rewritten by Ilmari Karonen, EFE. This program is maintained by the Perl 5 Porters. The CPAN distribution is maintained by SEbastien Aperghis-Tramoni EFE. =head1 COPYRIGHT & LICENSE Copyright (C) 1997, 1999 Tom Phoenix This module is free software; you can redistribute it or modify it under the same terms as Perl itself. =cut FILE2b6cef96/integer.pm package integer; our $VERSION = '1.01'; =head1 NAME integer - Perl pragma to use integer arithmetic instead of floating point =head1 SYNOPSIS use integer; $x = 10/3; # $x is now 3, not 3.33333333333333333 =head1 DESCRIPTION This tells the compiler to use integer operations from here to the end of the enclosing BLOCK. On many machines, this doesn't matter a great deal for most computations, but on those without floating point hardware, it can make a big difference in performance. Note that this only affects how most of the arithmetic and relational B handle their operands and results, and B how all numbers everywhere are treated. Specifically, C has the effect that before computing the results of the arithmetic operators (+, -, *, /, %, +=, -=, *=, /=, %=, and unary minus), the comparison operators (<, <=, >, >=, ==, !=, <=>), and the bitwise operators (|, &, ^, <<, >>, |=, &=, ^=, <<=, >>=), the operands have their fractional portions truncated (or floored), and the result will have its fractional portion truncated as well. In addition, the range of operands and results is restricted to that of familiar two's complement integers, i.e., -(2**31) .. (2**31-1) on 32-bit architectures, and -(2**63) .. (2**63-1) on 64-bit architectures. For example, this code use integer; $x = 5.8; $y = 2.5; $z = 2.7; $a = 2**31 - 1; # Largest positive integer on 32-bit machines $, = ", "; print $x, -$x, $x+$y, $x-$y, $x/$y, $x*$y, $y==$z, $a, $a+1; will print: 5.8, -5, 7, 3, 2, 10, 1, 2147483647, -2147483648 Note that $x is still printed as having its true non-integer value of 5.8 since it wasn't operated on. And note too the wrap-around from the largest positive integer to the largest negative one. Also, arguments passed to functions and the values returned by them are B affected by C. E.g., srand(1.5); $, = ", "; print sin(.5), cos(.5), atan2(1,2), sqrt(2), rand(10); will give the same result with or without C The power operator C<**> is also not affected, so that 2 ** .5 is always the square root of 2. Now, it so happens that the pre- and post- increment and decrement operators, ++ and --, are not affected by C either. Some may rightly consider this to be a bug -- but at least it's a long-standing one. Finally, C also has an additional affect on the bitwise operators. Normally, the operands and results are treated as B integers, but with C the operands and results are B. This means, among other things, that ~0 is -1, and -2 & -5 is -6. Internally, native integer arithmetic (as provided by your C compiler) is used. This means that Perl's own semantics for arithmetic operations may not be preserved. One common source of trouble is the modulus of negative numbers, which Perl does one way, but your hardware may do another. % perl -le 'print (4 % -3)' -2 % perl -Minteger -le 'print (4 % -3)' 1 See L, L =cut $integer::hint_bits = 0x1; sub import { $^H |= $integer::hint_bits; } sub unimport { $^H &= ~$integer::hint_bits; } 1; FILE28235a4c/overload.pmpackage overload; use strict; no strict 'refs'; our $VERSION = '1.40'; our %ops = ( with_assign => "+ - * / % ** << >> x .", assign => "+= -= *= /= %= **= <<= >>= x= .=", num_comparison => "< <= > >= == !=", '3way_comparison' => "<=> cmp", str_comparison => "lt le gt ge eq ne", binary => '& &= | |= ^ ^= &. &.= |. |.= ^. ^.=', unary => "neg ! ~ ~.", mutators => '++ --', func => "atan2 cos sin exp abs log sqrt int", conversion => 'bool "" 0+ qr', iterators => '<>', filetest => "-X", dereferencing => '${} @{} %{} &{} *{}', matching => '~~', special => 'nomethod fallback =', ); my %ops_seen; @ops_seen{ map split(/ /), values %ops } = (); sub nil {} sub OVERLOAD { my $package = shift; my %arg = @_; my $sub; *{$package . "::(("} = \&nil; # Make it findable via fetchmethod. for (keys %arg) { if ($_ eq 'fallback') { for my $sym (*{$package . "::()"}) { *$sym = \&nil; # Make it findable via fetchmethod. $$sym = $arg{$_}; } } else { warnings::warnif("overload arg '$_' is invalid") unless exists $ops_seen{$_}; $sub = $arg{$_}; if (not ref $sub) { $ {$package . "::(" . $_} = $sub; $sub = \&nil; } #print STDERR "Setting '$ {'package'}::\cO$_' to \\&'$sub'.\n"; *{$package . "::(" . $_} = \&{ $sub }; } } } sub import { my $package = caller(); # *{$package . "::OVERLOAD"} = \&OVERLOAD; shift; $package->overload::OVERLOAD(@_); } sub unimport { my $package = caller(); shift; *{$package . "::(("} = \&nil; for (@_) { warnings::warnif("overload arg '$_' is invalid") unless exists $ops_seen{$_}; delete $ {$package . "::"}{$_ eq 'fallback' ? '()' : "(" .$_}; } } sub Overloaded { my $package = shift; $package = ref $package if ref $package; mycan ($package, '()') || mycan ($package, '(('); } sub ov_method { my $globref = shift; return undef unless $globref; my $sub = \&{*$globref}; no overloading; return $sub if $sub != \&nil; return shift->can($ {*$globref}); } sub OverloadedStringify { my $package = shift; $package = ref $package if ref $package; #$package->can('(""') ov_method mycan($package, '(""'), $package or ov_method mycan($package, '(0+'), $package or ov_method mycan($package, '(bool'), $package or ov_method mycan($package, '(nomethod'), $package; } sub Method { my $package = shift; if (ref $package) { no warnings 'experimental::builtin'; $package = builtin::blessed($package); return undef if !defined $package; } #my $meth = $package->can('(' . shift); ov_method mycan($package, '(' . shift), $package; #return $meth if $meth ne \&nil; #return $ {*{$meth}}; } sub AddrRef { no overloading; "$_[0]"; } *StrVal = *AddrRef; sub mycan { # Real can would leave stubs. my ($package, $meth) = @_; local $@; local $!; require mro; my $mro = mro::get_linear_isa($package); foreach my $p (@$mro) { my $fqmeth = $p . q{::} . $meth; return \*{$fqmeth} if defined &{$fqmeth}; } return undef; } my %constants = ( 'integer' => 0x1000, # HINT_NEW_INTEGER 'float' => 0x2000, # HINT_NEW_FLOAT 'binary' => 0x4000, # HINT_NEW_BINARY 'q' => 0x8000, # HINT_NEW_STRING 'qr' => 0x10000, # HINT_NEW_RE ); use warnings::register; sub constant { # Arguments: what, sub while (@_) { if (@_ == 1) { warnings::warnif ("Odd number of arguments for overload::constant"); last; } elsif (!exists $constants {$_ [0]}) { warnings::warnif ("'$_[0]' is not an overloadable type"); } elsif (!ref $_ [1] || "$_[1]" !~ /(^|=)CODE\(0x[0-9a-f]+\)$/) { # Can't use C above as code references can be # blessed, and C would return the package the ref is blessed into. if (warnings::enabled) { $_ [1] = "undef" unless defined $_ [1]; warnings::warn ("'$_[1]' is not a code reference"); } } else { $^H{$_[0]} = $_[1]; $^H |= $constants{$_[0]}; } shift, shift; } } sub remove_constant { # Arguments: what, sub while (@_) { delete $^H{$_[0]}; $^H &= ~ $constants{$_[0]}; shift, shift; } } 1; __END__ =head1 NAME overload - Package for overloading Perl operations =head1 SYNOPSIS package SomeThing; use overload '+' => \&myadd, '-' => \&mysub; # etc ... package main; $a = SomeThing->new( 57 ); $b = 5 + $a; ... if (overload::Overloaded $b) {...} ... $strval = overload::StrVal $b; =head1 DESCRIPTION This pragma allows overloading of Perl's operators for a class. To overload built-in functions, see L instead. =head2 Fundamentals =head3 Declaration Arguments of the C directive are (key, value) pairs. For the full set of legal keys, see L below. Operator implementations (the values) can be subroutines, references to subroutines, or anonymous subroutines - in other words, anything legal inside a C<&{ ... }> call. Values specified as strings are interpreted as method names. Thus package Number; use overload "-" => "minus", "*=" => \&muas, '""' => sub { ...; }; declares that subtraction is to be implemented by method C in the class C (or one of its base classes), and that the function C is to be used for the assignment form of multiplication, C<*=>. It also defines an anonymous subroutine to implement stringification: this is called whenever an object blessed into the package C is used in a string context (this subroutine might, for example, return the number as a Roman numeral). =head3 Calling Conventions and Magic Autogeneration The following sample implementation of C (which assumes that C objects are simply blessed references to scalars) illustrates the calling conventions: package Number; sub minus { my ($self, $other, $swap) = @_; my $result = $$self - $other; # * $result = -$result if $swap; ref $result ? $result : bless \$result; } # * may recurse once - see table below Three arguments are passed to all subroutines specified in the C directive (with exceptions - see below, particularly L). The first of these is the operand providing the overloaded operator implementation - in this case, the object whose C method is being called. The second argument is the other operand, or C in the case of a unary operator. The third argument is set to TRUE if (and only if) the two operands have been swapped. Perl may do this to ensure that the first argument (C<$self>) is an object implementing the overloaded operation, in line with general object calling conventions. For example, if C<$x> and C<$y> are Cs: operation | generates a call to ============|====================== $x - $y | minus($x, $y, '') $x - 7 | minus($x, 7, '') 7 - $x | minus($x, 7, 1) Perl may also use C to implement other operators which have not been specified in the C directive, according to the rules for L described later. For example, the C above declared no subroutine for any of the operators C<-->, C (the overload key for unary minus), or C<-=>. Thus operation | generates a call to ============|====================== -$x | minus($x, 0, 1) $x-- | minus($x, 1, undef) $x -= 3 | minus($x, 3, undef) Note the Cs: where autogeneration results in the method for a standard operator which does not change either of its operands, such as C<->, being used to implement an operator which changes the operand ("mutators": here, C<--> and C<-=>), Perl passes undef as the third argument. This still evaluates as FALSE, consistent with the fact that the operands have not been swapped, but gives the subroutine a chance to alter its behaviour in these cases. In all the above examples, C is required only to return the result of the subtraction: Perl takes care of the assignment to $x. In fact, such methods should I modify their operands, even if C is passed as the third argument (see L). The same is not true of implementations of C<++> and C<-->: these are expected to modify their operand. An appropriate implementation of C<--> might look like use overload '--' => "decr", # ... sub decr { --${$_[0]}; } If the "bitwise" feature is enabled (see L), a fifth TRUE argument is passed to subroutines handling C<&>, C<|>, C<^> and C<~>. This indicates that the caller is expecting numeric behaviour. The fourth argument will be C, as that position (C<$_[3]>) is reserved for use by L. =head3 Mathemagic, Mutators, and Copy Constructors The term 'mathemagic' describes the overloaded implementation of mathematical operators. Mathemagical operations raise an issue. Consider the code: $a = $b; --$a; If C<$a> and C<$b> are scalars then after these statements $a == $b - 1 An object, however, is a reference to blessed data, so if C<$a> and C<$b> are objects then the assignment C<$a = $b> copies only the reference, leaving C<$a> and C<$b> referring to the same object data. One might therefore expect the operation C<--$a> to decrement C<$b> as well as C<$a>. However, this would not be consistent with how we expect the mathematical operators to work. Perl resolves this dilemma by transparently calling a copy constructor before calling a method defined to implement a mutator (C<-->, C<+=>, and so on.). In the above example, when Perl reaches the decrement statement, it makes a copy of the object data in C<$a> and assigns to C<$a> a reference to the copied data. Only then does it call C, which alters the copied data, leaving C<$b> unchanged. Thus the object metaphor is preserved as far as possible, while mathemagical operations still work according to the arithmetic metaphor. Note: the preceding paragraph describes what happens when Perl autogenerates the copy constructor for an object based on a scalar. For other cases, see L. =head2 Overloadable Operations The complete list of keys that can be specified in the C directive are given, separated by spaces, in the values of the hash C<%overload::ops>: with_assign => '+ - * / % ** << >> x .', assign => '+= -= *= /= %= **= <<= >>= x= .=', num_comparison => '< <= > >= == !=', '3way_comparison' => '<=> cmp', str_comparison => 'lt le gt ge eq ne', binary => '& &= | |= ^ ^= &. &.= |. |.= ^. ^.=', unary => 'neg ! ~ ~.', mutators => '++ --', func => 'atan2 cos sin exp abs log sqrt int', conversion => 'bool "" 0+ qr', iterators => '<>', filetest => '-X', dereferencing => '${} @{} %{} &{} *{}', matching => '~~', special => 'nomethod fallback =', Most of the overloadable operators map one-to-one to these keys. Exceptions, including additional overloadable operations not apparent from this hash, are included in the notes which follow. This list is subject to growth over time. A warning is issued if an attempt is made to register an operator not found above. =over 5 =item * C The operator C is not a valid key for C. However, if the operator C is overloaded then the same implementation will be used for C (since the two operators differ only in precedence). =item * C The key C is used for unary minus to disambiguate it from binary C<->. =item * C<++>, C<--> Assuming they are to behave analogously to Perl's C<++> and C<-->, overloaded implementations of these operators are required to mutate their operands. No distinction is made between prefix and postfix forms of the increment and decrement operators: these differ only in the point at which Perl calls the associated subroutine when evaluating an expression. =item * I += -= *= /= %= **= <<= >>= x= .= &= |= ^= &.= |.= ^.= Simple assignment is not overloadable (the C<'='> key is used for the L). Perl does have a way to make assignments to an object do whatever you want, but this involves using tie(), not overload - see L and the L examples below. The subroutine for the assignment variant of an operator is required only to return the result of the operation. It is permitted to change the value of its operand (this is safe because Perl calls the copy constructor first), but this is optional since Perl assigns the returned value to the left-hand operand anyway. An object that overloads an assignment operator does so only in respect of assignments to that object. In other words, Perl never calls the corresponding methods with the third argument (the "swap" argument) set to TRUE. For example, the operation $a *= $b cannot lead to C<$b>'s implementation of C<*=> being called, even if C<$a> is a scalar. (It can, however, generate a call to C<$b>'s method for C<*>). =item * I + - * / % ** << >> x . & | ^ &. |. ^. As described L, Perl may call methods for operators like C<+> and C<&> in the course of implementing missing operations like C<++>, C<+=>, and C<&=>. While these methods may detect this usage by testing the definedness of the third argument, they should in all cases avoid changing their operands. This is because Perl does not call the copy constructor before invoking these methods. =item * C Traditionally, the Perl function C rounds to 0 (see L), and so for floating-point-like types one should follow the same semantic. =item * I "" 0+ bool These conversions are invoked according to context as necessary. For example, the subroutine for C<'""'> (stringify) may be used where the overloaded object is passed as an argument to C, and that for C<'bool'> where it is tested in the condition of a flow control statement (like C) or the ternary C operation. Of course, in contexts like, for example, C<$obj + 1>, Perl will invoke C<$obj>'s implementation of C<+> rather than (in this example) converting C<$obj> to a number using the numify method C<'0+'> (an exception to this is when no method has been provided for C<'+'> and L is set to TRUE). The subroutines for C<'""'>, C<'0+'>, and C<'bool'> can return any arbitrary Perl value. If the corresponding operation for this value is overloaded too, the operation will be called again with this value. As a special case if the overload returns the object itself then it will be used directly. An overloaded conversion returning the object is probably a bug, because you're likely to get something that looks like C. qr The subroutine for C<'qr'> is used wherever the object is interpolated into or used as a regexp, including when it appears on the RHS of a C<=~> or C operator. C must return a compiled regexp, or a ref to a compiled regexp (such as C returns), and any further overloading on the return value will be ignored. =item * I If CE> is overloaded then the same implementation is used for both the I syntax C$varE> and I syntax C${var}E>. =item * I The key C<'-X'> is used to specify a subroutine to handle all the filetest operators (C<-f>, C<-x>, and so on: see L for the full list); it is not possible to overload any filetest operator individually. To distinguish them, the letter following the '-' is passed as the second argument (that is, in the slot that for binary operators is used to pass the second operand). Calling an overloaded filetest operator does not affect the stat value associated with the special filehandle C<_>. It still refers to the result of the last C, C or unoverloaded filetest. This overload was introduced in Perl 5.12. =item * I The key C<"~~"> allows you to override the smart matching logic used by the C<~~> operator and the switch construct (C/C). See L and L. Unusually, the overloaded implementation of the smart match operator does not get full control of the smart match behaviour. In particular, in the following code: package Foo; use overload '~~' => 'match'; my $obj = Foo->new(); $obj ~~ [ 1,2,3 ]; the smart match does I invoke the method call like this: $obj->match([1,2,3],0); rather, the smart match distributive rule takes precedence, so $obj is smart matched against each array element in turn until a match is found, so you may see between one and three of these calls instead: $obj->match(1,0); $obj->match(2,0); $obj->match(3,0); Consult the match table in L for details of when overloading is invoked. =item * I ${} @{} %{} &{} *{} If these operators are not explicitly overloaded then they work in the normal way, yielding the underlying scalar, array, or whatever stores the object data (or the appropriate error message if the dereference operator doesn't match it). Defining a catch-all C<'nomethod'> (see L) makes no difference to this as the catch-all function will not be called to implement a missing dereference operator. If a dereference operator is overloaded then it must return a I of the appropriate type (for example, the subroutine for key C<'${}'> should return a reference to a scalar, not a scalar), or another object which overloads the operator: that is, the subroutine only determines what is dereferenced and the actual dereferencing is left to Perl. As a special case, if the subroutine returns the object itself then it will not be called again - avoiding infinite recursion. =item * I nomethod fallback = See L>. =back =head2 Magic Autogeneration If a method for an operation is not found then Perl tries to autogenerate a substitute implementation from the operations that have been defined. Note: the behaviour described in this section can be disabled by setting C to FALSE (see L). In the following tables, numbers indicate priority. For example, the table below states that, if no implementation for C<'!'> has been defined then Perl will implement it using C<'bool'> (that is, by inverting the value returned by the method for C<'bool'>); if boolean conversion is also unimplemented then Perl will use C<'0+'> or, failing that, C<'""'>. operator | can be autogenerated from | | 0+ "" bool . x =========|========================== 0+ | 1 2 "" | 1 2 bool | 1 2 int | 1 2 3 ! | 2 3 1 qr | 2 1 3 . | 2 1 3 x | 2 1 3 .= | 3 2 4 1 x= | 3 2 4 1 <> | 2 1 3 -X | 2 1 3 Note: The iterator (C<'EE'>) and file test (C<'-X'>) operators work as normal: if the operand is not a blessed glob or IO reference then it is converted to a string (using the method for C<'""'>, C<'0+'>, or C<'bool'>) to be interpreted as a glob or filename. operator | can be autogenerated from | | < <=> neg -= - =========|========================== neg | 1 -= | 1 -- | 1 2 abs | a1 a2 b1 b2 [*] < | 1 <= | 1 > | 1 >= | 1 == | 1 != | 1 * one from [a1, a2] and one from [b1, b2] Just as numeric comparisons can be autogenerated from the method for C<< '<=>' >>, string comparisons can be autogenerated from that for C<'cmp'>: operators | can be autogenerated from ====================|=========================== lt gt le ge eq ne | cmp Similarly, autogeneration for keys C<'+='> and C<'++'> is analogous to C<'-='> and C<'--'> above: operator | can be autogenerated from | | += + =========|========================== += | 1 ++ | 1 2 And other assignment variations are analogous to C<'+='> and C<'-='> (and similar to C<'.='> and C<'x='> above): operator || *= /= %= **= <<= >>= &= ^= |= &.= ^.= |.= -------------------||------------------------------------------- autogenerated from || * / % ** << >> & ^ | &. ^. |. Note also that the copy constructor (key C<'='>) may be autogenerated, but only for objects based on scalars. See L. =head3 Minimal Set of Overloaded Operations Since some operations can be automatically generated from others, there is a minimal set of operations that need to be overloaded in order to have the complete set of overloaded operations at one's disposal. Of course, the autogenerated operations may not do exactly what the user expects. The minimal set is: + - * / % ** << >> x <=> cmp & | ^ ~ &. |. ^. ~. atan2 cos sin exp log sqrt int "" 0+ bool ~~ Of the conversions, only one of string, boolean or numeric is needed because each can be generated from either of the other two. =head2 Special Keys for C =head3 C The C<'nomethod'> key is used to specify a catch-all function to be called for any operator that is not individually overloaded. The specified function will be passed four parameters. The first three arguments coincide with those that would have been passed to the corresponding method if it had been defined. The fourth argument is the C key for that missing method. If the "bitwise" feature is enabled (see L), a fifth TRUE argument is passed to subroutines handling C<&>, C<|>, C<^> and C<~> to indicate that the caller is expecting numeric behaviour. For example, if C<$a> is an object blessed into a package declaring use overload 'nomethod' => 'catch_all', # ... then the operation 3 + $a could (unless a method is specifically declared for the key C<'+'>) result in a call catch_all($a, 3, 1, '+') See L. =head3 C The value assigned to the key C<'fallback'> tells Perl how hard it should try to find an alternative way to implement a missing operator. =over =item * defined, but FALSE use overload "fallback" => 0, # ... ; This disables L. =item * C In the default case where no value is explicitly assigned to C, magic autogeneration is enabled. =item * TRUE The same as for C, but if a missing operator cannot be autogenerated then, instead of issuing an error message, Perl is allowed to revert to what it would have done for that operator if there had been no C directive. Note: in most cases, particularly the L, this is unlikely to be appropriate behaviour. =back See L. =head3 Copy Constructor As mentioned L, this operation is called when a mutator is applied to a reference that shares its object with some other reference. For example, if C<$b> is mathemagical, and C<'++'> is overloaded with C<'incr'>, and C<'='> is overloaded with C<'clone'>, then the code $a = $b; # ... (other code which does not modify $a or $b) ... ++$b; would be executed in a manner equivalent to $a = $b; # ... $b = $b->clone(undef, ""); $b->incr(undef, ""); Note: =over =item * The subroutine for C<'='> does not overload the Perl assignment operator: it is used only to allow mutators to work as described here. (See L above.) =item * As for other operations, the subroutine implementing '=' is passed three arguments, though the last two are always C and C<''>. =item * The copy constructor is called only before a call to a function declared to implement a mutator, for example, if C<++$b;> in the code above is effected via a method declared for key C<'++'> (or 'nomethod', passed C<'++'> as the fourth argument) or, by autogeneration, C<'+='>. It is not called if the increment operation is effected by a call to the method for C<'+'> since, in the equivalent code, $a = $b; $b = $b + 1; the data referred to by C<$a> is unchanged by the assignment to C<$b> of a reference to new object data. =item * The copy constructor is not called if Perl determines that it is unnecessary because there is no other reference to the data being modified. =item * If C<'fallback'> is undefined or TRUE then a copy constructor can be autogenerated, but only for objects based on scalars. In other cases it needs to be defined explicitly. Where an object's data is stored as, for example, an array of scalars, the following might be appropriate: use overload '=' => sub { bless [ @{$_[0]} ] }, # ... =item * If C<'fallback'> is TRUE and no copy constructor is defined then, for objects not based on scalars, Perl may silently fall back on simple assignment - that is, assignment of the object reference. In effect, this disables the copy constructor mechanism since no new copy of the object data is created. This is almost certainly not what you want. (It is, however, consistent: for example, Perl's fallback for the C<++> operator is to increment the reference itself.) =back =head2 How Perl Chooses an Operator Implementation Which is checked first, C or C? If the two operands of an operator are of different types and both overload the operator, which implementation is used? The following are the precedence rules: =over =item 1. If the first operand has declared a subroutine to overload the operator then use that implementation. =item 2. Otherwise, if fallback is TRUE or undefined for the first operand then see if the L allows another of its operators to be used instead. =item 3. Unless the operator is an assignment (C<+=>, C<-=>, etc.), repeat step (1) in respect of the second operand. =item 4. Repeat Step (2) in respect of the second operand. =item 5. If the first operand has a "nomethod" method then use that. =item 6. If the second operand has a "nomethod" method then use that. =item 7. If C is TRUE for both operands then perform the usual operation for the operator, treating the operands as numbers, strings, or booleans as appropriate for the operator (see note). =item 8. Nothing worked - die. =back Where there is only one operand (or only one operand with overloading) the checks in respect of the other operand above are skipped. There are exceptions to the above rules for dereference operations (which, if Step 1 fails, always fall back to the normal, built-in implementations - see Dereferencing), and for C<~~> (which has its own set of rules - see C under L above). Note on Step 7: some operators have a different semantic depending on the type of their operands. As there is no way to instruct Perl to treat the operands as, e.g., numbers instead of strings, the result here may not be what you expect. See L. =head2 Losing Overloading The restriction for the comparison operation is that even if, for example, C should return a blessed reference, the autogenerated C function will produce only a standard logical value based on the numerical value of the result of C. In particular, a working numeric conversion is needed in this case (possibly expressed in terms of other conversions). Similarly, C<.=> and C operators lose their mathemagical properties if the string conversion substitution is applied. When you chop() a mathemagical object it is promoted to a string and its mathemagical properties are lost. The same can happen with other operations as well. =head2 Inheritance and Overloading Overloading respects inheritance via the @ISA hierarchy. Inheritance interacts with overloading in two ways. =over =item Method names in the C directive If C in use overload key => value; is a string, it is interpreted as a method name - which may (in the usual way) be inherited from another class. =item Overloading of an operation is inherited by derived classes Any class derived from an overloaded class is also overloaded and inherits its operator implementations. If the same operator is overloaded in more than one ancestor then the implementation is determined by the usual inheritance rules. For example, if C inherits from C and C (in that order), C overloads C<+> with C<\&D::plus_sub>, and C overloads C<+> by C<"plus_meth">, then the subroutine C will be called to implement operation C<+> for an object in package C. =back Note that in Perl version prior to 5.18 inheritance of the C key was not governed by the above rules. The value of C in the first overloaded ancestor was used. This was fixed in 5.18 to follow the usual rules of inheritance. =head2 Run-time Overloading Since all C directives are executed at compile-time, the only way to change overloading during run-time is to eval 'use overload "+" => \&addmethod'; You can also use eval 'no overload "+", "--", "<="'; though the use of these constructs during run-time is questionable. =head2 Public Functions Package C provides the following public functions: =over 5 =item overload::StrVal(arg) Gives the string value of C as in the absence of stringify overloading. If you are using this to get the address of a reference (useful for checking if two references point to the same thing) then you may be better off using C or C, which are faster. =item overload::Overloaded(arg) Returns true if C is subject to overloading of some operations. =item overload::Method(obj,op) Returns C or a reference to the method that implements C. Such a method always takes three arguments, which will be enforced if it is an XS method. =back =head2 Overloading Constants For some applications, the Perl parser mangles constants too much. It is possible to hook into this process via C and C functions. These functions take a hash as an argument. The recognized keys of this hash are: =over 8 =item integer to overload integer constants, =item float to overload floating point constants, =item binary to overload octal and hexadecimal constants, =item q to overload C-quoted strings, constant pieces of C- and C-quoted strings and here-documents, =item qr to overload constant pieces of regular expressions. =back The corresponding values are references to functions which take three arguments: the first one is the I string form of the constant, the second one is how Perl interprets this constant, the third one is how the constant is used. Note that the initial string form does not contain string delimiters, and has backslashes in backslash-delimiter combinations stripped (thus the value of delimiter is not relevant for processing of this string). The return value of this function is how this constant is going to be interpreted by Perl. The third argument is undefined unless for overloaded C- and C- constants, it is C in single-quote context (comes from strings, regular expressions, and single-quote HERE documents), it is C for arguments of C/C operators, it is C for right-hand side of C-operator, and it is C otherwise. Since an expression C<"ab$cd,,"> is just a shortcut for C<'ab' . $cd . ',,'>, it is expected that overloaded constant strings are equipped with reasonable overloaded catenation operator, otherwise absurd results will result. Similarly, negative numbers are considered as negations of positive constants. Note that it is probably meaningless to call the functions overload::constant() and overload::remove_constant() from anywhere but import() and unimport() methods. From these methods they may be called as sub import { shift; return unless @_; die "unknown import: @_" unless @_ == 1 and $_[0] eq ':constant'; overload::constant integer => sub {Math::BigInt->new(shift)}; } =head1 IMPLEMENTATION What follows is subject to change RSN. The table of methods for all operations is cached in magic for the symbol table hash for the package. The cache is invalidated during processing of C, C, new function definitions, and changes in @ISA. (Every SVish thing has a magic queue, and magic is an entry in that queue. This is how a single variable may participate in multiple forms of magic simultaneously. For instance, environment variables regularly have two forms at once: their %ENV magic and their taint magic. However, the magic which implements overloading is applied to the stashes, which are rarely used directly, thus should not slow down Perl.) If a package uses overload, it carries a special flag. This flag is also set when new functions are defined or @ISA is modified. There will be a slight speed penalty on the very first operation thereafter that supports overloading, while the overload tables are updated. If there is no overloading present, the flag is turned off. Thus the only speed penalty thereafter is the checking of this flag. It is expected that arguments to methods that are not explicitly supposed to be changed are constant (but this is not enforced). =head1 COOKBOOK Please add examples to what follows! =head2 Two-face Scalars Put this in F in your Perl library directory: package two_face; # Scalars with separate string and # numeric values. sub new { my $p = shift; bless [@_], $p } use overload '""' => \&str, '0+' => \&num, fallback => 1; sub num {shift->[1]} sub str {shift->[0]} Use it as follows: require two_face; my $seven = two_face->new("vii", 7); printf "seven=$seven, seven=%d, eight=%d\n", $seven, $seven+1; print "seven contains 'i'\n" if $seven =~ /i/; (The second line creates a scalar which has both a string value, and a numeric value.) This prints: seven=vii, seven=7, eight=8 seven contains 'i' =head2 Two-face References Suppose you want to create an object which is accessible as both an array reference and a hash reference. package two_refs; use overload '%{}' => \&gethash, '@{}' => sub { $ {shift()} }; sub new { my $p = shift; bless \ [@_], $p; } sub gethash { my %h; my $self = shift; tie %h, ref $self, $self; \%h; } sub TIEHASH { my $p = shift; bless \ shift, $p } my %fields; my $i = 0; $fields{$_} = $i++ foreach qw{zero one two three}; sub STORE { my $self = ${shift()}; my $key = $fields{shift()}; defined $key or die "Out of band access"; $$self->[$key] = shift; } sub FETCH { my $self = ${shift()}; my $key = $fields{shift()}; defined $key or die "Out of band access"; $$self->[$key]; } Now one can access an object using both the array and hash syntax: my $bar = two_refs->new(3,4,5,6); $bar->[2] = 11; $bar->{two} == 11 or die 'bad hash fetch'; Note several important features of this example. First of all, the I type of $bar is a scalar reference, and we do not overload the scalar dereference. Thus we can get the I non-overloaded contents of $bar by just using C<$$bar> (what we do in functions which overload dereference). Similarly, the object returned by the TIEHASH() method is a scalar reference. Second, we create a new tied hash each time the hash syntax is used. This allows us not to worry about a possibility of a reference loop, which would lead to a memory leak. Both these problems can be cured. Say, if we want to overload hash dereference on a reference to an object which is I as a hash itself, the only problem one has to circumvent is how to access this I hash (as opposed to the I hash exhibited by the overloaded dereference operator). Here is one possible fetching routine: sub access_hash { my ($self, $key) = (shift, shift); my $class = ref $self; bless $self, 'overload::dummy'; # Disable overloading of %{} my $out = $self->{$key}; bless $self, $class; # Restore overloading $out; } To remove creation of the tied hash on each access, one may an extra level of indirection which allows a non-circular structure of references: package two_refs1; use overload '%{}' => sub { ${shift()}->[1] }, '@{}' => sub { ${shift()}->[0] }; sub new { my $p = shift; my $a = [@_]; my %h; tie %h, $p, $a; bless \ [$a, \%h], $p; } sub gethash { my %h; my $self = shift; tie %h, ref $self, $self; \%h; } sub TIEHASH { my $p = shift; bless \ shift, $p } my %fields; my $i = 0; $fields{$_} = $i++ foreach qw{zero one two three}; sub STORE { my $a = ${shift()}; my $key = $fields{shift()}; defined $key or die "Out of band access"; $a->[$key] = shift; } sub FETCH { my $a = ${shift()}; my $key = $fields{shift()}; defined $key or die "Out of band access"; $a->[$key]; } Now if $baz is overloaded like this, then C<$baz> is a reference to a reference to the intermediate array, which keeps a reference to an actual array, and the access hash. The tie()ing object for the access hash is a reference to a reference to the actual array, so =over =item * There are no loops of references. =item * Both "objects" which are blessed into the class C are references to a reference to an array, thus references to a I. Thus the accessor expression C<$$foo-E[$ind]> involves no overloaded operations. =back =head2 Symbolic Calculator Put this in F in your Perl library directory: package symbolic; # Primitive symbolic calculator use overload nomethod => \&wrap; sub new { shift; bless ['n', @_] } sub wrap { my ($obj, $other, $inv, $meth) = @_; ($obj, $other) = ($other, $obj) if $inv; bless [$meth, $obj, $other]; } This module is very unusual as overloaded modules go: it does not provide any usual overloaded operators, instead it provides an implementation for C>. In this example the C subroutine returns an object which encapsulates operations done over the objects: C<< symbolic->new(3) >> contains C<['n', 3]>, C<< 2 + symbolic->new(3) >> contains C<['+', 2, ['n', 3]]>. Here is an example of the script which "calculates" the side of circumscribed octagon using the above package: require symbolic; my $iter = 1; # 2**($iter+2) = 8 my $side = symbolic->new(1); my $cnt = $iter; while ($cnt--) { $side = (sqrt(1 + $side**2) - 1)/$side; } print "OK\n"; The value of $side is ['/', ['-', ['sqrt', ['+', 1, ['**', ['n', 1], 2]], undef], 1], ['n', 1]] Note that while we obtained this value using a nice little script, there is no simple way to I this value. In fact this value may be inspected in debugger (see L), but only if C Bption is set, and not via C

command. If one attempts to print this value, then the overloaded operator C<""> will be called, which will call C operator. The result of this operator will be stringified again, but this result is again of type C, which will lead to an infinite loop. Add a pretty-printer method to the module F: sub pretty { my ($meth, $a, $b) = @{+shift}; $a = 'u' unless defined $a; $b = 'u' unless defined $b; $a = $a->pretty if ref $a; $b = $b->pretty if ref $b; "[$meth $a $b]"; } Now one can finish the script by print "side = ", $side->pretty, "\n"; The method C is doing object-to-string conversion, so it is natural to overload the operator C<""> using this method. However, inside such a method it is not necessary to pretty-print the I $a and $b of an object. In the above subroutine C<"[$meth $a $b]"> is a catenation of some strings and components $a and $b. If these components use overloading, the catenation operator will look for an overloaded operator C<.>; if not present, it will look for an overloaded operator C<"">. Thus it is enough to use use overload nomethod => \&wrap, '""' => \&str; sub str { my ($meth, $a, $b) = @{+shift}; $a = 'u' unless defined $a; $b = 'u' unless defined $b; "[$meth $a $b]"; } Now one can change the last line of the script to print "side = $side\n"; which outputs side = [/ [- [sqrt [+ 1 [** [n 1 u] 2]] u] 1] [n 1 u]] and one can inspect the value in debugger using all the possible methods. Something is still amiss: consider the loop variable $cnt of the script. It was a number, not an object. We cannot make this value of type C, since then the loop will not terminate. Indeed, to terminate the cycle, the $cnt should become false. However, the operator C for checking falsity is overloaded (this time via overloaded C<"">), and returns a long string, thus any object of type C is true. To overcome this, we need a way to compare an object to 0. In fact, it is easier to write a numeric conversion routine. Here is the text of F with such a routine added (and slightly modified str()): package symbolic; # Primitive symbolic calculator use overload nomethod => \&wrap, '""' => \&str, '0+' => \# sub new { shift; bless ['n', @_] } sub wrap { my ($obj, $other, $inv, $meth) = @_; ($obj, $other) = ($other, $obj) if $inv; bless [$meth, $obj, $other]; } sub str { my ($meth, $a, $b) = @{+shift}; $a = 'u' unless defined $a; if (defined $b) { "[$meth $a $b]"; } else { "[$meth $a]"; } } my %subr = ( n => sub {$_[0]}, sqrt => sub {sqrt $_[0]}, '-' => sub {shift() - shift()}, '+' => sub {shift() + shift()}, '/' => sub {shift() / shift()}, '*' => sub {shift() * shift()}, '**' => sub {shift() ** shift()}, ); sub num { my ($meth, $a, $b) = @{+shift}; my $subr = $subr{$meth} or die "Do not know how to ($meth) in symbolic"; $a = $a->num if ref $a eq __PACKAGE__; $b = $b->num if ref $b eq __PACKAGE__; $subr->($a,$b); } All the work of numeric conversion is done in %subr and num(). Of course, %subr is not complete, it contains only operators used in the example below. Here is the extra-credit question: why do we need an explicit recursion in num()? (Answer is at the end of this section.) Use this module like this: require symbolic; my $iter = symbolic->new(2); # 16-gon my $side = symbolic->new(1); my $cnt = $iter; while ($cnt) { $cnt = $cnt - 1; # Mutator '--' not implemented $side = (sqrt(1 + $side**2) - 1)/$side; } printf "%s=%f\n", $side, $side; printf "pi=%f\n", $side*(2**($iter+2)); It prints (without so many line breaks) [/ [- [sqrt [+ 1 [** [/ [- [sqrt [+ 1 [** [n 1] 2]]] 1] [n 1]] 2]]] 1] [/ [- [sqrt [+ 1 [** [n 1] 2]]] 1] [n 1]]]=0.198912 pi=3.182598 The above module is very primitive. It does not implement mutator methods (C<++>, C<-=> and so on), does not do deep copying (not required without mutators!), and implements only those arithmetic operations which are used in the example. To implement most arithmetic operations is easy; one should just use the tables of operations, and change the code which fills %subr to my %subr = ( 'n' => sub {$_[0]} ); foreach my $op (split " ", $overload::ops{with_assign}) { $subr{$op} = $subr{"$op="} = eval "sub {shift() $op shift()}"; } my @bins = qw(binary 3way_comparison num_comparison str_comparison); foreach my $op (split " ", "@overload::ops{ @bins }") { $subr{$op} = eval "sub {shift() $op shift()}"; } foreach my $op (split " ", "@overload::ops{qw(unary func)}") { print "defining '$op'\n"; $subr{$op} = eval "sub {$op shift()}"; } Since subroutines implementing assignment operators are not required to modify their operands (see L above), we do not need anything special to make C<+=> and friends work, besides adding these operators to %subr and defining a copy constructor (needed since Perl has no way to know that the implementation of C<'+='> does not mutate the argument - see L). To implement a copy constructor, add C<< '=' => \&cpy >> to C line, and code (this code assumes that mutators change things one level deep only, so recursive copying is not needed): sub cpy { my $self = shift; bless [@$self], ref $self; } To make C<++> and C<--> work, we need to implement actual mutators, either directly, or in C. We continue to do things inside C, thus add if ($meth eq '++' or $meth eq '--') { @$obj = ($meth, (bless [@$obj]), 1); # Avoid circular reference return $obj; } after the first line of wrap(). This is not a most effective implementation, one may consider sub inc { $_[0] = bless ['++', shift, 1]; } instead. As a final remark, note that one can fill %subr by my %subr = ( 'n' => sub {$_[0]} ); foreach my $op (split " ", $overload::ops{with_assign}) { $subr{$op} = $subr{"$op="} = eval "sub {shift() $op shift()}"; } my @bins = qw(binary 3way_comparison num_comparison str_comparison); foreach my $op (split " ", "@overload::ops{ @bins }") { $subr{$op} = eval "sub {shift() $op shift()}"; } foreach my $op (split " ", "@overload::ops{qw(unary func)}") { $subr{$op} = eval "sub {$op shift()}"; } $subr{'++'} = $subr{'+'}; $subr{'--'} = $subr{'-'}; This finishes implementation of a primitive symbolic calculator in 50 lines of Perl code. Since the numeric values of subexpressions are not cached, the calculator is very slow. Here is the answer for the exercise: In the case of str(), we need no explicit recursion since the overloaded C<.>-operator will fall back to an existing overloaded operator C<"">. Overloaded arithmetic operators I fall back to numeric conversion if C is not explicitly requested. Thus without an explicit recursion num() would convert C<['+', $a, $b]> to C<$a + $b>, which would just rebuild the argument of num(). If you wonder why defaults for conversion are different for str() and num(), note how easy it was to write the symbolic calculator. This simplicity is due to an appropriate choice of defaults. One extra note: due to the explicit recursion num() is more fragile than sym(): we need to explicitly check for the type of $a and $b. If components $a and $b happen to be of some related type, this may lead to problems. =head2 I Symbolic Calculator One may wonder why we call the above calculator symbolic. The reason is that the actual calculation of the value of expression is postponed until the value is I. To see it in action, add a method sub STORE { my $obj = shift; $#$obj = 1; @$obj->[0,1] = ('=', shift); } to the package C. After this change one can do my $a = symbolic->new(3); my $b = symbolic->new(4); my $c = sqrt($a**2 + $b**2); and the numeric value of $c becomes 5. However, after calling $a->STORE(12); $b->STORE(5); the numeric value of $c becomes 13. There is no doubt now that the module symbolic provides a I calculator indeed. To hide the rough edges under the hood, provide a tie()d interface to the package C. Add methods sub TIESCALAR { my $pack = shift; $pack->new(@_) } sub FETCH { shift } sub nop { } # Around a bug (the bug, fixed in Perl 5.14, is described in L<"BUGS">). One can use this new interface as tie $a, 'symbolic', 3; tie $b, 'symbolic', 4; $a->nop; $b->nop; # Around a bug my $c = sqrt($a**2 + $b**2); Now numeric value of $c is 5. After C<$a = 12; $b = 5> the numeric value of $c becomes 13. To insulate the user of the module add a method sub vars { my $p = shift; tie($_, $p), $_->nop foreach @_; } Now my ($a, $b); symbolic->vars($a, $b); my $c = sqrt($a**2 + $b**2); $a = 3; $b = 4; printf "c5 %s=%f\n", $c, $c; $a = 12; $b = 5; printf "c13 %s=%f\n", $c, $c; shows that the numeric value of $c follows changes to the values of $a and $b. =head1 AUTHOR Ilya Zakharevich EFE. =head1 SEE ALSO The C pragma can be used to enable or disable overloaded operations within a lexical scope - see L. =head1 DIAGNOSTICS When Perl is run with the B<-Do> switch or its equivalent, overloading induces diagnostic messages. Using the C command of Perl debugger (see L) one can deduce which operations are overloaded (and which ancestor triggers this overloading). Say, if C is overloaded, then the method C<(eq> is shown by debugger. The method C<()> corresponds to the C key (in fact a presence of this method shows that this package has overloading enabled, and it is what is used by the C function of module C). The module might issue the following warnings: =over 4 =item Odd number of arguments for overload::constant (W) The call to overload::constant contained an odd number of arguments. The arguments should come in pairs. =item '%s' is not an overloadable type (W) You tried to overload a constant type the overload package is unaware of. =item '%s' is not a code reference (W) The second (fourth, sixth, ...) argument of overload::constant needs to be a code reference. Either an anonymous subroutine, or a reference to a subroutine. =item overload arg '%s' is invalid (W) C was passed an argument it did not recognize. Did you mistype an operator? =back =head1 BUGS AND PITFALLS =over =item * A pitfall when fallback is TRUE and Perl resorts to a built-in implementation of an operator is that some operators have more than one semantic, for example C<|>: use overload '0+' => sub { $_[0]->{n}; }, fallback => 1; my $x = bless { n => 4 }, "main"; my $y = bless { n => 8 }, "main"; print $x | $y, "\n"; You might expect this to output "12". In fact, it prints "<": the ASCII result of treating "|" as a bitwise string operator - that is, the result of treating the operands as the strings "4" and "8" rather than numbers. The fact that numify (C<0+>) is implemented but stringify (C<"">) isn't makes no difference since the latter is simply autogenerated from the former. The only way to change this is to provide your own subroutine for C<'|'>. =item * Magic autogeneration increases the potential for inadvertently creating self-referential structures. Currently Perl will not free self-referential structures until cycles are explicitly broken. For example, use overload '+' => 'add'; sub add { bless [ \$_[0], \$_[1] ] }; is asking for trouble, since $obj += $y; will effectively become $obj = add($obj, $y, undef); with the same result as $obj = [\$obj, \$foo]; Even if no I assignment-variants of operators are present in the script, they may be generated by the optimizer. For example, "obj = $obj\n" may be optimized to my $tmp = 'obj = ' . $obj; $tmp .= "\n"; =item * The symbol table is filled with names looking like line-noise. =item * This bug was fixed in Perl 5.18, but may still trip you up if you are using older versions: For the purpose of inheritance every overloaded package behaves as if C is present (possibly undefined). This may create interesting effects if some package is not overloaded, but inherits from two overloaded packages. =item * Before Perl 5.14, the relation between overloading and tie()ing was broken. Overloading was triggered or not based on the I class of the tie()d variable. This happened because the presence of overloading was checked too early, before any tie()d access was attempted. If the class of the value FETCH()ed from the tied variable does not change, a simple workaround for code that is to run on older Perl versions is to access the value (via C<() = $foo> or some such) immediately after tie()ing, so that after this call the I class coincides with the current one. =item * Barewords are not covered by overloaded string constants. =item * The range operator C<..> cannot be overloaded. =back =cut # ex: set ts=8 sts=4 sw=4 et: FILEa0c659a5/overloading.pmpackage overloading; use warnings; our $VERSION = '0.02'; my $HINT_NO_AMAGIC = 0x01000000; # see perl.h require 5.010001; sub _ops_to_nums { require overload::numbers; map { exists $overload::numbers::names{"($_"} ? $overload::numbers::names{"($_"} : do { require Carp; Carp::croak("'$_' is not a valid overload") } } @_; } sub import { my ( $class, @ops ) = @_; if ( @ops ) { if ( $^H{overloading} ) { vec($^H{overloading} , $_, 1) = 0 for _ops_to_nums(@ops); } if ( $^H{overloading} !~ /[^\0]/ ) { delete $^H{overloading}; $^H &= ~$HINT_NO_AMAGIC; } } else { delete $^H{overloading}; $^H &= ~$HINT_NO_AMAGIC; } } sub unimport { my ( $class, @ops ) = @_; if ( exists $^H{overloading} or not $^H & $HINT_NO_AMAGIC ) { if ( @ops ) { vec($^H{overloading} ||= '', $_, 1) = 1 for _ops_to_nums(@ops); } else { delete $^H{overloading}; } } $^H |= $HINT_NO_AMAGIC; } 1; __END__ =head1 NAME overloading - perl pragma to lexically control overloading =head1 SYNOPSIS { no overloading; my $str = "$object"; # doesn't call stringification overload } # it's lexical, so this stringifies: warn "$object"; # it can be enabled per op no overloading qw(""); warn "$object"; # and also reenabled use overloading; =head1 DESCRIPTION This pragma allows you to lexically disable or enable overloading. =over 6 =item C Disables overloading entirely in the current lexical scope. =item C Disables only specific overloads in the current lexical scope. =item C Reenables overloading in the current lexical scope. =item C Reenables overloading only for specific ops in the current lexical scope. =back =cut FILE490999b1/parent.pm package parent; use strict; our $VERSION = '0.244'; sub import { my $class = shift; my $inheritor = caller(0); if ( @_ and $_[0] eq '-norequire' ) { shift @_; } else { for ( my @filename = @_ ) { local @_; # protect us against the loaded module changing @_ s{::|'}{/}g; require "$_.pm"; # dies if the file is not found } } { no strict 'refs'; push @{"$inheritor\::ISA"}, @_; # dies if a loop is detected }; }; 1; __END__ =encoding utf8 =head1 NAME parent - Establish an ISA relationship with base classes at compile time =head1 SYNOPSIS package Baz; use parent qw(Foo Bar); =head1 DESCRIPTION Allows you to both load one or more modules, while setting up inheritance from those modules at the same time. Mostly similar in effect to package Baz; BEGIN { require Foo; require Bar; push @ISA, qw(Foo Bar); } By default, every base class needs to live in a file of its own. If you want to have a subclass and its parent class in the same file, you can tell C not to load any modules by using the C<-norequire> switch: package Foo; sub exclaim { "I CAN HAS PERL" } package DoesNotLoadFooBar; use parent -norequire, 'Foo', 'Bar'; # will not go looking for Foo.pm or Bar.pm This is equivalent to the following code: package Foo; sub exclaim { "I CAN HAS PERL" } package DoesNotLoadFooBar; push @DoesNotLoadFooBar::ISA, 'Foo', 'Bar'; This is also helpful for the case where a package lives within a differently named file: package MyHash; use Tie::Hash; use parent -norequire, 'Tie::StdHash'; This is equivalent to the following code: package MyHash; require Tie::Hash; push @ISA, 'Tie::StdHash'; If you want to load a subclass from a file that C would not consider an eligible filename (that is, it does not end in either C<.pm> or C<.pmc>), use the following code: package MySecondPlugin; require './plugins/custom.plugin'; # contains Plugin::Custom use parent -norequire, 'Plugin::Custom'; =head1 HISTORY This module was forked from L to remove the cruft that had accumulated in it. =head1 CAVEATS =head1 SEE ALSO =over 4 =item L =item L A fork of L that provides version checking in parent class modules. =back =head1 AUTHORS AND CONTRIBUTORS Rafaël Garcia-Suarez, Bart Lateur, Max Maischein, Anno Siegel, Michael Schwern =head1 MAINTAINER Max Maischein C< corion@cpan.org > Copyright (c) 2007-2017 Max Maischein C<< >> Based on the idea of C, which was introduced with Perl 5.004_04. =head1 LICENSE This module is released under the same terms as Perl itself. =cut FILE95b29963/strict.pmspackage strict; $strict::VERSION = "1.14"; my ( %bitmask, %explicit_bitmask ); BEGIN { # Verify that we're called correctly so that strictures will work. # Can't use Carp, since Carp uses us! # see also warnings.pm. die sprintf "Incorrect use of pragma '%s' at %s line %d.\n", __PACKAGE__, +(caller)[1,2] if __FILE__ !~ ( '(?x) \b '.__PACKAGE__.' \.pmc? \z' ) && __FILE__ =~ ( '(?x) \b (?i:'.__PACKAGE__.') \.pmc? \z' ); # which strictures are actually in force %bitmask = ( refs => 0x00000002, subs => 0x00000200, vars => 0x00000400, ); # which strictures have at some point been turned on or off explicitly # and must therefore not be touched by any subsequent `use VERSION` or `no VERSION` %explicit_bitmask = ( refs => 0x00000020, subs => 0x00000040, vars => 0x00000080, ); my $bits = 0; $bits |= $_ for values %bitmask; my $inline_all_bits = $bits; *all_bits = sub () { $inline_all_bits }; $bits = 0; $bits |= $_ for values %explicit_bitmask; my $inline_all_explicit_bits = $bits; *all_explicit_bits = sub () { $inline_all_explicit_bits }; } sub bits { my $do_explicit = caller eq __PACKAGE__; my $bits = 0; my @wrong; foreach my $s (@_) { if (exists $bitmask{$s}) { $bits |= $explicit_bitmask{$s} if $do_explicit; $bits |= $bitmask{$s}; } else { push @wrong, $s; } } if (@wrong) { require Carp; Carp::croak("Unknown 'strict' tag(s) '@wrong'"); } $bits; } sub import { shift; $^H |= @_ ? &bits : all_bits | all_explicit_bits; } sub unimport { shift; if (@_) { my $bits = &bits; $^H &= ~$bits; $^H |= all_explicit_bits & $bits; } else { $^H &= ~all_bits; $^H |= all_explicit_bits; } } 1; __END__ =head1 NAME strict - Perl pragma to restrict unsafe constructs =head1 SYNOPSIS use strict; use strict "vars"; use strict "refs"; use strict "subs"; use strict; no strict "vars"; =head1 DESCRIPTION The C pragma disables certain Perl expressions that could behave unexpectedly or are difficult to debug, turning them into errors. The effect of this pragma is limited to the current file or scope block. If no import list is supplied, all possible restrictions are assumed. (This is the safest mode to operate in, but is sometimes too strict for casual programming.) Currently, there are three possible things to be strict about: "subs", "vars", and "refs". =over 6 =item C This generates a runtime error if you use symbolic references (see L). use strict 'refs'; $ref = \$foo; print $$ref; # ok $ref = "foo"; print $$ref; # runtime error; normally ok $file = "STDOUT"; print $file "Hi!"; # error; note: no comma after $file There is one exception to this rule: $bar = \&{'foo'}; &$bar; is allowed so that C would not break under stricture. =item C This generates a compile-time error if you access a variable that was neither explicitly declared (using any of C, C, C, or C) nor fully qualified. (Because this is to avoid variable suicide problems and subtle dynamic scoping issues, a merely C variable isn't good enough.) See L, L, L, L, and L. use strict 'vars'; $X::foo = 1; # ok, fully qualified my $foo = 10; # ok, my() var local $baz = 9; # blows up, $baz not declared before package Cinna; our $bar; # Declares $bar in current package $bar = 'HgS'; # ok, global declared via pragma The local() generated a compile-time error because you just touched a global name without fully qualifying it. Because of their special use by sort(), the variables $a and $b are exempted from this check. =item C This disables the poetry optimization, generating a compile-time error if you try to use a bareword identifier that's not a subroutine, unless it is a simple identifier (no colons) and that it appears in curly braces, on the left hand side of the C<< => >> symbol, or has the unary minus operator applied to it. use strict 'subs'; $SIG{PIPE} = Plumber; # blows up $SIG{PIPE} = "Plumber"; # fine: quoted string is always ok $SIG{PIPE} = \&Plumber; # preferred form =back See L. =head1 HISTORY C, with Perl 5.6.1, erroneously permitted to use an unquoted compound identifier (e.g. C) as a hash key (before C<< => >> or inside curlies), but without forcing it always to a literal string. Starting with Perl 5.8.1 strict is strict about its restrictions: if unknown restrictions are used, the strict pragma will abort with Unknown 'strict' tag(s) '...' As of version 1.04 (Perl 5.10), strict verifies that it is used as "strict" to avoid the dreaded Strict trap on case insensitive file systems. Beginning with Perl 5.12, use of "use VERSION" (where VERSION >= 5.11.0) now lexically enables strictures just like "use strict" (in addition to the normal "use VERSION" effects and features.) In other words, "use v5.011" or higher now implies "use strict" automatically, as noted in L and L|perlfunc/use VERSION>. =cut FILEefadda20/utf8.pm*package utf8; use strict; use warnings; our $utf8_hint_bits = 0x00800000; our $ascii_hint_bits = 0x00000010; # Turned off when utf8 turned on our $VERSION = '1.27'; our $AUTOLOAD; sub import { $^H |= $utf8_hint_bits; $^H &= ~$ascii_hint_bits; } sub unimport { $^H &= ~$utf8_hint_bits; } sub AUTOLOAD { goto &$AUTOLOAD if defined &$AUTOLOAD; require Carp; Carp::croak("Undefined subroutine $AUTOLOAD called"); } 1; __END__ =head1 NAME utf8 - Perl pragma to enable/disable UTF-8 (or UTF-EBCDIC) in source code =head1 SYNOPSIS use utf8; no utf8; # Convert the internal representation of a Perl scalar to/from UTF-8. $num_octets = utf8::upgrade($string); $success = utf8::downgrade($string[, $fail_ok]); # Change each character of a Perl scalar to/from a series of # characters that represent the UTF-8 bytes of each original character. utf8::encode($string); # "\x{100}" becomes "\xc4\x80" utf8::decode($string); # "\xc4\x80" becomes "\x{100}" # Convert a code point from the platform native character set to # Unicode, and vice-versa. $unicode = utf8::native_to_unicode(ord('A')); # returns 65 on both # ASCII and EBCDIC # platforms $native = utf8::unicode_to_native(65); # returns 65 on ASCII # platforms; 193 on # EBCDIC $flag = utf8::is_utf8($string); # since Perl 5.8.1 $flag = utf8::valid($string); =head1 DESCRIPTION The C pragma tells the Perl parser to allow UTF-8 in the program text in the current lexical scope. The C pragma tells Perl to switch back to treating the source text as literal bytes in the current lexical scope. (On EBCDIC platforms, technically it is allowing UTF-EBCDIC, and not UTF-8, but this distinction is academic, so in this document the term UTF-8 is used to mean both). B The utility functions described below are directly usable without C. Because it is not possible to reliably tell UTF-8 from native 8 bit encodings, you need either a Byte Order Mark at the beginning of your source code, or C, to instruct perl. When UTF-8 becomes the standard source format, this pragma will effectively become a no-op. See also the effects of the C<-C> switch and its cousin, the C environment variable, in L. Enabling the C pragma has the following effect: =over 4 =item * Bytes in the source text that are not in the ASCII character set will be treated as being part of a literal UTF-8 sequence. This includes most literals such as identifier names, string constants, and constant regular expression patterns. =back Note that if you have non-ASCII, non-UTF-8 bytes in your script (for example embedded Latin-1 in your string literals), C will be unhappy. If you want to have such bytes under C, you can disable this pragma until the end the block (or file, if at top level) by C. =head2 Utility functions The following functions are defined in the C package by the Perl core. You do not need to say C to use these and in fact you should not say that unless you really want to have UTF-8 source code. =over 4 =item * C<$num_octets = utf8::upgrade($string)> (Since Perl v5.8.0) Converts in-place the internal representation of the string from an octet sequence in the native encoding (Latin-1 or EBCDIC) to UTF-8. The logical character sequence itself is unchanged. If I<$string> is already upgraded, then this is a no-op. Returns the number of octets necessary to represent the string as UTF-8. Since Perl v5.38, if C<$string> is C no action is taken; prior to that, it would be converted to be defined and zero-length. If your code needs to be compatible with versions of perl without C, you can force Unicode semantics on a given string: # force unicode semantics for $string without the # "unicode_strings" feature utf8::upgrade($string); For example: # without explicit or implicit use feature 'unicode_strings' my $x = "\xDF"; # LATIN SMALL LETTER SHARP S $x =~ /ss/i; # won't match my $y = uc($x); # won't convert utf8::upgrade($x); $x =~ /ss/i; # matches my $z = uc($x); # converts to "SS" B; use L instead. =item * C<$success = utf8::downgrade($string[, $fail_ok])> (Since Perl v5.8.0) Converts in-place the internal representation of the string from UTF-8 to the equivalent octet sequence in the native encoding (Latin-1 or EBCDIC). The logical character sequence itself is unchanged. If I<$string> is already stored as native 8 bit, then this is a no-op. Can be used to make sure that the UTF-8 flag is off, e.g. when you want to make sure that the substr() or length() function works with the usually faster byte algorithm. Fails if the original UTF-8 sequence cannot be represented in the native 8 bit encoding. On failure dies or, if the value of I<$fail_ok> is true, returns false. Returns true on success. If your code expects an octet sequence this can be used to validate that you've received one: # throw an exception if not representable as octets utf8::downgrade($string) # or do your own error handling utf8::downgrade($string, 1) or die "string must be octets"; B; use L instead. =item * C (Since Perl v5.8.0) Converts in-place the character sequence to the corresponding octet sequence in Perl's extended UTF-8. That is, every (possibly wide) character gets replaced with a sequence of one or more characters that represent the individual UTF-8 bytes of the character. The UTF8 flag is turned off. Returns nothing. my $x = "\x{100}"; # $x contains one character, with ord 0x100 utf8::encode($x); # $x contains two characters, with ords (on # ASCII platforms) 0xc4 and 0x80. On EBCDIC # 1047, this would instead be 0x8C and 0x41. Similar to: use Encode; $x = Encode::encode("utf8", $x); B; use L instead. =item * C<$success = utf8::decode($string)> (Since Perl v5.8.0) Attempts to convert in-place the octet sequence encoded in Perl's extended UTF-8 to the corresponding character sequence. That is, it replaces each sequence of characters in the string whose ords represent a valid (extended) UTF-8 byte sequence, with the corresponding single character. The UTF-8 flag is turned on only if the source string contains multiple-byte UTF-8 characters. If I<$string> is invalid as extended UTF-8, returns false; otherwise returns true. my $x = "\xc4\x80"; # $x contains two characters, with ords # 0xc4 and 0x80 utf8::decode($x); # On ASCII platforms, $x contains one char, # with ord 0x100. Since these bytes aren't # legal UTF-EBCDIC, on EBCDIC platforms, $x is # unchanged and the function returns FALSE. my $y = "\xc3\x83\xc2\xab"; This has been encoded twice; this # example is only for ASCII platforms utf8::decode($y); # Converts $y to \xc3\xab, returns TRUE; utf8::decode($y); # Further converts to \xeb, returns TRUE; utf8::decode($y); # Returns FALSE, leaves $y unchanged B; use L instead. =item * C<$unicode = utf8::native_to_unicode($code_point)> (Since Perl v5.8.0) This takes an unsigned integer (which represents the ordinal number of a character (or a code point) on the platform the program is being run on) and returns its Unicode equivalent value. Since ASCII platforms natively use the Unicode code points, this function returns its input on them. On EBCDIC platforms it converts from EBCDIC to Unicode. A meaningless value will currently be returned if the input is not an unsigned integer. Since Perl v5.22.0, calls to this function are optimized out on ASCII platforms, so there is no performance hit in using it there. =item * C<$native = utf8::unicode_to_native($code_point)> (Since Perl v5.8.0) This is the inverse of C, converting the other direction. Again, on ASCII platforms, this returns its input, but on EBCDIC platforms it will find the native platform code point, given any Unicode one. A meaningless value will currently be returned if the input is not an unsigned integer. Since Perl v5.22.0, calls to this function are optimized out on ASCII platforms, so there is no performance hit in using it there. =item * C<$flag = utf8::is_utf8($string)> (Since Perl 5.8.1) Test whether I<$string> is marked internally as encoded in UTF-8. Functionally the same as C. Typically only necessary for debugging and testing, if you need to dump the internals of an SV, L Dump() provides more detail in a compact form. If you still think you need this outside of debugging, testing or dealing with filenames, you should probably read L and L. Don't use this flag as a marker to distinguish character and binary data: that should be decided for each variable when you write your code. To force unicode semantics in code portable to perl 5.8 and 5.10, call C unconditionally. =item * C<$flag = utf8::valid($string)> [INTERNAL] Test whether I<$string> is in a consistent state regarding UTF-8. Will return true if it is well-formed Perl extended UTF-8 and has the UTF-8 flag on B if I<$string> is held as bytes (both these states are 'consistent'). The main reason for this routine is to allow Perl's test suite to check that operations have left strings in a consistent state. =back C is like C, but the UTF8 flag is cleared. See L, and the C API functions C>, C>, C>, and C>, which are wrapped by the Perl functions C, C, C and C. Also, the functions C, C, C, C, C, and C are actually internal, and thus always available, without a C statement. =head1 BUGS Some filesystems may not support UTF-8 file names, or they may be supported incompatibly with Perl. Therefore UTF-8 names that are visible to the filesystem, such as module names may not work. =head1 SEE ALSO L, L, L, L, L =cut FILEab7f7a02/vars.pm package vars; use 5.006; our $VERSION = '1.05'; use warnings::register; use strict qw(vars subs); sub import { my $callpack = caller; my (undef, @imports) = @_; my ($sym, $ch); foreach (@imports) { if (($ch, $sym) = /^([\$\@\%\*\&])(.+)/) { if ($sym =~ /\W/) { # time for a more-detailed check-up if ($sym =~ /^\w+[[{].*[]}]$/) { require Carp; Carp::croak("Can't declare individual elements of hash or array"); } elsif (warnings::enabled() and length($sym) == 1 and $sym !~ tr/a-zA-Z//) { warnings::warn("No need to declare built-in vars"); } elsif (($^H & strict::bits('vars'))) { require Carp; Carp::croak("'$_' is not a valid variable name under strict vars"); } } $sym = "${callpack}::$sym" unless $sym =~ /::/; *$sym = ( $ch eq "\$" ? \$$sym : $ch eq "\@" ? \@$sym : $ch eq "\%" ? \%$sym : $ch eq "\*" ? \*$sym : $ch eq "\&" ? \&$sym : do { require Carp; Carp::croak("'$_' is not a valid variable name"); }); } else { require Carp; Carp::croak("'$_' is not a valid variable name"); } } }; 1; __END__ =head1 NAME vars - Perl pragma to predeclare global variable names =head1 SYNOPSIS use vars qw($frob @mung %seen); =head1 DESCRIPTION NOTE: For use with variables in the current package for a single scope, the functionality provided by this pragma has been superseded by C declarations, available in Perl v5.6.0 or later, and use of this pragma is discouraged. See L. This pragma will predeclare all the variables whose names are in the list, allowing you to use them under C, and disabling any typo warnings for them. Unlike pragmas that affect the C<$^H> hints variable, the C and C declarations are not lexically scoped to the block they appear in: they affect the entire package in which they appear. It is not possible to rescind these declarations with C or C. Packages such as the B and B that delay loading of subroutines within packages can create problems with package lexicals defined using C. While the B pragma cannot duplicate the effect of package lexicals (total transparency outside of the package), it can act as an acceptable substitute by pre-declaring global symbols, ensuring their availability to the later-loaded routines. See L. =cut FILE6812ffab/warnings.pm# -*- mode: Perl; buffer-read-only: t -*- # !!!!!!! DO NOT EDIT THIS FILE !!!!!!! # This file is built by regen/warnings.pl. # Any changes made here will be lost! package warnings; our $VERSION = "1.74"; # Verify that we're called correctly so that warnings will work. # Can't use Carp, since Carp uses us! # String regexps because constant folding = smaller optree = less memory vs regexp literal # see also strict.pm. die sprintf "Incorrect use of pragma '%s' at %s line %d.\n", __PACKAGE__, +(caller)[1,2] if __FILE__ !~ ( '(?x) \b '.__PACKAGE__.' \.pmc? \z' ) && __FILE__ =~ ( '(?x) \b (?i:'.__PACKAGE__.') \.pmc? \z' ); our %Offsets = ( # Warnings Categories added in Perl 5.008 'all' => 0, 'closure' => 2, 'deprecated' => 4, 'exiting' => 6, 'glob' => 8, 'io' => 10, 'closed' => 12, 'exec' => 14, 'layer' => 16, 'newline' => 18, 'pipe' => 20, 'unopened' => 22, 'misc' => 24, 'numeric' => 26, 'once' => 28, 'overflow' => 30, 'pack' => 32, 'portable' => 34, 'recursion' => 36, 'redefine' => 38, 'regexp' => 40, 'severe' => 42, 'debugging' => 44, 'inplace' => 46, 'internal' => 48, 'malloc' => 50, 'signal' => 52, 'substr' => 54, 'syntax' => 56, 'ambiguous' => 58, 'bareword' => 60, 'digit' => 62, 'parenthesis' => 64, 'precedence' => 66, 'printf' => 68, 'prototype' => 70, 'qw' => 72, 'reserved' => 74, 'semicolon' => 76, 'taint' => 78, 'threads' => 80, 'uninitialized' => 82, 'unpack' => 84, 'untie' => 86, 'utf8' => 88, 'void' => 90, # Warnings Categories added in Perl 5.011 'imprecision' => 92, 'illegalproto' => 94, # Warnings Categories added in Perl 5.011003 'deprecated::goto_construct' => 96, 'deprecated::unicode_property_name' => 98, # Warnings Categories added in Perl 5.013 'non_unicode' => 100, 'nonchar' => 102, 'surrogate' => 104, # Warnings Categories added in Perl 5.017 'experimental' => 106, 'experimental::regex_sets' => 108, # Warnings Categories added in Perl 5.019 'syscalls' => 110, # Warnings Categories added in Perl 5.021 'experimental::re_strict' => 112, 'experimental::refaliasing' => 114, 'locale' => 116, 'missing' => 118, 'redundant' => 120, # Warnings Categories added in Perl 5.025 'experimental::declared_refs' => 122, # Warnings Categories added in Perl 5.025011 'deprecated::dot_in_inc' => 124, # Warnings Categories added in Perl 5.027 'shadow' => 126, # Warnings Categories added in Perl 5.029 'experimental::private_use' => 128, 'experimental::uniprop_wildcards' => 130, 'experimental::vlb' => 132, # Warnings Categories added in Perl 5.033 'experimental::try' => 134, # Warnings Categories added in Perl 5.035 'experimental::args_array_with_signatures'=> 136, 'experimental::builtin' => 138, 'experimental::defer' => 140, 'experimental::extra_paired_delimiters'=> 142, 'scalar' => 144, # Warnings Categories added in Perl 5.035009 'deprecated::version_downgrade' => 146, # Warnings Categories added in Perl 5.03501 'deprecated::delimiter_will_be_paired'=> 148, # Warnings Categories added in Perl 5.037 'experimental::class' => 150, # Warnings Categories added in Perl 5.039002 'deprecated::missing_import_called_with_args'=> 152, # Warnings Categories added in Perl 5.039008 'deprecated::subsequent_use_version'=> 154, # Warnings Categories added in Perl 5.041 'experimental::keyword_all' => 156, 'experimental::keyword_any' => 158, ); our %Bits = ( 'all' => "\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55\x55", # [0..79] 'ambiguous' => "\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [29] 'bareword' => "\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [30] 'closed' => "\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [6] 'closure' => "\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [1] 'debugging' => "\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [22] 'deprecated' => "\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x05\x00\x00\x10\x00\x00\x14\x05", # [2,48,49,62,73,74,76,77] 'deprecated::delimiter_will_be_paired'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00", # [74] 'deprecated::dot_in_inc' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00", # [62] 'deprecated::goto_construct' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00", # [48] 'deprecated::missing_import_called_with_args'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01", # [76] 'deprecated::subsequent_use_version'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04", # [77] 'deprecated::unicode_property_name' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00", # [49] 'deprecated::version_downgrade' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00", # [73] 'digit' => "\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [31] 'exec' => "\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [7] 'exiting' => "\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [3] 'experimental' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x14\x05\x04\x55\x55\x40\x50", # [53,54,56,57,61,64..71,75,78,79] 'experimental::args_array_with_signatures'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00", # [68] 'experimental::builtin' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00", # [69] 'experimental::class' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00", # [75] 'experimental::declared_refs' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00", # [61] 'experimental::defer' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00", # [70] 'experimental::extra_paired_delimiters'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00", # [71] 'experimental::keyword_all' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10", # [78] 'experimental::keyword_any' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40", # [79] 'experimental::private_use' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00", # [64] 'experimental::re_strict' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00", # [56] 'experimental::refaliasing' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00", # [57] 'experimental::regex_sets' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00", # [54] 'experimental::try' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00", # [67] 'experimental::uniprop_wildcards' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00", # [65] 'experimental::vlb' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00", # [66] 'glob' => "\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [4] 'illegalproto' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00", # [47] 'imprecision' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00", # [46] 'inplace' => "\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [23] 'internal' => "\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [24] 'io' => "\x00\x54\x55\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00", # [5..11,55] 'layer' => "\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [8] 'locale' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00", # [58] 'malloc' => "\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [25] 'misc' => "\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [12] 'missing' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00", # [59] 'newline' => "\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [9] 'non_unicode' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00", # [50] 'nonchar' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00", # [51] 'numeric' => "\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [13] 'once' => "\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [14] 'overflow' => "\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [15] 'pack' => "\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [16] 'parenthesis' => "\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [32] 'pipe' => "\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [10] 'portable' => "\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [17] 'precedence' => "\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [33] 'printf' => "\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [34] 'prototype' => "\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [35] 'qw' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [36] 'recursion' => "\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [18] 'redefine' => "\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [19] 'redundant' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00", # [60] 'regexp' => "\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [20] 'reserved' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [37] 'scalar' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00", # [72] 'semicolon' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [38] 'severe' => "\x00\x00\x00\x00\x00\x54\x05\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [21..25] 'shadow' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00", # [63] 'signal' => "\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [26] 'substr' => "\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [27] 'surrogate' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00", # [52] 'syntax' => "\x00\x00\x00\x00\x00\x00\x00\x55\x55\x15\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00", # [28..38,47] 'syscalls' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00", # [55] 'taint' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [39] 'threads' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [40] 'uninitialized' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [41] 'unopened' => "\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [11] 'unpack' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x10\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [42] 'untie' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x40\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [43] 'utf8' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x01\x50\x01\x00\x00\x00\x00\x00\x00", # [44,50..52] 'void' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x04\x00\x00\x00\x00\x00\x00\x00\x00", # [45] ); our %DeadBits = ( 'all' => "\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa\xaa", # [0..79] 'ambiguous' => "\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [29] 'bareword' => "\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [30] 'closed' => "\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [6] 'closure' => "\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [1] 'debugging' => "\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [22] 'deprecated' => "\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x0a\x00\x00\x20\x00\x00\x28\x0a", # [2,48,49,62,73,74,76,77] 'deprecated::delimiter_will_be_paired'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00", # [74] 'deprecated::dot_in_inc' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00", # [62] 'deprecated::goto_construct' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00", # [48] 'deprecated::missing_import_called_with_args'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02", # [76] 'deprecated::subsequent_use_version'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08", # [77] 'deprecated::unicode_property_name' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00", # [49] 'deprecated::version_downgrade' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00", # [73] 'digit' => "\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [31] 'exec' => "\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [7] 'exiting' => "\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [3] 'experimental' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x28\x0a\x08\xaa\xaa\x80\xa0", # [53,54,56,57,61,64..71,75,78,79] 'experimental::args_array_with_signatures'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00", # [68] 'experimental::builtin' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00", # [69] 'experimental::class' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00", # [75] 'experimental::declared_refs' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00", # [61] 'experimental::defer' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00", # [70] 'experimental::extra_paired_delimiters'=> "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00", # [71] 'experimental::keyword_all' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20", # [78] 'experimental::keyword_any' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80", # [79] 'experimental::private_use' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00", # [64] 'experimental::re_strict' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00", # [56] 'experimental::refaliasing' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00", # [57] 'experimental::regex_sets' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00", # [54] 'experimental::try' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00", # [67] 'experimental::uniprop_wildcards' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00", # [65] 'experimental::vlb' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00", # [66] 'glob' => "\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [4] 'illegalproto' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00", # [47] 'imprecision' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00", # [46] 'inplace' => "\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [23] 'internal' => "\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [24] 'io' => "\x00\xa8\xaa\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00", # [5..11,55] 'layer' => "\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [8] 'locale' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00", # [58] 'malloc' => "\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [25] 'misc' => "\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [12] 'missing' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00", # [59] 'newline' => "\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [9] 'non_unicode' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00", # [50] 'nonchar' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00", # [51] 'numeric' => "\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [13] 'once' => "\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [14] 'overflow' => "\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [15] 'pack' => "\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [16] 'parenthesis' => "\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [32] 'pipe' => "\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [10] 'portable' => "\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [17] 'precedence' => "\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [33] 'printf' => "\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [34] 'prototype' => "\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [35] 'qw' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [36] 'recursion' => "\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [18] 'redefine' => "\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [19] 'redundant' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00", # [60] 'regexp' => "\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [20] 'reserved' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [37] 'scalar' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00", # [72] 'semicolon' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [38] 'severe' => "\x00\x00\x00\x00\x00\xa8\x0a\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [21..25] 'shadow' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00", # [63] 'signal' => "\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [26] 'substr' => "\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [27] 'surrogate' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00", # [52] 'syntax' => "\x00\x00\x00\x00\x00\x00\x00\xaa\xaa\x2a\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00", # [28..38,47] 'syscalls' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00", # [55] 'taint' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [39] 'threads' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [40] 'uninitialized' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [41] 'unopened' => "\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [11] 'unpack' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x20\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [42] 'untie' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x80\x00\x00\x00\x00\x00\x00\x00\x00\x00", # [43] 'utf8' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x02\xa0\x02\x00\x00\x00\x00\x00\x00", # [44,50..52] 'void' => "\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x00\x08\x00\x00\x00\x00\x00\x00\x00\x00", # [45] ); our %NoOp = ( 'deprecated::smartmatch' => 1, 'experimental::alpha_assertions' => 1, 'experimental::bitwise' => 1, 'experimental::const_attr' => 1, 'experimental::for_list' => 1, 'experimental::isa' => 1, 'experimental::lexical_subs' => 1, 'experimental::postderef' => 1, 'experimental::script_run' => 1, 'experimental::signatures' => 1, 'experimental::smartmatch' => 1, ); # These are used by various things, including our own tests our $NONE = "\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0\0"; our $DEFAULT = "\x10\x01\x00\x00\x00\x50\x04\x00\x00\x00\x00\x00\x05\x00\x15\x14\x55\x55\x54\x55"; # [2,4,22,23,25,48,49,56..58,61,62,64..71,73..79] our $LAST_BIT = 160 ; our $BYTES = 20 ; sub Croaker { require Carp; # this initializes %CarpInternal local $Carp::CarpInternal{'warnings'}; delete $Carp::CarpInternal{'warnings'}; Carp::croak(@_); } sub _expand_bits { my $bits = shift; my $want_len = ($LAST_BIT + 7) >> 3; my $len = length($bits); if ($len != $want_len) { if ($bits eq "") { $bits = "\x00" x $want_len; } elsif ($len > $want_len) { substr $bits, $want_len, $len-$want_len, ""; } else { my $x = vec($bits, $Offsets{all} >> 1, 2); $x |= $x << 2; $x |= $x << 4; $bits .= chr($x) x ($want_len - $len); } } return $bits; } sub _bits { my $mask = shift ; my $catmask ; my $fatal = 0 ; my $no_fatal = 0 ; $mask = _expand_bits($mask); foreach my $word ( @_ ) { next if $NoOp{$word}; if ($word eq 'FATAL') { $fatal = 1; $no_fatal = 0; } elsif ($word eq 'NONFATAL') { $fatal = 0; $no_fatal = 1; } elsif ($catmask = $Bits{$word}) { $mask |= $catmask ; $mask |= $DeadBits{$word} if $fatal ; $mask = ~(~$mask | $DeadBits{$word}) if $no_fatal ; } else { Croaker("Unknown warnings category '$word'")} } return $mask ; } sub bits { # called from B::Deparse.pm push @_, 'all' unless @_ ; return _bits("", @_) ; } sub import { my $invocant = shift; # append 'all' when implied (empty import list or after a lone # "FATAL" or "NONFATAL") push @_, 'all' if !@_ || (@_==1 && ($_[0] eq 'FATAL' || $_[0] eq 'NONFATAL')); my @fatal = (); foreach my $warning (@_) { if($warning =~ /^(NON)?FATAL$/) { @fatal = ($warning); } elsif(substr($warning, 0, 1) ne '-') { my $mask = ${^WARNING_BITS} // ($^W ? $Bits{all} : $DEFAULT) ; ${^WARNING_BITS} = _bits($mask, @fatal, $warning); } else { $invocant->unimport(substr($warning, 1)); } } } sub unimport { shift; my $catmask ; my $mask = ${^WARNING_BITS} // ($^W ? $Bits{all} : $DEFAULT) ; # append 'all' when implied (empty import list or after a lone "FATAL") push @_, 'all' if !@_ || @_==1 && $_[0] eq 'FATAL'; $mask = _expand_bits($mask); foreach my $word ( @_ ) { next if $NoOp{$word}; if ($word eq 'FATAL') { next; } elsif ($catmask = $Bits{$word}) { $mask = ~(~$mask | $catmask | $DeadBits{$word}); } else { Croaker("Unknown warnings category '$word'")} } ${^WARNING_BITS} = $mask ; } my %builtin_type; @builtin_type{qw(SCALAR ARRAY HASH CODE REF GLOB LVALUE Regexp)} = (); sub LEVEL () { 8 }; sub MESSAGE () { 4 }; sub FATAL () { 2 }; sub NORMAL () { 1 }; sub __chk { my $category ; my $offset ; my $isobj = 0 ; my $wanted = shift; my $has_message = $wanted & MESSAGE; my $has_level = $wanted & LEVEL ; if ($has_level) { if (@_ != ($has_message ? 3 : 2)) { my $sub = (caller 1)[3]; my $syntax = $has_message ? "category, level, 'message'" : 'category, level'; Croaker("Usage: $sub($syntax)"); } } elsif (not @_ == 1 || @_ == ($has_message ? 2 : 0)) { my $sub = (caller 1)[3]; my $syntax = $has_message ? "[category,] 'message'" : '[category]'; Croaker("Usage: $sub($syntax)"); } my $message = pop if $has_message; if (@_) { # check the category supplied. $category = shift ; if (my $type = ref $category) { Croaker("not an object") if exists $builtin_type{$type}; $category = $type; $isobj = 1 ; } $offset = $Offsets{$category}; Croaker("Unknown warnings category '$category'") unless defined $offset; } else { $category = caller(1); $offset = $Offsets{$category}; Croaker("package '$category' not registered for warnings") unless defined $offset ; } my $i; if ($isobj) { my $pkg; $i = 2; while (do { { package DB; $pkg = (caller($i++))[0] } } ) { last unless @DB::args && $DB::args[0] =~ /^$category=/ ; } $i -= 2 ; } elsif ($has_level) { $i = 2 + shift; } else { $i = _error_loc(); # see where Carp will allocate the error } # Default to 0 if caller returns nothing. Default to $DEFAULT if it # explicitly returns undef. my(@callers_bitmask) = (caller($i))[9] ; my $callers_bitmask = @callers_bitmask ? $callers_bitmask[0] // $DEFAULT : 0 ; length($callers_bitmask) > ($offset >> 3) or $offset = $Offsets{all}; my @results; foreach my $type (FATAL, NORMAL) { next unless $wanted & $type; push @results, vec($callers_bitmask, $offset + $type - 1, 1); } # &enabled and &fatal_enabled return $results[0] unless $has_message; # &warnif, and the category is neither enabled as warning nor as fatal return if ($wanted & (NORMAL | FATAL | MESSAGE)) == (NORMAL | FATAL | MESSAGE) && !($results[0] || $results[1]); # If we have an explicit level, bypass Carp. if ($has_level and @callers_bitmask) { # logic copied from util.c:mess_sv my $stuff = " at " . join " line ", (caller $i)[1,2]; $stuff .= sprintf ", <%s> %s %d", *${^LAST_FH}{NAME}, ($/ eq "\n" ? "line" : "chunk"), $. if $. && ${^LAST_FH}; die "$message$stuff.\n" if $results[0]; return warn "$message$stuff.\n"; } require Carp; Carp::croak($message) if $results[0]; # will always get here for &warn. will only get here for &warnif if the # category is enabled Carp::carp($message); } sub _mkMask { my ($bit) = @_; my $mask = ""; vec($mask, $bit, 1) = 1; return $mask; } sub register_categories { my @names = @_; for my $name (@names) { if (! defined $Bits{$name}) { $Offsets{$name} = $LAST_BIT; $Bits{$name} = _mkMask($LAST_BIT++); $DeadBits{$name} = _mkMask($LAST_BIT++); if (length($Bits{$name}) > length($Bits{all})) { $Bits{all} .= "\x55"; $DeadBits{all} .= "\xaa"; } } } } sub _error_loc { require Carp; goto &Carp::short_error_loc; # don't introduce another stack frame } sub enabled { return __chk(NORMAL, @_); } sub fatal_enabled { return __chk(FATAL, @_); } sub warn { return __chk(FATAL | MESSAGE, @_); } sub warnif { return __chk(NORMAL | FATAL | MESSAGE, @_); } sub enabled_at_level { return __chk(NORMAL | LEVEL, @_); } sub fatal_enabled_at_level { return __chk(FATAL | LEVEL, @_); } sub warn_at_level { return __chk(FATAL | MESSAGE | LEVEL, @_); } sub warnif_at_level { return __chk(NORMAL | FATAL | MESSAGE | LEVEL, @_); } # These are not part of any public interface, so we can delete them to save # space. delete @warnings::{qw(NORMAL FATAL MESSAGE LEVEL)}; 1; __END__ =head1 NAME warnings - Perl pragma to control optional warnings =head1 SYNOPSIS use warnings; no warnings; # Standard warnings are enabled by use v5.35 or above use v5.35; use warnings "all"; no warnings "uninitialized"; # or equivalent to those last two ... use warnings qw(all -uninitialized); use warnings::register; if (warnings::enabled()) { warnings::warn("some warning"); } if (warnings::enabled("void")) { warnings::warn("void", "some warning"); } if (warnings::enabled($object)) { warnings::warn($object, "some warning"); } warnings::warnif("some warning"); warnings::warnif("void", "some warning"); warnings::warnif($object, "some warning"); =head1 DESCRIPTION The C pragma gives control over which warnings are enabled in which parts of a Perl program. It's a more flexible alternative for both the command line flag B<-w> and the equivalent Perl variable, C<$^W>. This pragma works just like the C pragma. This means that the scope of the warning pragma is limited to the enclosing block. It also means that the pragma setting will not leak across files (via C, C or C). This allows authors to independently define the degree of warning checks that will be applied to their module. By default, optional warnings are disabled, so any legacy code that doesn't attempt to control the warnings will work unchanged. All warnings are enabled in a block by either of these: use warnings; use warnings 'all'; Similarly all warnings are disabled in a block by either of these: no warnings; no warnings 'all'; For example, consider the code below: use warnings; my @x; { no warnings; my $y = @x[0]; } my $z = @x[0]; The code in the enclosing block has warnings enabled, but the inner block has them disabled. In this case that means the assignment to the scalar C<$z> will trip the C<"Scalar value @x[0] better written as $x[0]"> warning, but the assignment to the scalar C<$y> will not. All warnings are enabled automatically within the scope of a C> (or higher) declaration. =head2 Default Warnings and Optional Warnings Before the introduction of lexical warnings, Perl had two classes of warnings: mandatory and optional. As its name suggests, if your code tripped a mandatory warning, you would get a warning whether you wanted it or not. For example, the code below would always produce an C<"isn't numeric"> warning about the "2:". my $x = "2:" + 3; With the introduction of lexical warnings, mandatory warnings now become I warnings. The difference is that although the previously mandatory warnings are still enabled by default, they can then be subsequently enabled or disabled with the lexical warning pragma. For example, in the code below, an C<"isn't numeric"> warning will only be reported for the C<$x> variable. my $x = "2:" + 3; no warnings; my $y = "2:" + 3; Note that neither the B<-w> flag or the C<$^W> can be used to disable/enable default warnings. They are still mandatory in this case. =head2 "Negative warnings" As a convenience, you can (as of Perl 5.34) pass arguments to the C method both positively and negatively. Negative warnings are those with a C<-> sign prepended to their names; positive warnings are anything else. This lets you turn on some warnings and turn off others in one command. So, assuming that you've already turned on a bunch of warnings but want to tweak them a bit in some block, you can do this: { use warnings qw(uninitialized -redefine); ... } which is equivalent to: { use warnings qw(uninitialized); no warnings qw(redefine); ... } The argument list is processed in the order you specify. So, for example, if you don't want to be warned about use of experimental features, except for C that you really dislike, you can say this: use warnings qw(all -experimental experimental::somefeature); which is equivalent to: use warnings 'all'; no warnings 'experimental'; use warnings 'experimental::somefeature'; As experimental features become regular features of Perl, the corresponding warnings are not printed anymore. They also stop being listed in the L below. It is still possible to request turning on or off these warnings, but doing so has no effect. =head2 What's wrong with B<-w> and C<$^W> Although very useful, the big problem with using B<-w> on the command line to enable warnings is that it is all or nothing. Take the typical scenario when you are writing a Perl program. Parts of the code you will write yourself, but it's very likely that you will make use of pre-written Perl modules. If you use the B<-w> flag in this case, you end up enabling warnings in pieces of code that you haven't written. Similarly, using C<$^W> to either disable or enable blocks of code is fundamentally flawed. For a start, say you want to disable warnings in a block of code. You might expect this to be enough to do the trick: { local ($^W) = 0; my $x =+ 2; my $y; chop $y; } When this code is run with the B<-w> flag, a warning will be produced for the C<$x> line: C<"Reversed += operator">. The problem is that Perl has both compile-time and run-time warnings. To disable compile-time warnings you need to rewrite the code like this: { BEGIN { $^W = 0 } my $x =+ 2; my $y; chop $y; } And note that unlike the first example, this will permanently set C<$^W> since it cannot both run during compile-time and be localized to a run-time block. The other big problem with C<$^W> is the way you can inadvertently change the warning setting in unexpected places in your code. For example, when the code below is run (without the B<-w> flag), the second call to C will trip a C<"Use of uninitialized value"> warning, whereas the first will not. sub doit { my $y; chop $y; } doit(); { local ($^W) = 1; doit() } This is a side-effect of C<$^W> being dynamically scoped. Lexical warnings get around these limitations by allowing finer control over where warnings can or can't be tripped. =head2 Controlling Warnings from the Command Line There are three Command Line flags that can be used to control when warnings are (or aren't) produced: =over 5 =item B<-w> X<-w> This is the existing flag. If the lexical warnings pragma is B used in any of your code, or any of the modules that you use, this flag will enable warnings everywhere. See L for details of how this flag interacts with lexical warnings. =item B<-W> X<-W> If the B<-W> flag is used on the command line, it will enable all warnings throughout the program regardless of whether warnings were disabled locally using C or C<$^W =0>. This includes all files that get included via C, C or C. Think of it as the Perl equivalent of the "lint" command. =item B<-X> X<-X> Does the exact opposite to the B<-W> flag, i.e. it disables all warnings. =back =head2 Backward Compatibility If you are used to working with a version of Perl prior to the introduction of lexically scoped warnings, or have code that uses both lexical warnings and C<$^W>, this section will describe how they interact. How Lexical Warnings interact with B<-w>/C<$^W>: =over 5 =item 1. If none of the three command line flags (B<-w>, B<-W> or B<-X>) that control warnings is used and neither C<$^W> nor the C pragma are used, then default warnings will be enabled and optional warnings disabled. This means that legacy code that doesn't attempt to control the warnings will work unchanged. =item 2. The B<-w> flag just sets the global C<$^W> variable as in 5.005. This means that any legacy code that currently relies on manipulating C<$^W> to control warning behavior will still work as is. =item 3. Apart from now being a boolean, the C<$^W> variable operates in exactly the same horrible uncontrolled global way, except that it cannot disable/enable default warnings. =item 4. If a piece of code is under the control of the C pragma, both the C<$^W> variable and the B<-w> flag will be ignored for the scope of the lexical warning. =item 5. The only way to override a lexical warnings setting is with the B<-W> or B<-X> command line flags. =back The combined effect of 3 & 4 is that it will allow code which uses the C pragma to control the warning behavior of $^W-type code (using a C) if it really wants to, but not vice-versa. =head2 Category Hierarchy X A hierarchy of "categories" have been defined to allow groups of warnings to be enabled/disabled in isolation. The current hierarchy is: all -+ | +- closure | +- deprecated ----+ | | | +- deprecated::delimiter_will_be_paired | | | +- deprecated::dot_in_inc | | | +- deprecated::goto_construct | | | +- deprecated::missing_import_called_with_args | | | +- deprecated::subsequent_use_version | | | +- deprecated::unicode_property_name | | | +- deprecated::version_downgrade | +- exiting | +- experimental --+ | | | +- experimental::args_array_with_signatures | | | +- experimental::builtin | | | +- experimental::class | | | +- experimental::declared_refs | | | +- experimental::defer | | | +- experimental::extra_paired_delimiters | | | +- experimental::keyword_all | | | +- experimental::keyword_any | | | +- experimental::private_use | | | +- experimental::re_strict | | | +- experimental::refaliasing | | | +- experimental::regex_sets | | | +- experimental::try | | | +- experimental::uniprop_wildcards | | | +- experimental::vlb | +- glob | +- imprecision | +- io ------------+ | | | +- closed | | | +- exec | | | +- layer | | | +- newline | | | +- pipe | | | +- syscalls | | | +- unopened | +- locale | +- misc | +- missing | +- numeric | +- once | +- overflow | +- pack | +- portable | +- recursion | +- redefine | +- redundant | +- regexp | +- scalar | +- severe --------+ | | | +- debugging | | | +- inplace | | | +- internal | | | +- malloc | +- shadow | +- signal | +- substr | +- syntax --------+ | | | +- ambiguous | | | +- bareword | | | +- digit | | | +- illegalproto | | | +- parenthesis | | | +- precedence | | | +- printf | | | +- prototype | | | +- qw | | | +- reserved | | | +- semicolon | +- taint | +- threads | +- uninitialized | +- unpack | +- untie | +- utf8 ----------+ | | | +- non_unicode | | | +- nonchar | | | +- surrogate | +- void Just like the "strict" pragma any of these categories can be combined use warnings qw(void redefine); no warnings qw(io syntax untie); Also like the "strict" pragma, if there is more than one instance of the C pragma in a given scope the cumulative effect is additive. use warnings qw(void); # only "void" warnings enabled ... use warnings qw(io); # only "void" & "io" warnings enabled ... no warnings qw(void); # only "io" warnings enabled To determine which category a specific warning has been assigned to see L. Note: Before Perl 5.8.0, the lexical warnings category "deprecated" was a sub-category of the "syntax" category. It is now a top-level category in its own right. Note: Before 5.21.0, the "missing" lexical warnings category was internally defined to be the same as the "uninitialized" category. It is now a top-level category in its own right. =head2 Fatal Warnings X The presence of the word "FATAL" in the category list will escalate warnings in those categories into fatal errors in that lexical scope. B FATAL warnings should be used with care, particularly C<< FATAL => 'all' >>. Libraries using L for custom warning categories generally don't expect L to be fatal and can wind up in an unexpected state as a result. For XS modules issuing categorized warnings, such unanticipated exceptions could also expose memory leak bugs. Moreover, the Perl interpreter itself has had serious bugs involving fatalized warnings. For a summary of resolved and unresolved problems as of January 2015, please see L. While some developers find fatalizing some warnings to be a useful defensive programming technique, using C<< FATAL => 'all' >> to fatalize all possible warning categories -- including custom ones -- is particularly risky. Therefore, the use of C<< FATAL => 'all' >> is L. The L module on CPAN offers one example of a warnings subset that the module's authors believe is relatively safe to fatalize. B Users of FATAL warnings, especially those using C<< FATAL => 'all' >>, should be fully aware that they are risking future portability of their programs by doing so. Perl makes absolutely no commitments to not introduce new warnings or warnings categories in the future; indeed, we explicitly reserve the right to do so. Code that may not warn now may warn in a future release of Perl if the Perl5 development team deems it in the best interests of the community to do so. Should code using FATAL warnings break due to the introduction of a new warning we will NOT consider it an incompatible change. Users of FATAL warnings should take special caution during upgrades to check to see if their code triggers any new warnings and should pay particular attention to the fine print of the documentation of the features they use to ensure they do not exploit features that are documented as risky, deprecated, or unspecified, or where the documentation says "so don't do that", or anything with the same sense and spirit. Use of such features in combination with FATAL warnings is ENTIRELY AT THE USER'S RISK. The following documentation describes how to use FATAL warnings but the perl5 porters strongly recommend that you understand the risks before doing so, especially for library code intended for use by others, as there is no way for downstream users to change the choice of fatal categories. In the code below, the use of C